| Basic Information | |
|---|---|
| Family ID | F011169 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 294 |
| Average Sequence Length | 48 residues |
| Representative Sequence | YDFRKVIDNSLVDRLVKEGFFESLFGPEIKAEEDRKAKLAFR |
| Number of Associated Samples | 215 |
| Number of Associated Scaffolds | 294 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.68 % |
| % of genes near scaffold ends (potentially truncated) | 97.28 % |
| % of genes from short scaffolds (< 2000 bps) | 92.18 % |
| Associated GOLD sequencing projects | 190 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (83.333 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere (6.803 % of family members) |
| Environment Ontology (ENVO) | Unclassified (47.959 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (58.163 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.57% β-sheet: 0.00% Coil/Unstructured: 61.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 294 Family Scaffolds |
|---|---|---|
| PF00005 | ABC_tran | 40.14 |
| PF02900 | LigB | 11.56 |
| PF13709 | DUF4159 | 3.06 |
| PF03737 | RraA-like | 2.72 |
| PF00528 | BPD_transp_1 | 1.36 |
| PF01717 | Meth_synt_2 | 1.02 |
| PF13561 | adh_short_C2 | 0.68 |
| PF03551 | PadR | 0.68 |
| PF09084 | NMT1 | 0.68 |
| PF00498 | FHA | 0.68 |
| PF00645 | zf-PARP | 0.34 |
| PF06762 | LMF1 | 0.34 |
| PF02700 | PurS | 0.34 |
| PF11716 | MDMPI_N | 0.34 |
| PF02518 | HATPase_c | 0.34 |
| PF13502 | AsmA_2 | 0.34 |
| PF13231 | PMT_2 | 0.34 |
| PF05157 | T2SSE_N | 0.34 |
| PF07519 | Tannase | 0.34 |
| PF04295 | GD_AH_C | 0.34 |
| PF13175 | AAA_15 | 0.34 |
| PF00076 | RRM_1 | 0.34 |
| PF08450 | SGL | 0.34 |
| PF13360 | PQQ_2 | 0.34 |
| PF02371 | Transposase_20 | 0.34 |
| PF07609 | DUF1572 | 0.34 |
| PF00440 | TetR_N | 0.34 |
| PF02472 | ExbD | 0.34 |
| PF00583 | Acetyltransf_1 | 0.34 |
| PF00501 | AMP-binding | 0.34 |
| COG ID | Name | Functional Category | % Frequency in 294 Family Scaffolds |
|---|---|---|---|
| COG0684 | RNA degradosome component RraA (regulator of RNase E activity) | Translation, ribosomal structure and biogenesis [J] | 2.72 |
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 1.02 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.68 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.68 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.68 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.68 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.68 |
| COG0848 | Biopolymer transport protein ExbD | Intracellular trafficking, secretion, and vesicular transport [U] | 0.34 |
| COG1828 | Phosphoribosylformylglycinamidine (FGAM) synthase, PurS subunit | Nucleotide transport and metabolism [F] | 0.34 |
| COG2721 | Altronate dehydratase | Carbohydrate transport and metabolism [G] | 0.34 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.34 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.34 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.34 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.33 % |
| Unclassified | root | N/A | 16.67 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459004|F62QY1Z02FJYDO | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 518 | Open in IMG/M |
| 2170459024|GZRSKLJ02FWNDO | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 2199352024|deeps__Contig_92453 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 2228664022|INPgaii200_c0563442 | Not Available | 652 | Open in IMG/M |
| 3300000956|JGI10216J12902_118494602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1671 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_109559745 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300001356|JGI12269J14319_10224528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 718 | Open in IMG/M |
| 3300004080|Ga0062385_10804813 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300004153|Ga0063455_100941767 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300005288|Ga0065714_10149368 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
| 3300005294|Ga0065705_10146164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 2036 | Open in IMG/M |
| 3300005327|Ga0070658_10474464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1079 | Open in IMG/M |
| 3300005329|Ga0070683_101971227 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300005332|Ga0066388_106492855 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
| 3300005336|Ga0070680_100293170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 1379 | Open in IMG/M |
| 3300005337|Ga0070682_100859590 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300005338|Ga0068868_102290950 | Not Available | 515 | Open in IMG/M |
| 3300005338|Ga0068868_102380068 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 506 | Open in IMG/M |
| 3300005339|Ga0070660_100924332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 736 | Open in IMG/M |
| 3300005345|Ga0070692_10050355 | All Organisms → cellular organisms → Bacteria | 2163 | Open in IMG/M |
| 3300005345|Ga0070692_10691016 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 685 | Open in IMG/M |
| 3300005347|Ga0070668_101354662 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300005353|Ga0070669_101264330 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300005356|Ga0070674_100021135 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4172 | Open in IMG/M |
| 3300005366|Ga0070659_100697962 | Not Available | 877 | Open in IMG/M |
| 3300005434|Ga0070709_10679060 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300005436|Ga0070713_100118614 | All Organisms → cellular organisms → Bacteria | 2317 | Open in IMG/M |
| 3300005436|Ga0070713_101240844 | Not Available | 722 | Open in IMG/M |
| 3300005438|Ga0070701_11202839 | Not Available | 538 | Open in IMG/M |
| 3300005455|Ga0070663_101977308 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 524 | Open in IMG/M |
| 3300005458|Ga0070681_11205934 | Not Available | 679 | Open in IMG/M |
| 3300005466|Ga0070685_10874053 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300005467|Ga0070706_102135445 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300005531|Ga0070738_10228086 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 829 | Open in IMG/M |
| 3300005533|Ga0070734_10651499 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300005539|Ga0068853_100092275 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2664 | Open in IMG/M |
| 3300005544|Ga0070686_100570978 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300005544|Ga0070686_101002298 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300005544|Ga0070686_101387147 | Not Available | 589 | Open in IMG/M |
| 3300005545|Ga0070695_100199625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 1429 | Open in IMG/M |
| 3300005547|Ga0070693_101655478 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 504 | Open in IMG/M |
| 3300005563|Ga0068855_101562091 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300005577|Ga0068857_102116360 | Not Available | 552 | Open in IMG/M |
| 3300005578|Ga0068854_101311255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 652 | Open in IMG/M |
| 3300005578|Ga0068854_101970794 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 538 | Open in IMG/M |
| 3300005591|Ga0070761_10551865 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 714 | Open in IMG/M |
| 3300005614|Ga0068856_101260554 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300005614|Ga0068856_102514035 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300005615|Ga0070702_101688288 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 526 | Open in IMG/M |
| 3300005616|Ga0068852_100451881 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1272 | Open in IMG/M |
| 3300005616|Ga0068852_100755142 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300005618|Ga0068864_102672961 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 505 | Open in IMG/M |
| 3300005713|Ga0066905_100981529 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300005764|Ga0066903_102436614 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1012 | Open in IMG/M |
| 3300005764|Ga0066903_103227743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 882 | Open in IMG/M |
| 3300005764|Ga0066903_108081365 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300005829|Ga0074479_10900791 | All Organisms → cellular organisms → Bacteria | 1785 | Open in IMG/M |
| 3300005834|Ga0068851_10397749 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300005836|Ga0074470_11666369 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300005836|Ga0074470_11708518 | All Organisms → cellular organisms → Bacteria | 3708 | Open in IMG/M |
| 3300005841|Ga0068863_100970017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 852 | Open in IMG/M |
| 3300005842|Ga0068858_100553121 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1114 | Open in IMG/M |
| 3300005842|Ga0068858_101275901 | Not Available | 723 | Open in IMG/M |
| 3300005842|Ga0068858_101497288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 665 | Open in IMG/M |
| 3300005843|Ga0068860_100269166 | All Organisms → cellular organisms → Bacteria | 1662 | Open in IMG/M |
| 3300005844|Ga0068862_101149123 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 773 | Open in IMG/M |
| 3300006046|Ga0066652_101138253 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300006046|Ga0066652_101151520 | Not Available | 734 | Open in IMG/M |
| 3300006162|Ga0075030_101113799 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300006175|Ga0070712_101243218 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 648 | Open in IMG/M |
| 3300006176|Ga0070765_101119142 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300006237|Ga0097621_100277356 | Not Available | 1475 | Open in IMG/M |
| 3300006237|Ga0097621_100448469 | All Organisms → cellular organisms → Bacteria | 1162 | Open in IMG/M |
| 3300006237|Ga0097621_101733347 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300006358|Ga0068871_101854204 | Not Available | 573 | Open in IMG/M |
| 3300006806|Ga0079220_12057445 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300006853|Ga0075420_100227242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae | 1626 | Open in IMG/M |
| 3300006853|Ga0075420_101279976 | Not Available | 630 | Open in IMG/M |
| 3300006881|Ga0068865_100264758 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1362 | Open in IMG/M |
| 3300006881|Ga0068865_100463326 | Not Available | 1050 | Open in IMG/M |
| 3300006914|Ga0075436_100432875 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 956 | Open in IMG/M |
| 3300006954|Ga0079219_11903080 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
| 3300007004|Ga0079218_11861046 | Not Available | 678 | Open in IMG/M |
| 3300009089|Ga0099828_11995426 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300009093|Ga0105240_10754044 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1058 | Open in IMG/M |
| 3300009098|Ga0105245_10025043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 5245 | Open in IMG/M |
| 3300009098|Ga0105245_10656631 | Not Available | 1079 | Open in IMG/M |
| 3300009098|Ga0105245_11580717 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300009101|Ga0105247_11272692 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300009148|Ga0105243_10406941 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1265 | Open in IMG/M |
| 3300009148|Ga0105243_11615950 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300009148|Ga0105243_11928253 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 624 | Open in IMG/M |
| 3300009148|Ga0105243_11969914 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 618 | Open in IMG/M |
| 3300009156|Ga0111538_10257331 | All Organisms → cellular organisms → Bacteria | 2209 | Open in IMG/M |
| 3300009156|Ga0111538_10564013 | All Organisms → cellular organisms → Bacteria | 1444 | Open in IMG/M |
| 3300009174|Ga0105241_10593345 | All Organisms → cellular organisms → Bacteria | 1000 | Open in IMG/M |
| 3300009174|Ga0105241_10598995 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 995 | Open in IMG/M |
| 3300009174|Ga0105241_11172251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 726 | Open in IMG/M |
| 3300009176|Ga0105242_10305096 | All Organisms → cellular organisms → Bacteria | 1454 | Open in IMG/M |
| 3300009176|Ga0105242_12813161 | Not Available | 537 | Open in IMG/M |
| 3300009177|Ga0105248_10966919 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300009177|Ga0105248_12303862 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300009218|Ga0103848_1094707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 20-60-12 | 601 | Open in IMG/M |
| 3300009524|Ga0116225_1365106 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 642 | Open in IMG/M |
| 3300009545|Ga0105237_11031311 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300009545|Ga0105237_11503700 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 680 | Open in IMG/M |
| 3300009700|Ga0116217_10554573 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 718 | Open in IMG/M |
| 3300009824|Ga0116219_10544900 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 640 | Open in IMG/M |
| 3300010362|Ga0126377_11877645 | Not Available | 675 | Open in IMG/M |
| 3300010375|Ga0105239_11662275 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300010375|Ga0105239_12904614 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300010375|Ga0105239_13260988 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300010375|Ga0105239_13525053 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 509 | Open in IMG/M |
| 3300010376|Ga0126381_101564486 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 953 | Open in IMG/M |
| 3300010379|Ga0136449_100390927 | All Organisms → cellular organisms → Bacteria | 2474 | Open in IMG/M |
| 3300010399|Ga0134127_12563599 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 590 | Open in IMG/M |
| 3300010401|Ga0134121_10974971 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 830 | Open in IMG/M |
| 3300010401|Ga0134121_13110745 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300010403|Ga0134123_13152938 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300011119|Ga0105246_10046434 | All Organisms → cellular organisms → Bacteria | 2962 | Open in IMG/M |
| 3300011119|Ga0105246_10588045 | Not Available | 960 | Open in IMG/M |
| 3300011119|Ga0105246_10910598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 789 | Open in IMG/M |
| 3300011120|Ga0150983_11012222 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300012038|Ga0137431_1065851 | Not Available | 999 | Open in IMG/M |
| 3300012212|Ga0150985_119369853 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300012212|Ga0150985_121472255 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300012469|Ga0150984_107334139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS191 | 596 | Open in IMG/M |
| 3300012904|Ga0157282_10039565 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
| 3300012929|Ga0137404_11581617 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300012948|Ga0126375_11477903 | Not Available | 580 | Open in IMG/M |
| 3300012971|Ga0126369_10055548 | All Organisms → cellular organisms → Bacteria | 3406 | Open in IMG/M |
| 3300012986|Ga0164304_10436430 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 940 | Open in IMG/M |
| 3300013296|Ga0157374_10171620 | All Organisms → cellular organisms → Bacteria | 2116 | Open in IMG/M |
| 3300013297|Ga0157378_10042446 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4037 | Open in IMG/M |
| 3300013297|Ga0157378_10984175 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300013297|Ga0157378_11275087 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300013297|Ga0157378_13172960 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300013306|Ga0163162_12544995 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300013307|Ga0157372_11366892 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300013308|Ga0157375_10780397 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1105 | Open in IMG/M |
| 3300013766|Ga0120181_1149039 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 508 | Open in IMG/M |
| 3300014325|Ga0163163_10234749 | All Organisms → cellular organisms → Bacteria | 1883 | Open in IMG/M |
| 3300014325|Ga0163163_10926111 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 935 | Open in IMG/M |
| 3300014325|Ga0163163_11034693 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300014325|Ga0163163_11314025 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300014325|Ga0163163_11878449 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300014638|Ga0181536_10036046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3530 | Open in IMG/M |
| 3300014658|Ga0181519_10190253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1295 | Open in IMG/M |
| 3300014745|Ga0157377_10622734 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300014745|Ga0157377_11412999 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300014866|Ga0180090_1023529 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
| 3300014968|Ga0157379_10793765 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300014968|Ga0157379_11271580 | Not Available | 710 | Open in IMG/M |
| 3300014968|Ga0157379_12422026 | Not Available | 524 | Open in IMG/M |
| 3300014968|Ga0157379_12449409 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300014968|Ga0157379_12668832 | Not Available | 501 | Open in IMG/M |
| 3300014969|Ga0157376_10852243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 927 | Open in IMG/M |
| 3300014969|Ga0157376_11251509 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 771 | Open in IMG/M |
| 3300015264|Ga0137403_11117069 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300015264|Ga0137403_11226985 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300015372|Ga0132256_101588737 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300017792|Ga0163161_10597338 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300017926|Ga0187807_1264625 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 566 | Open in IMG/M |
| 3300017943|Ga0187819_10574140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS191 | 640 | Open in IMG/M |
| 3300017948|Ga0187847_10697218 | Not Available | 571 | Open in IMG/M |
| 3300017959|Ga0187779_11101571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS191 | 555 | Open in IMG/M |
| 3300017975|Ga0187782_11374001 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300018012|Ga0187810_10312701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 651 | Open in IMG/M |
| 3300018062|Ga0187784_10366617 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1166 | Open in IMG/M |
| 3300018064|Ga0187773_11094974 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 529 | Open in IMG/M |
| 3300018422|Ga0190265_11247504 | Not Available | 861 | Open in IMG/M |
| 3300018466|Ga0190268_11658095 | Not Available | 567 | Open in IMG/M |
| 3300018476|Ga0190274_10219442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1693 | Open in IMG/M |
| 3300018476|Ga0190274_12068123 | Not Available | 666 | Open in IMG/M |
| 3300019377|Ga0190264_10322924 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 950 | Open in IMG/M |
| 3300020081|Ga0206354_10441263 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300020580|Ga0210403_10563450 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300020583|Ga0210401_11133550 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300020583|Ga0210401_11246019 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 602 | Open in IMG/M |
| 3300021168|Ga0210406_10625207 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300021170|Ga0210400_10148686 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1886 | Open in IMG/M |
| 3300021170|Ga0210400_10585841 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300021181|Ga0210388_11428556 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 580 | Open in IMG/M |
| 3300021406|Ga0210386_10793937 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 814 | Open in IMG/M |
| 3300021433|Ga0210391_11489317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 519 | Open in IMG/M |
| 3300021478|Ga0210402_11981698 | Not Available | 508 | Open in IMG/M |
| 3300022529|Ga0242668_1086918 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 616 | Open in IMG/M |
| 3300022722|Ga0242657_1133367 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 641 | Open in IMG/M |
| 3300022756|Ga0222622_11397236 | Not Available | 515 | Open in IMG/M |
| 3300023067|Ga0247743_1050413 | Not Available | 602 | Open in IMG/M |
| 3300025321|Ga0207656_10251374 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 866 | Open in IMG/M |
| 3300025899|Ga0207642_10854474 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 581 | Open in IMG/M |
| 3300025903|Ga0207680_10957182 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300025904|Ga0207647_10345639 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 843 | Open in IMG/M |
| 3300025906|Ga0207699_10629839 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300025911|Ga0207654_10352234 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
| 3300025911|Ga0207654_10520597 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300025911|Ga0207654_10799159 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 681 | Open in IMG/M |
| 3300025913|Ga0207695_11209742 | Not Available | 636 | Open in IMG/M |
| 3300025914|Ga0207671_11278911 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 572 | Open in IMG/M |
| 3300025919|Ga0207657_10711002 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 780 | Open in IMG/M |
| 3300025919|Ga0207657_11225317 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 569 | Open in IMG/M |
| 3300025924|Ga0207694_11806577 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 514 | Open in IMG/M |
| 3300025927|Ga0207687_10783412 | Not Available | 813 | Open in IMG/M |
| 3300025927|Ga0207687_10860965 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300025927|Ga0207687_11091347 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300025927|Ga0207687_11669300 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300025930|Ga0207701_11655457 | Not Available | 513 | Open in IMG/M |
| 3300025934|Ga0207686_10143629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1653 | Open in IMG/M |
| 3300025934|Ga0207686_10352453 | Not Available | 1108 | Open in IMG/M |
| 3300025934|Ga0207686_10388188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1061 | Open in IMG/M |
| 3300025935|Ga0207709_11111352 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300025937|Ga0207669_11550693 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300025938|Ga0207704_10184134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1512 | Open in IMG/M |
| 3300025938|Ga0207704_10226962 | Not Available | 1386 | Open in IMG/M |
| 3300025938|Ga0207704_10779235 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300025939|Ga0207665_11552834 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300025940|Ga0207691_11173206 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 637 | Open in IMG/M |
| 3300025941|Ga0207711_10008304 | All Organisms → cellular organisms → Bacteria | 8692 | Open in IMG/M |
| 3300025941|Ga0207711_10669827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS191 | 968 | Open in IMG/M |
| 3300025941|Ga0207711_11149550 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300025944|Ga0207661_10793282 | Not Available | 872 | Open in IMG/M |
| 3300025945|Ga0207679_11957193 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300025961|Ga0207712_11072142 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300025981|Ga0207640_10637310 | Not Available | 906 | Open in IMG/M |
| 3300025981|Ga0207640_11436134 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 619 | Open in IMG/M |
| 3300025986|Ga0207658_10763858 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 876 | Open in IMG/M |
| 3300026023|Ga0207677_10139842 | All Organisms → cellular organisms → Bacteria | 1852 | Open in IMG/M |
| 3300026023|Ga0207677_11726144 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300026041|Ga0207639_12145674 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300026075|Ga0207708_10985438 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300026088|Ga0207641_10525661 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1151 | Open in IMG/M |
| 3300026089|Ga0207648_11244964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS191 | 699 | Open in IMG/M |
| 3300026116|Ga0207674_10411636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS113 | 1307 | Open in IMG/M |
| 3300026142|Ga0207698_10408586 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1299 | Open in IMG/M |
| 3300026142|Ga0207698_10861659 | Not Available | 911 | Open in IMG/M |
| 3300026142|Ga0207698_11744783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS191 | 638 | Open in IMG/M |
| 3300026142|Ga0207698_11758532 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300027548|Ga0209523_1071860 | Not Available | 713 | Open in IMG/M |
| 3300027639|Ga0209387_1202369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 546 | Open in IMG/M |
| 3300027812|Ga0209656_10548995 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300027853|Ga0209274_10590959 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300027854|Ga0209517_10005507 | All Organisms → cellular organisms → Bacteria | 16111 | Open in IMG/M |
| 3300027886|Ga0209486_10050671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2077 | Open in IMG/M |
| 3300027886|Ga0209486_11272486 | Not Available | 508 | Open in IMG/M |
| 3300027905|Ga0209415_10260691 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1546 | Open in IMG/M |
| 3300027905|Ga0209415_10662752 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300027907|Ga0207428_10651439 | Not Available | 756 | Open in IMG/M |
| 3300028379|Ga0268266_11176910 | Not Available | 741 | Open in IMG/M |
| 3300028381|Ga0268264_10248004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1653 | Open in IMG/M |
| 3300029636|Ga0222749_10807701 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300029984|Ga0311332_11670114 | Not Available | 518 | Open in IMG/M |
| 3300031199|Ga0307495_10131727 | Not Available | 628 | Open in IMG/M |
| 3300031231|Ga0170824_111369058 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 512 | Open in IMG/M |
| 3300031524|Ga0302320_10545607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS113 | 1381 | Open in IMG/M |
| 3300031538|Ga0310888_10013248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3242 | Open in IMG/M |
| 3300031562|Ga0310886_10059455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1766 | Open in IMG/M |
| 3300031562|Ga0310886_10085746 | All Organisms → cellular organisms → Bacteria | 1533 | Open in IMG/M |
| 3300031708|Ga0310686_101791058 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 974 | Open in IMG/M |
| 3300031708|Ga0310686_114557949 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300031708|Ga0310686_118609821 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300031716|Ga0310813_11564981 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300031716|Ga0310813_11982052 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 549 | Open in IMG/M |
| 3300031740|Ga0307468_102399274 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300031770|Ga0318521_11030847 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 505 | Open in IMG/M |
| 3300031792|Ga0318529_10207300 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 910 | Open in IMG/M |
| 3300031823|Ga0307478_11315750 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300031902|Ga0302322_103689886 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300031902|Ga0302322_103847092 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 513 | Open in IMG/M |
| 3300031913|Ga0310891_10004807 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2875 | Open in IMG/M |
| 3300031939|Ga0308174_11055079 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300031940|Ga0310901_10607392 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300031942|Ga0310916_11517801 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300031944|Ga0310884_10280242 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300031946|Ga0310910_10548266 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 917 | Open in IMG/M |
| 3300031981|Ga0318531_10572985 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 511 | Open in IMG/M |
| 3300031996|Ga0308176_10631341 | All Organisms → cellular organisms → Bacteria | 1104 | Open in IMG/M |
| 3300032012|Ga0310902_10014469 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3318 | Open in IMG/M |
| 3300032017|Ga0310899_10037097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1706 | Open in IMG/M |
| 3300032017|Ga0310899_10220417 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300032075|Ga0310890_11754677 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300032090|Ga0318518_10718935 | Not Available | 508 | Open in IMG/M |
| 3300032144|Ga0315910_10481066 | Not Available | 956 | Open in IMG/M |
| 3300032179|Ga0310889_10010873 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2932 | Open in IMG/M |
| 3300032261|Ga0306920_102058391 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 798 | Open in IMG/M |
| 3300032421|Ga0310812_10112570 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1130 | Open in IMG/M |
| 3300032515|Ga0348332_10546629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1084 | Open in IMG/M |
| 3300032892|Ga0335081_11724900 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 681 | Open in IMG/M |
| 3300033004|Ga0335084_11088521 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300033004|Ga0335084_11203509 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300034090|Ga0326723_0106501 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1215 | Open in IMG/M |
| 3300034177|Ga0364932_0283510 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 6.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 6.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.46% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 5.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.10% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.74% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.40% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.06% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.38% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.38% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.04% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.04% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.70% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.70% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.70% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.70% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.70% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.36% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.36% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.36% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.36% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.36% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.36% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.02% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.02% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.02% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.02% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.02% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.02% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.68% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.68% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.68% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.68% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.68% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.68% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.68% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.34% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 0.34% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.34% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.34% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.34% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.34% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.34% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.34% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.34% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.34% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.34% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.34% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.34% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.34% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.34% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.34% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.34% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.34% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.34% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.34% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.34% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.34% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459004 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm (2) | Environmental | Open in IMG/M |
| 2170459024 | Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005531 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009218 | Microbial communities of water from Amazon river, Brazil - RCM1 | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012038 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012904 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1 | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013766 | Permafrost microbial communities from Nunavut, Canada - A26_65cm_6M | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014866 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT890_16_10D | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022529 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300023067 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S221-509R-5 | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027639 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| 3300034177 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E4B_06911180 | 2170459004 | Grass Soil | YDFRTVIDNSIVERLVREGXFEKLFGPGVKEEEERKAKTAFR |
| FD1_05232180 | 2170459024 | Grass Soil | DNSTVDRLVKEGFFEKLFGNSIKSEQDKKSKLALR |
| deeps_01595850 | 2199352024 | Soil | DNSIVDRLVKEKYFEMLMGVSIKAEEDRKAKLAFK |
| INPgaii200_05634422 | 2228664022 | Soil | IDNSIVDRLVKEGFFEQLFGAGIKTEQERKAKLAYR |
| JGI10216J12902_1184946023 | 3300000956 | Soil | LRAADFKKIIDNSVIDRLVREGFFQQVFGPGVKADEQSKAKLAFK* |
| JGIcombinedJ13530_1095597452 | 3300001213 | Wetland | NSVVERLVKQGFFEQLFGKSIKEEQDRKAKLAFRK* |
| JGI12269J14319_102245281 | 3300001356 | Peatlands Soil | QVGARLKAYDFHKVIDNSVVERLVREHFFENLFGPSIKAEEDARAKLAFK* |
| Ga0062385_108048131 | 3300004080 | Bog Forest Soil | DFHKVIDNSYVSKLVKEGFFEQLFGPSVKAEEQRKAKLAFGK* |
| Ga0063455_1009417672 | 3300004153 | Soil | FRKVIDNSTVERLVKEGFFEQLFGAEVKAEEQQRAKIAFQK* |
| Ga0065714_101493681 | 3300005288 | Miscanthus Rhizosphere | RTVIDNSVVDRLVKEGFFEKTFGPGVKSEQEARSKQAMR* |
| Ga0065705_101461641 | 3300005294 | Switchgrass Rhizosphere | RLSADLKAYDFHKVIDNGTVARLVKEGFFQSLFGPGVKAEETRKAGQAYK* |
| Ga0070658_104744641 | 3300005327 | Corn Rhizosphere | DFRTVVDNATVDRLVREGFFEKLYGPAIKAAEDRQAKTAFR* |
| Ga0070683_1019712272 | 3300005329 | Corn Rhizosphere | VPYVLAGAVKSVVDQQADPQIAAQMKAYDFKKVVDNSIVERLVKQGFFDMLFGPSIKAEEDRKAKQAFGK* |
| Ga0066388_1064928551 | 3300005332 | Tropical Forest Soil | FDYRKVADNGTVDRLVKEGFFEKLFGMSVKAEEDRKSRLAFK* |
| Ga0070680_1002931703 | 3300005336 | Corn Rhizosphere | IAARMKAYDFHQVIDNSTVARLVKEKYFETLFGPSIKAEEDRKAKLAFK* |
| Ga0070682_1008595901 | 3300005337 | Corn Rhizosphere | ELYAKPKAFERIPYVLDDGVKAVVAQQSDPQLAAQMKAYDFRKVIDNSVIERLVKEKYFEMLMGASIKAEEDRKAKLAFK* |
| Ga0068868_1022909502 | 3300005338 | Miscanthus Rhizosphere | FNVKTIVDNSAIDRLVKEGFFEKLFGSSIKAEIDRKSKMAFR* |
| Ga0068868_1023800681 | 3300005338 | Miscanthus Rhizosphere | VLAPAVQWIVDHQADPQIGAQLKAYDFHKVIDNSVVERLVREKFFANLFGPTIRAEEERKGNLAFK* |
| Ga0070660_1009243322 | 3300005339 | Corn Rhizosphere | EHQADPQIGARMKAYDFRKVIDNSVVERLVREHFFENLFGPSIKAEEDRKGKLAFK* |
| Ga0070692_100503551 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | KAYDFHKVIDNSIIDRLVKEKYFETLFGATIKAEEDRKAKLAFK* |
| Ga0070692_106910162 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | EHQADAQTGARLKAYDFHKVIDNSVVERLVREHFFENLFGPSIKAEEDRKAKMAFK* |
| Ga0070668_1013546622 | 3300005347 | Switchgrass Rhizosphere | ADLKAYDFHKVIDNGTVVRLVKEGFFQSLFGPGVKAEETRKAGQAYK* |
| Ga0070669_1012643301 | 3300005353 | Switchgrass Rhizosphere | ADLKAYDFHKVIDNGTVARLVKEGFFQSLFGPGVKAEETRKAGQAYK* |
| Ga0070674_1000211356 | 3300005356 | Miscanthus Rhizosphere | GFDFRTVIDNGVVARLVREGYFQTLFGAGVKAEEDRKSKIAFR* |
| Ga0070659_1006979621 | 3300005366 | Corn Rhizosphere | AAVKFILDHVADPQISAQMRAYDFRKVIDNSLVDRLVKEGFFESLFGPEIKAEEDRKAKLAFR* |
| Ga0070709_106790601 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | AYDFHKVVDNSTVDRLVKEKFFDTLFGASIKAEEDRKAKLAFK* |
| Ga0070713_1001186141 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | DFHKVIDNSTIDRLIKEKYFEMLFGPAIKAEEDRKAKLAFK* |
| Ga0070713_1012408442 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | NFHTVIDNSIVERLVKEGFFEQLFGPRIKAEEDLKAKLAFR* |
| Ga0070701_112028392 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | KGYDFRKVIDNSVVARLVKDGYFQQVFGPGVKAEEQSKASMAFK* |
| Ga0070663_1019773081 | 3300005455 | Corn Rhizosphere | IGARLKAYDFHKVIDNSVVERLVREHFFENLFGPSIKAEEDARGKLAFK* |
| Ga0070681_112059342 | 3300005458 | Corn Rhizosphere | YDFRKVIDNSLVDRLVKEGFFESLFGPEIKAEEDRKAKLAFR* |
| Ga0070685_108740532 | 3300005466 | Switchgrass Rhizosphere | FRTVVDNSTVDRLVKEGFFQKLFGAGIKSEEERKSKLALR* |
| Ga0070706_1021354451 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | ELYAKPKAFERIPYVLADGVKAVVAQQSDPQLAAQMKAYDFHKVIDNSIIERLVKEKYFETLFGAPIRAEEDRKAKLAFK* |
| Ga0070738_102280862 | 3300005531 | Surface Soil | AAHQADPNLGAQMKAYDFHKVIDNSIVEKLVREHFFEQLFGSGIKAEEDSKARLAFR* |
| Ga0070734_106514992 | 3300005533 | Surface Soil | RMVVDNSVVDRLVKEGFFEQTFGKSIKAEEDRKSKTAFR* |
| Ga0068853_1000922754 | 3300005539 | Corn Rhizosphere | YDFHKVIDNSVVERLVREHFFENLFGSSIKAQEDARAKLAFK* |
| Ga0070686_1005709781 | 3300005544 | Switchgrass Rhizosphere | YERIPYVLAPAVQWIIEHQADPQIGARMKAYDFRKVIDNSVVERLVREKFFENLFGPSIKAEEDRKGKLAFK* |
| Ga0070686_1010022982 | 3300005544 | Switchgrass Rhizosphere | DPQLAAQMKAYDFHKVIDNSIIDRLVKEKYFETLFGATIKAEEDRKAKLAFK* |
| Ga0070686_1013871471 | 3300005544 | Switchgrass Rhizosphere | EHQPDAQIAAQMKAYDFTRVIDNSVVDRLVKEHFFEQLFGAGIKAEQDSKAKIAFK* |
| Ga0070695_1001996253 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | VVEQQSDPQIAAQMKAYDFHKVVDNSTVDRLVKEKFFDTLFGASIKAEEDRKAKLAFK* |
| Ga0070693_1016554782 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | DRKAESYERIPCVLAPAVQYIVEHQADAQVGARLKAYDFHKVIDNSVVERLVREHFFENLFGPSIKAEEDARAKLAFK* |
| Ga0068855_1015620912 | 3300005563 | Corn Rhizosphere | DPNISAQMKSYDFKKVIDNSYVDKVVKQGFFEQLFGPSIKADEQRRAKLAFGK* |
| Ga0068857_1021163601 | 3300005577 | Corn Rhizosphere | NATVDRLVKEGFFEKLYGSTIKAQEAQSAKTAYR* |
| Ga0068854_1013112551 | 3300005578 | Corn Rhizosphere | FDFRTVVDNATVDRLVREGFFEKLYGPAIKAAEDRQAKTAFR* |
| Ga0068854_1019707941 | 3300005578 | Corn Rhizosphere | HQADPQIGARMKAYDFRKVIDNSVVERLVREHFFENLFGPSIKAEEDRKGKLAFK* |
| Ga0070761_105518652 | 3300005591 | Soil | PAVQYIIDHQADARIAAQMKAYDFHNVIDNSVVDRLVKEHFFEQLFGPEIKAEQDSKARLEFK* |
| Ga0068856_1012605542 | 3300005614 | Corn Rhizosphere | YDFHKVIDNSYVERLVKQGFFEQTFGPSVKAEEQRKAKLDFGK* |
| Ga0068856_1025140352 | 3300005614 | Corn Rhizosphere | KAVVAQQSDPQLAAQMKAYDFHKVIDNSIVDRLVKEKYFEMLMGASIKAEEDRKAKLAFK |
| Ga0070702_1016882882 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | FHKVIDNSVVEKLVREHFFENLYGPSVKAEQDRKAKLAFR* |
| Ga0068852_1004518811 | 3300005616 | Corn Rhizosphere | AVKYIQEHQADAQTGARLKAYDFHKVIDNSVVERLVREHFFENLFGPSIKAEEDRKAKMAFK* |
| Ga0068852_1007551422 | 3300005616 | Corn Rhizosphere | AKPKAFERIPYVLADGVKAVVAQQSDPQLAAQMKAYDFHKVIDNSVIERLVKEKYFEMLFGPTIKAEEDRKAKLAFK* |
| Ga0068864_1026729612 | 3300005618 | Switchgrass Rhizosphere | ERIPYVLAPAVQWIVEHQADPQIGARLKAYDFHKVIDNSVVERLVREKFFENLFGPAIKAEEDRKGKLAFK* |
| Ga0066905_1009815292 | 3300005713 | Tropical Forest Soil | NGTVARLVKEGYFQSLYGPAVKAEESRKAGQAYK* |
| Ga0066903_1024366143 | 3300005764 | Tropical Forest Soil | NTLVARLVQEGYFEKLFGPSIKDEEERKAKLAFR* |
| Ga0066903_1032277432 | 3300005764 | Tropical Forest Soil | VLDNSIVDKLVREGFFEQLFGLQVRAEQEQKQKIAFQ* |
| Ga0066903_1080813652 | 3300005764 | Tropical Forest Soil | IDFKTVIDNSVVDKLAKEGFFEKTFGAGVKSEQESRSKQAMR* |
| Ga0074479_109007911 | 3300005829 | Sediment (Intertidal) | VDNSVIDRLVKEGFFEKLFGGGIKSEIDRRSKLAFR* |
| Ga0068851_103977492 | 3300005834 | Corn Rhizosphere | AQMKAYDFHKVVDNSTVERLVKEKFFETLFGATIKAEEDRKAKLAFK* |
| Ga0074470_116663691 | 3300005836 | Sediment (Intertidal) | IDNSTVDRLVRSGFFEQLFGPAIKAEEERKAKLAFR* |
| Ga0074470_117085181 | 3300005836 | Sediment (Intertidal) | IVDNSIVTRLVKEKFFETLFGPSIKAEEDRKAKLAFK* |
| Ga0068863_1009700172 | 3300005841 | Switchgrass Rhizosphere | YVLAPAVQWIVEHQADAQIGAQLKAYDFHKVIDNSVVERLVREKFFENLFGPTIKAEEDRKGKLAFK* |
| Ga0068858_1005531212 | 3300005842 | Switchgrass Rhizosphere | LAPAVQWIVEHQADAQIGAQLKAYDFHKVIDNSVVEKLVREHFFENLYGPSVKAEQDRKAKIAFK* |
| Ga0068858_1012759013 | 3300005842 | Switchgrass Rhizosphere | KVIDNSIVERLVKAGYFVQLSGPGLKAEETMKASQAFK* |
| Ga0068858_1014972881 | 3300005842 | Switchgrass Rhizosphere | KYILDHVADPQISAQMKVFDFRKVIDNSLVDRLVKERYFENLFGPEIKAEEDRKTKTAFR |
| Ga0068860_1002691661 | 3300005843 | Switchgrass Rhizosphere | SAQMRAYDFRKVIDNSLVDRLVKERFFETLFGPEIKAEEDRKAKLAFR* |
| Ga0068862_1011491231 | 3300005844 | Switchgrass Rhizosphere | DNSVVERLVREHFFENLFGPSIKAEEDARAKLAFK* |
| Ga0066652_1011382531 | 3300006046 | Soil | AFDFKKVVDNSIVDRLVKEGFFETLFGTTIKAEEERKSKLALR* |
| Ga0066652_1011515201 | 3300006046 | Soil | MRAYDFRKVIDNSLVDRLVKEGFFESLFGPEIRAEEDRKAKLAFR* |
| Ga0075030_1011137991 | 3300006162 | Watersheds | VVDHSIVDRLVKEGFFEQVFGPKIKEEEARKSKLAFR* |
| Ga0070712_1012432181 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | FRTVIDNTAVDRLVREGFFEKLYGVGIKAEEDRQAKASFR* |
| Ga0070765_1011191422 | 3300006176 | Soil | VAQQSDPQIAAQMKAYDFHQVIDNSTVERLVKEKFFETLFGATIKAEEDRKAKLAFK* |
| Ga0097621_1002773563 | 3300006237 | Miscanthus Rhizosphere | TIVDNSAIDRLVKEEFFEKLFGSSIKAEIDRKSKMAFR* |
| Ga0097621_1004484693 | 3300006237 | Miscanthus Rhizosphere | ADLKAFDFRKVVDNSTVDRLVKEGFFEQLFGPDVKTEEQQRAKIAFGK* |
| Ga0097621_1017333472 | 3300006237 | Miscanthus Rhizosphere | VVEQQSDPQIAAQMKAYDFHKVVDDSTVDRLVKEKFFDTLFGASIKAEEDRKAKLAFK* |
| Ga0068871_1018542042 | 3300006358 | Miscanthus Rhizosphere | VADPQISAQMRAYDFHKVIDNGLVDRLVKEGFFESVFGPDVKAEEDRKAKLAFR* |
| Ga0079220_120574452 | 3300006806 | Agricultural Soil | AAAVKAVVEQQSDPQLAAQMKAYDFHKVVDNSTVDRLVKEKFFETLFGAPIKAEEDRKAKLAFK* |
| Ga0075420_1002272423 | 3300006853 | Populus Rhizosphere | NGTVARLVKEGFFQSLFGPGVKAEETRKAGQAYK* |
| Ga0075420_1012799761 | 3300006853 | Populus Rhizosphere | TVIDNSIVTRLVKEGFFQKLFGPAIKAEEDRKSKMAFR* |
| Ga0068865_1002647581 | 3300006881 | Miscanthus Rhizosphere | IDNSLVDRLVKEGFFETLFGPEIKAEEDRKAKLAFR* |
| Ga0068865_1004633262 | 3300006881 | Miscanthus Rhizosphere | AVIDNSVIDRLVKEGFFEKLFGAGVKSEIDRKSKLAFR* |
| Ga0075436_1004328751 | 3300006914 | Populus Rhizosphere | FHKVIDNSVVERLVREHFFENLYGASVKAEEDKKAKLAFK* |
| Ga0079219_119030801 | 3300006954 | Agricultural Soil | NSIVDRLVKEGFFEKLFGPSIKAEEERKAKLAFR* |
| Ga0079218_118610462 | 3300007004 | Agricultural Soil | DNSLVARLVKEGFFEKLFGAGVKAEEDRKAKLAFR* |
| Ga0099828_119954261 | 3300009089 | Vadose Zone Soil | NGLIDRLVKEGFFEKTFGPSIKSEQDKKSKAAYR* |
| Ga0105240_107540443 | 3300009093 | Corn Rhizosphere | KKFDFRTVIDNAIVDRLVKEGFFEKLYGASIKAQEDRSAKSSFR* |
| Ga0105245_100250431 | 3300009098 | Miscanthus Rhizosphere | SDPQIAAQMKAYDFHKVVDNGTVDRLVKEKFFETLFGATIKAEEDRKAKLAFK* |
| Ga0105245_106566311 | 3300009098 | Miscanthus Rhizosphere | ILEHVADPQISAQMRAYDFRKVIDNSLVDRLVKEGFFETLFGPEIKAEEDRKAKLAFR* |
| Ga0105245_115807172 | 3300009098 | Miscanthus Rhizosphere | RKIIDNGVVDKLVKEGFFQQVFGPGVKAEEQSKAKLAFGK* |
| Ga0105247_112726921 | 3300009101 | Switchgrass Rhizosphere | AYDFHKVVDNSTVERLVKEKFFETLFGATIKAEEDRKAKLAFK* |
| Ga0105243_104069411 | 3300009148 | Miscanthus Rhizosphere | QADPQIGARMKAYDFRKVIDNSVVERLVREHFFENLFGPSIKAEEDRKGKLAFK* |
| Ga0105243_116159502 | 3300009148 | Miscanthus Rhizosphere | FRKVIDNSVIERLVKEKYFEMLFGATIKAEEDRKAKLAFK* |
| Ga0105243_119282532 | 3300009148 | Miscanthus Rhizosphere | IDNSIVQRLVEQGYFRDLFGAGVKAEEERKAAIAFR* |
| Ga0105243_119699141 | 3300009148 | Miscanthus Rhizosphere | IVDNSAIDRLVKEGFFEKLFGSSIKAEIDRKSKMAFR* |
| Ga0111538_102573314 | 3300009156 | Populus Rhizosphere | FDFRKIIDNGVVDKLVKEGFFQQVFGPGVKAEEQSKAKLAFGR* |
| Ga0111538_105640133 | 3300009156 | Populus Rhizosphere | TKAIDFKTVIDNSVIDRLVKEGFFEKTFGAGVKSEQESRSKQAMR* |
| Ga0105241_105933451 | 3300009174 | Corn Rhizosphere | AFERIPYVLADGVKAVVAQQSDPQLAAQMKAYDFHKVIDNSIVDRLVKEKYFEMLMGASIKAEEDRKAKLAFK* |
| Ga0105241_105989952 | 3300009174 | Corn Rhizosphere | EHQADAQVGARLKAYDFHKVIDNSVVERLVREHFFENLYGTSVKAEEDKKAKLAFK* |
| Ga0105241_111722511 | 3300009174 | Corn Rhizosphere | RIPYVLAPAVQWIIEHQADPQIGARMKAYDFRKVIDNSVVERLVREKFFENLFGPSIKAEEDRKGKLAFK* |
| Ga0105242_103050961 | 3300009176 | Miscanthus Rhizosphere | KFDFRTVIDNATVDRLVRAGFFQKLFGPGVKEEEQRKEKLAFR* |
| Ga0105242_128131612 | 3300009176 | Miscanthus Rhizosphere | VIDNSVIDRLVKEGFFEKLFGPGVKSEIDRKSKLAFR* |
| Ga0105248_109669192 | 3300009177 | Switchgrass Rhizosphere | DVERIYELYAKPKAFERIPYVLGDGVKAVVAQQSDPQLAAQMKAYDFRKVIDNSVIERLVKEKYFEMLFGATIKAEEDRKAKLAFK* |
| Ga0105248_123038622 | 3300009177 | Switchgrass Rhizosphere | YILEHVADPQISAQMRAYDFRKVIDNSLVDRLVKEGFFETLFGPEIKAEEDRKAKLAFR* |
| Ga0103848_10947072 | 3300009218 | River Water | VKSVLDQQADPQIAAQMKGYDWKKVIDNSYVEKLVKDGFYEQLFGASIKAEEQKKAKAAFGK* |
| Ga0116225_13651062 | 3300009524 | Peatlands Soil | YERIPYVLAPAVQYIVEHQADAQVGARLKAYDFHKVIDNSVVERLVREHFFENLFGPSIKAEEDARAKLAFK* |
| Ga0105237_110313112 | 3300009545 | Corn Rhizosphere | AVKAVVAEQSDPQIAAQMKAYDFHKVIDNSTIDRLIKEKYFEMLFGPAIKAEEDRKAKLAFK* |
| Ga0105237_115037002 | 3300009545 | Corn Rhizosphere | QADAQVGARLKAYDFHKVIDNSVVERLVREHFFENLYGASVKAEEDKKAKLAFK* |
| Ga0116217_105545731 | 3300009700 | Peatlands Soil | QVGARLKAYDFHKVIDNSVVERLVREHFFENLFGSSIKAEEDARAQLAFK* |
| Ga0116219_105449001 | 3300009824 | Peatlands Soil | HDRKAESYERIPYVLAPAVQYIVEHQADAQVGARLKAYDFHKVIDNSVVERLVREHFFENLFGPSIKAEEDARAKLAFK* |
| Ga0126308_111716552 | 3300010040 | Serpentine Soil | MDAAVKSIVAQQVDQRLAADLKAFDFHKVVDNRTVDRLVKEGFFQTLFGQGIKTEEQRKASLAFK* |
| Ga0126377_118776451 | 3300010362 | Tropical Forest Soil | FDFKTVLDNSIVERLVKEGFFEKTFGPSIKAEIDRKSKMAFR* |
| Ga0105239_116622752 | 3300010375 | Corn Rhizosphere | EQQSDPQISSQMKAYDFHKVIDNSTVERLVKEKFFETLFGATIKAEEDRKAKLAFK* |
| Ga0105239_129046141 | 3300010375 | Corn Rhizosphere | NSTVDRLVKEKFFDTLFGASIKAEEDRKAKLAFK* |
| Ga0105239_132609881 | 3300010375 | Corn Rhizosphere | GVKAVVAQQSDPQLAAQMKAYDFHKVIDNSIVDRLVKEKYFEMLMGASIKAEEDRKAKLAFK* |
| Ga0105239_135250532 | 3300010375 | Corn Rhizosphere | YVLAPAVQYIVEHQADPQVGARLKAYDFHKVIDNSVVERLVREHFFENLFGPSIKAEEDARAKLAFK* |
| Ga0126381_1015644861 | 3300010376 | Tropical Forest Soil | DFRTVIDNGTVDYLVRQGFFEKLFGPGVKAEENRKEKLATRK* |
| Ga0136449_1003909271 | 3300010379 | Peatlands Soil | HKVIDNSYVSKLVKEGFFEQLFGPSVKAEEQRKAKLAFGK* |
| Ga0134127_125635992 | 3300010399 | Terrestrial Soil | VIDNSLVERLVREKFFENLFGPTIKAEEDRKGKLAFK* |
| Ga0134121_109749711 | 3300010401 | Terrestrial Soil | IDNSVVERLVREKFFENLFGPSIKAEEDRKGKLAFK* |
| Ga0134121_131107451 | 3300010401 | Terrestrial Soil | VDNGPVDRLVKAGFFEKLFGPSIKAEEDRKSKLALR* |
| Ga0134123_131529381 | 3300010403 | Terrestrial Soil | VVDNSIVDRLVKEGFFEKLFGSGIKAEEEHKSKLALR* |
| Ga0105246_100464345 | 3300011119 | Miscanthus Rhizosphere | LAAQMKAYDFRKVIDNSVIERLVKEKYFEMLMGASIKAEEDRKAKLAFK* |
| Ga0105246_105880452 | 3300011119 | Miscanthus Rhizosphere | VPAPGLDRLVKEGFFEKLFGSGIRAEIDRKSKMAFR* |
| Ga0105246_109105981 | 3300011119 | Miscanthus Rhizosphere | MKAYDFRKVIDNSVVERLVREKFFENLFGPSIKAEEDRKGKLAFK* |
| Ga0150983_110122221 | 3300011120 | Forest Soil | YVLAGADKAVVAQQSDPQIAAQMKAYDFHKVIDNSTVERLVKEKFFETLFGATIKAEEDRKAKLAFK* |
| Ga0137431_10658511 | 3300012038 | Soil | RTVIDNGVVARLVREGYFQKLFGPGVKAEEDRKSKLAFR* |
| Ga0150985_1193698532 | 3300012212 | Avena Fatua Rhizosphere | AVLKAFDAHKLVDNSYVDKLVKENFFVNLFGPSVKAEQERKSKLAFK* |
| Ga0150985_1214722551 | 3300012212 | Avena Fatua Rhizosphere | YDFHKVIDNSVVDRLVKQGFFENLFGADIKAEEQRKAKLAFR* |
| Ga0150984_1073341392 | 3300012469 | Avena Fatua Rhizosphere | KAYDFHKVIDNSFVDRLVKQGFFEQLFGPSIKAEEQRKAKLAFSR* |
| Ga0157282_100395653 | 3300012904 | Soil | VIDNGTVARLVKEGFFQSLFGPGVKAEETRKAGQAYK* |
| Ga0137404_115816172 | 3300012929 | Vadose Zone Soil | AAQMKAYDFHKVIDNSVIERLVKEKYFEMLFGATIKADEDRKAKLAFK* |
| Ga0126375_114779032 | 3300012948 | Tropical Forest Soil | QMAKFDFRTVLDNSIVDRLVKEGFFEKLFGAGIRAEEERKAKIVFK* |
| Ga0126369_100555483 | 3300012971 | Tropical Forest Soil | VLDNSIVEPLVKEGFFEKLFGAGIKAEEERKAKIAFR* |
| Ga0164304_104364303 | 3300012986 | Soil | FDFRTVIDNSAVDRLIKEGFFEKLYGAGIKAEEDRQAKTAFR* |
| Ga0157374_101716201 | 3300013296 | Miscanthus Rhizosphere | NSIVQRLVEQGYFRDLFGAGVKAEEERKAAIAFR* |
| Ga0157378_100424465 | 3300013297 | Miscanthus Rhizosphere | AQMRAYDFHKVIDNSLVDRLVKEGFFESLFGPEIKAEEDRKTKLAFR* |
| Ga0157378_109841753 | 3300013297 | Miscanthus Rhizosphere | AQMRAYDFHKVIDNSLVDRLVKEGFFESLFGPEIKAEEDRKAKLAFR* |
| Ga0157378_112750872 | 3300013297 | Miscanthus Rhizosphere | IDNSVIERLVKEKYFEMLFGATIKAEEDRKAKLAFK* |
| Ga0157378_131729602 | 3300013297 | Miscanthus Rhizosphere | VIDNAAVDRLVREGFFEKLYGPTIKIQEDRSAKTAFR* |
| Ga0163162_125449951 | 3300013306 | Switchgrass Rhizosphere | LYAKPKAFERIPYVLGDGVKAVVAQQSDPQLAAQMKAYDFRKVIDNSVIERLVKEKYFEMLFGATIKAEEDRKAKLAFK* |
| Ga0157372_113668921 | 3300013307 | Corn Rhizosphere | IAAQMKAYDFHKVVDNSTVERLVKEKFFETLFGATIKADEDRKAKLAFK* |
| Ga0157375_107803972 | 3300013308 | Miscanthus Rhizosphere | IDNSIVQRLVDQGYFRDLFGAGVKAEEERKAAIAFR* |
| Ga0120181_11490391 | 3300013766 | Permafrost | YVLAPAVQYIVDHQADAQVGARLKAYDFHKVIDNSVVERLVREHFFENLFGPSVKAEEDRKAKLAFK* |
| Ga0163163_102347494 | 3300014325 | Switchgrass Rhizosphere | VLADGVKAVVAQQSDPQLAAQMKAYDFHKVIDNSVIDRLVKEKYFEMLMGASIKTEEDRKAKLAFK* |
| Ga0163163_109261111 | 3300014325 | Switchgrass Rhizosphere | SYERIPYVLAPAVQWIVDHQADPQIGAQLKAYDFHKVIDNSVVERLVREKFFANLFGPTIRAEEERKGNLAFK* |
| Ga0163163_110346931 | 3300014325 | Switchgrass Rhizosphere | LKKFDFRTVIDNATVDRLVKEGFFEKLYGSGIKAAEDRQAKSAFR* |
| Ga0163163_113140251 | 3300014325 | Switchgrass Rhizosphere | LEHVADPQIAAQMRAYDFHKVIDNSLVDRLVKEGFFEQLFGANIKSEEQQRAKIAFGK* |
| Ga0163163_118784492 | 3300014325 | Switchgrass Rhizosphere | YDFRKVIDNSVIERLVKEKYFEMLFGATIKAEEDRKAKLAFK* |
| Ga0181536_100360461 | 3300014638 | Bog | AQMKAYDFHKVIDNSYVSKLVKDGFFEQLFGPSIKAEEQRKARLAFGK* |
| Ga0181519_101902533 | 3300014658 | Bog | VIDNSYVSKLVKEGFFEQLFGPSIKAEEQRKAKLAFGK* |
| Ga0157377_106227341 | 3300014745 | Miscanthus Rhizosphere | VIDNSTVDRLVKEGFFDQLFGASIKTEEQQRAKIAFGK* |
| Ga0157377_114129992 | 3300014745 | Miscanthus Rhizosphere | AQMKAYDFRKVIDNSVIERLVKEKYFEMLFGATIKAEEDRKAKLAFK* |
| Ga0180090_10235291 | 3300014866 | Soil | HKVIDNGTVARLVKEGFFQSLFGPGVKAEETRKAGQAYK* |
| Ga0157379_107937651 | 3300014968 | Switchgrass Rhizosphere | LKKFDFRTVIDNATVDRLVKEGFFEKLYGAGIKAQEDRSAKTAFR* |
| Ga0157379_112715801 | 3300014968 | Switchgrass Rhizosphere | NSLVDRLVKERFFESLFGPEIKAEEDRKAKLAFR* |
| Ga0157379_124220261 | 3300014968 | Switchgrass Rhizosphere | AKCRLLALNRLVKEGFFENLFGNGIRAEIDRKSKMAFR* |
| Ga0157379_124494092 | 3300014968 | Switchgrass Rhizosphere | KAVVDQQSDAQIMAQMKAYDFHKIIDNSTVDHLVKEKFFETLFGAKIKAEEDRKAKLAFK |
| Ga0157379_126688321 | 3300014968 | Switchgrass Rhizosphere | HQPDAQIAAQMKAYDFTKVIDNSVIDRLVKEHFFEQLFGAGIKAEQDSKAKIAFK* |
| Ga0157376_108522432 | 3300014969 | Miscanthus Rhizosphere | VPYVLAPAAKAVVEQQSDPQIAAQMKAYDFHKVIDNSTVERLVKEKFFETLFGTTIKAEEDRKAKLAFK* |
| Ga0157376_112515092 | 3300014969 | Miscanthus Rhizosphere | QIMAQMKAYDFHKIIDNSTVDHLVKEKFFETLFGAKIKAEEDRKAKLAFK* |
| Ga0137403_111170692 | 3300015264 | Vadose Zone Soil | SDPQLAAQMKAYDFHKVIDNSVIERLVKEKYFEMLFGATIKADEDRKAKLAFK* |
| Ga0137403_112269851 | 3300015264 | Vadose Zone Soil | QLAEQMSKFDFHKAIDNSYVDRLVKEGFFEMLFGPSIKAEEQRKAKLAFK* |
| Ga0132256_1015887371 | 3300015372 | Arabidopsis Rhizosphere | NGVVDRLVKAGFFKRLFGDEIRAEEELKAKIAFR* |
| Ga0163161_105973381 | 3300017792 | Switchgrass Rhizosphere | VVDNSTVDRLVKEGFFEKLFGTEIKSEENRKSKLALR |
| Ga0187807_12646252 | 3300017926 | Freshwater Sediment | VPYVLAPAVDYIIHHQADANIAKQMQAYDFHKVIDNSVIDRLVKEHFFEQLFGSGIKAEEDAKSKLAFK |
| Ga0187819_105741402 | 3300017943 | Freshwater Sediment | AQMKAYDFHKVIDNSYVEKLVKDGSFEKIFGASIKADEERKAKEMYK |
| Ga0187847_106972181 | 3300017948 | Peatland | IDNSMVARLVREGFFEKLFGPGVKAEQDRKEKLAYR |
| Ga0187779_111015711 | 3300017959 | Tropical Peatland | ILEHVADPQIAAQMKAYDFHKVVDNSTVERLVKEKFFEMLFGASIKAEEDRKAKLAFK |
| Ga0187782_113740012 | 3300017975 | Tropical Peatland | VDNSIVDRLVRRGFFEDLFGPGIKSEQQKKAALAL |
| Ga0187810_103127011 | 3300018012 | Freshwater Sediment | YDFHKVIDNSVVERLVQEHFFEQLFGSGIQAEEERKAKLAFK |
| Ga0187784_103666171 | 3300018062 | Tropical Peatland | RGYDYRKVIDNSYVDRLVKEGFFEMLYGPSIKAEEDRKARLQFK |
| Ga0187773_110949742 | 3300018064 | Tropical Peatland | PYVLAPAVQYIVEHQADPQVGARLKAYDFHKVIDNSVVDRLVKEHFFENLFGPGVKAEEDRKKKMAF |
| Ga0190265_112475041 | 3300018422 | Soil | KGFDYHTVIDNSTVRRLVKEGFFRQLFGSGIKAEEDRKAKLAF |
| Ga0190268_116580951 | 3300018466 | Soil | NAGNYRTLIDNSTVDRLVKEGFFQKLFGPSIRAEEERKAKLAFR |
| Ga0190274_102194421 | 3300018476 | Soil | RLSADLKAYDFHKVIDNGTVVRLVKEGFFQSLFGPGVKAEETRKAGQAYK |
| Ga0190274_120681232 | 3300018476 | Soil | DNGVVARLVREGYFQTLFGAGVKAEEDRKSKIAFR |
| Ga0190264_103229241 | 3300019377 | Soil | FKKVVDNSAVDKLVKEGFFQKVFGPQIKAEEQSKAKLAFR |
| Ga0206354_104412632 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | QMKAYDFRKSIDNSVIDRLVKEHYFEQLFGPSVKAEEEAKSKIAVR |
| Ga0210403_105634502 | 3300020580 | Soil | QIAAQMKAYDFHKVIDNSTVERLVKEKFFETLFGATIKAEEDRKAKLAFK |
| Ga0210401_111335502 | 3300020583 | Soil | IDNTIVDRLVKEGFFEQLFGASVKAEEESKTKLAFR |
| Ga0210401_112460192 | 3300020583 | Soil | HQADANIAAQMKAFDFRKVIDNSVTDRLVREHFFEHLFGPGVKAEEESKAKIAVK |
| Ga0210406_106252072 | 3300021168 | Soil | DFHMVIDNSIVDSLVKQGFFEQLFGPSIKAEEQRKSKLAFRK |
| Ga0210400_101486864 | 3300021170 | Soil | AQQSDPQIAAQMKAYDFHKVIDNSTVERLVKEKFFETLFGPTVKAEEDRKAKLAFK |
| Ga0210400_105858412 | 3300021170 | Soil | DFHKVIDNSYVSKLVKEDFFEKLYGPSIKAEQQRKAKLAYGR |
| Ga0210388_114285562 | 3300021181 | Soil | VQYIVDHQADARIAAQMKAYDFHKVIDNSVVERLVREHYFEQLFGPEIKAEQDSKARLEF |
| Ga0210386_107939372 | 3300021406 | Soil | VPYVLAPAVQYIVEHQADANIAAQMKAYDFHKVIDNSVVERLVKEHFFEQLFGQGIKAEQDSKGRLEFK |
| Ga0210391_114893171 | 3300021433 | Soil | DPQIAAQMKAYDFHKVIDNSYVSKLMKEGFFEQLFGPSIKAEEQRKAKLAFGK |
| Ga0210402_119816981 | 3300021478 | Soil | FHKVIDNSLVDRLVKEGFFESLFGPGVKAEEDRKAKIAFR |
| Ga0242668_10869182 | 3300022529 | Soil | ADANIAAQMKAFDFRKVIDNSVTDRLVREHFFEHLFGPGVKAEEESKAKIAVK |
| Ga0242657_11333672 | 3300022722 | Soil | KVIDNSVVERLVREHFFEHLFGPAIKAEQDSKAKLAFK |
| Ga0222622_113972361 | 3300022756 | Groundwater Sediment | DNSAIDRLVKEGFFEKLFGPTIKSEIERKSKMAFR |
| Ga0247743_10504131 | 3300023067 | Soil | HTVIDNSLVARLVKEGFFEKLFGPGVKAEEDRKAKAAFK |
| Ga0207656_102513741 | 3300025321 | Corn Rhizosphere | AVQWIIEHQADPQIGARMKAYDFRKVNDNSVVERLVREHFFENLFGPSIKAEEDRKGKLAFK |
| Ga0207642_108544741 | 3300025899 | Miscanthus Rhizosphere | PQIGARMKAYDFRKVIDNSVVERLVREKFFENLFGPSIKAEEDRKGKLAFK |
| Ga0207680_109571821 | 3300025903 | Switchgrass Rhizosphere | HKVIDNSIVDRLVKEKYFEMLMGASIKAEEDRKAKLAFK |
| Ga0207647_103456392 | 3300025904 | Corn Rhizosphere | IDNSVVERLVREHFFENLFGPSIKAEEDRKGKLAFK |
| Ga0207699_106298392 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | LAAAVKAVVEQQSDPQIAAQMKAYDFHKIIDNGTVERLVKEKFFETLFGASIKAEEDRKAKLAFK |
| Ga0207654_103522341 | 3300025911 | Corn Rhizosphere | DGVKAVVEQQSDPQLAAQMKAYDFHKVIDNSIVDRLVKEKYFEMLMGVSIKAEEDRKAKLAFK |
| Ga0207654_105205972 | 3300025911 | Corn Rhizosphere | AYDFHKVVDNSTVDRLVKEKFFDTLFGASIKAEEDRKAKLAFK |
| Ga0207654_107991592 | 3300025911 | Corn Rhizosphere | HQADAQVGARLKAYDFHKVIDNSVVERLVREHFFENLYGTSVKAEEDKKAKLAFK |
| Ga0207695_112097421 | 3300025913 | Corn Rhizosphere | RAYDFHKVIDNGLVDRLVKEGFFESVFGPDVKAEEDRKAKLAFR |
| Ga0207671_112789111 | 3300025914 | Corn Rhizosphere | LAPAVQWIIEHQADPQIGARMKAYDFRKVIDNSVVERLVREHFFENLFGPSIKAEEDRKGKLAFK |
| Ga0207657_107110021 | 3300025919 | Corn Rhizosphere | ERIPYVLAPAVQWIIEHQADPQIGARMKAYDFRKVIDNSVVERLVREHFFENLFGPSIKAEEDRKGKLAFK |
| Ga0207657_112253172 | 3300025919 | Corn Rhizosphere | VIDNSVVERLVREHFFENLFGPSIKAEEDARGKLAFK |
| Ga0207694_118065772 | 3300025924 | Corn Rhizosphere | QWIVEHQADAQIGAQLKAYDFHKVIDNSVVDKLVREHFFENLYGPSVKAEQDRKSKLAFR |
| Ga0207687_107834122 | 3300025927 | Miscanthus Rhizosphere | VIDNSLVDRLVKEGFFETLFGPEIKAEEDRKAKLAFR |
| Ga0207687_108609652 | 3300025927 | Miscanthus Rhizosphere | QQSDPQIAAQMKAYDFHKVVDNGTVDRLVKEKFFETLFGATIKAEEDRKAKLAFK |
| Ga0207687_110913471 | 3300025927 | Miscanthus Rhizosphere | DNSTVERLVKEKFFETLFGVTIKAEEDRKAKLAFK |
| Ga0207687_116693002 | 3300025927 | Miscanthus Rhizosphere | QLAAQMKAYDFHKVIDNSVIDRLVKEKYFETLLGASIKSEEDRKAKLAFK |
| Ga0207701_116554571 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | DLKGYDFKKVIDNSVVARLVKDGYFQQVFGPGVKAEEQSKASMAFK |
| Ga0207686_101436291 | 3300025934 | Miscanthus Rhizosphere | VKAVVAQQSDPQLAAQMKAYDFHKVIDNSIIDRLVKEKYFEMLMGASIKTEEDRKAKLAF |
| Ga0207686_103524532 | 3300025934 | Miscanthus Rhizosphere | DPQISAQMRAYDFRKVIDNSLVDRLVKEGFFESLFGPEIKAEEDRKAKLAFR |
| Ga0207686_103881881 | 3300025934 | Miscanthus Rhizosphere | QMKAYDFHKVVDNSTVERLVKEKFFETLFGATIKAEEDRKAKLAFK |
| Ga0207709_111113522 | 3300025935 | Miscanthus Rhizosphere | FRKVIDNSVIERLVKEKYFEMLFGATIKAEEDRKAKLAFK |
| Ga0207669_115506932 | 3300025937 | Miscanthus Rhizosphere | KFDFRTVIDNATVDRLVKEGFFEKLYGSGIKAAEERQAKSSFR |
| Ga0207704_101841343 | 3300025938 | Miscanthus Rhizosphere | VDNSVVDKLVKEGFFQQVFGPGVKAEEQAKAKLAFGK |
| Ga0207704_102269621 | 3300025938 | Miscanthus Rhizosphere | QISAQMRAYDFRKVIDNSLVDRLVKEGFFQSLFGPDVKAEEDRKAKLAFR |
| Ga0207704_107792351 | 3300025938 | Miscanthus Rhizosphere | IDNSLVDRLVKEGFFETLFGPEIKAEEDRKAKLAFR |
| Ga0207665_115528341 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | RAWDVADPQIGAQMRVFDFRKVIDNSVIDRLVREHYFEQLFGPAIKAEQERKAKLAFK |
| Ga0207691_111732062 | 3300025940 | Miscanthus Rhizosphere | ADAQIGAQLKAYDFHKVIDNSVVEKLVREHFFENLYGPSVKAEQDRKAKIAFK |
| Ga0207711_100083041 | 3300025941 | Switchgrass Rhizosphere | YDFHKVVDNSTVDRLAKEKFFETLFGATIKAEEDRKAKLAFK |
| Ga0207711_106698271 | 3300025941 | Switchgrass Rhizosphere | DVERIYELYAKPKAFERIPYVLGDGVKAVVAQQSDPQLAAQMKAYDFRKVIDNSVIERLVKEKYFEMLFGATIKAEEDRKAKLAFK |
| Ga0207711_111495501 | 3300025941 | Switchgrass Rhizosphere | FRKVIDNSLVDRLVKEGFFETLFGPEIKAEEDRKAKLAFR |
| Ga0207661_107932822 | 3300025944 | Corn Rhizosphere | TVIDNSVVARLVKEGFFEKLFGPGVKAEEDRKSKLAFR |
| Ga0207679_119571932 | 3300025945 | Corn Rhizosphere | FKAFDFKKIIDNSVVDKLVKEGFFQQVFGPGVKAEEQSKAKLAFGR |
| Ga0207712_110721422 | 3300025961 | Switchgrass Rhizosphere | LYAKPKAFERIPYVLSDGVKAVIAQQSDPQLAAQMKAYDFRKVIDNSVIERLVKEKYFEMLFGATIKAEEDRKAKLAFK |
| Ga0207640_106373102 | 3300025981 | Corn Rhizosphere | IAAQMKAYDFRKSIDNSVIDRLVKEHYFEQLFGPSEKAEEEAIASLPST |
| Ga0207640_114361342 | 3300025981 | Corn Rhizosphere | IIEHQADPQIGARMKAYDFRKVIDNSVVERLVREHFFENLFGPSIKAEEDRKGKLAFK |
| Ga0207658_107638581 | 3300025986 | Switchgrass Rhizosphere | PYVLAPAVQWIIEHQADPQIGARMKAYDFRKVIDNSVVERLVREKFFENLFGPSIKAEEDRKGKLAFK |
| Ga0207677_101398424 | 3300026023 | Miscanthus Rhizosphere | QQSDPQLAAQMKAYDFHKVIDNSVIERLVKEKYFEMLFGATIKAEEDRKAKLAFK |
| Ga0207677_117261442 | 3300026023 | Miscanthus Rhizosphere | MIDNATVDRLVKEGFFEKLYGSGIKAAEDRQAKSAFR |
| Ga0207639_121456741 | 3300026041 | Corn Rhizosphere | FHKVIDNSTIDRLIKEKYFEMLFGPAIKAEEDRKAKLAFK |
| Ga0207708_109854382 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | LKAYDFHKVIDNGTVARLVKEGFFQSLFGPGVKAEETRKAGQAYK |
| Ga0207641_105256612 | 3300026088 | Switchgrass Rhizosphere | QADPQIGARMKAYDFRKVIDNSVVERLVREHFFENLFGPSIKAEEDRKGKLAFK |
| Ga0207648_112449641 | 3300026089 | Miscanthus Rhizosphere | DPQIAAQMKAYDFRKVVDNSTIERLVKEKYFETLFGASIKAEQDRKAKLAFK |
| Ga0207674_104116361 | 3300026116 | Corn Rhizosphere | MKAYDFHKVIDNSIVDRLVKEKYFEMLMGASIKAEEDRKAKLAFK |
| Ga0207698_104085861 | 3300026142 | Corn Rhizosphere | AVKYIQEHQADAQTGARLKAYDFHKVIDNSVVERLVREHFFENLFGPSIKAEEDRKAKMAFK |
| Ga0207698_108616591 | 3300026142 | Corn Rhizosphere | IDNGVVDKLVKEGFFQQVFGPGVKAEEQSKAKLAFGK |
| Ga0207698_117447832 | 3300026142 | Corn Rhizosphere | PYVLAPAVKAVVEQQSDPQIAAQMKAYDFHKVVDNSTVERLVKEKFFETLFGATIKAEEDRKAKLAFK |
| Ga0207698_117585322 | 3300026142 | Corn Rhizosphere | IDNSVIERLVKEKYFEMLFGPTIKAEEDRKAKLAFK |
| Ga0209523_10718601 | 3300027548 | Forest Soil | FDFHKSVDNSYVEKLVKEHFFEQLFGPSIKAEEDRKAKLAFR |
| Ga0209387_12023691 | 3300027639 | Agricultural Soil | YDFHKVIDNGTVARLVKEGFFQSLFGPTVKTEETRKAGQAYK |
| Ga0209656_105489951 | 3300027812 | Bog Forest Soil | IDNRPVRKLIEEGFFEKLFGPDIRAEEERKLKVAFA |
| Ga0209274_105909591 | 3300027853 | Soil | FDFRAVIDNSVVERLVREGYFEKLFGVSIKDEEERKAKQAFR |
| Ga0209517_1000550719 | 3300027854 | Peatlands Soil | YDFHKVIDNSVVERLVREHFFENLFGPSIKAEEDARAKLAFK |
| Ga0209486_100506714 | 3300027886 | Agricultural Soil | KAYDFHKVIDNGTVARLVKEGFFQSLFGPTVKTEETRKAGQAYK |
| Ga0209486_112724861 | 3300027886 | Agricultural Soil | DNSLVARLVKEGFFEKLFGAGVKAEEDRKAKLAFR |
| Ga0209415_102606913 | 3300027905 | Peatlands Soil | HKVIDNSYVSKLVKEGFFEQLFGPSVKAEEQRKAKLAFGK |
| Ga0209415_106627521 | 3300027905 | Peatlands Soil | DNSYVSKLVKEGFFDQLFGPSVKAEEQGKAKLAFGK |
| Ga0207428_106514391 | 3300027907 | Populus Rhizosphere | DFHTVIDNSLVARLVKEGFFEKLFGPGVKAEEDRKAKAAFK |
| Ga0268266_111769102 | 3300028379 | Switchgrass Rhizosphere | DNSVVARLVKEGFFQKLFGPGVKAEEDRKSKLAFR |
| Ga0268264_102480043 | 3300028381 | Switchgrass Rhizosphere | QMKAYDFRKVVDNSIVERLVKEKFFETLFGATIKAEQDRKAKLAFK |
| Ga0222749_108077011 | 3300029636 | Soil | AYDFRKVVDNSTIDRLVKEKFFETLFGASVKTEEDRKAKLAFK |
| Ga0311332_116701141 | 3300029984 | Fen | KGYDWKQVIDNSVVEKLVKQGFFEQLFGKEIKAEQDRKAKLAFRK |
| Ga0307495_101317272 | 3300031199 | Soil | VRTVVDNSVIDRLVKEGFFEKLFGPAIKPEIDRKSKMAFR |
| Ga0170824_1113690582 | 3300031231 | Forest Soil | FDFRKVIDNSMIERLVKEGFFEQLFGPSIKAEEEKKAKLAFR |
| Ga0302320_105456073 | 3300031524 | Bog | AAQMKAYDFHKVIDNSYVSKLVKEGFFEQVFGPSVKAEEQRKAKLAFGK |
| Ga0310888_100132485 | 3300031538 | Soil | KAYDFHKVIDNGTVARLVKEGFFQSLFGPGVKAEETRKAGQAYK |
| Ga0310886_100594553 | 3300031562 | Soil | LKAFDFRKIVDNSVVDKLVKEGFFQQVFGPGVKAEEQSKAKLAFGR |
| Ga0310886_100857463 | 3300031562 | Soil | VIDNSLVARLVKEGFFEKLFGPGVKAEEDRKAKAAFK |
| Ga0310686_1017910582 | 3300031708 | Soil | IDNSLVDRLVREGFFEKLFGPEIKAEEERKAKLAFR |
| Ga0310686_1145579492 | 3300031708 | Soil | MKAFDFHRVIDNGTVQRLVREGFFEELFGTGIKTEEETKARIAFGR |
| Ga0310686_1186098212 | 3300031708 | Soil | DFRKVIDNSLVDRLVREGFFEKLFGPEIKSEEERKAKIAFR |
| Ga0310813_115649812 | 3300031716 | Soil | LKRFDFRTVIDNAAVDRLVREGFFEKLYGSGIKAEEDRQAKTAFR |
| Ga0310813_119820522 | 3300031716 | Soil | YDFHKVIDNSVVERLVREHFFENLFGPSIKAEEDARGKLAFK |
| Ga0307468_1023992741 | 3300031740 | Hardwood Forest Soil | TDLKAYDFHKVIDNGTVARLVKEGFFQSLFGPAIKAEESRKAGQAYK |
| Ga0318521_110308471 | 3300031770 | Soil | MKAFDFHKTIDNSYVDRLVKEGFFEQVFGAQIKAEEQKKSKLAFR |
| Ga0318529_102073002 | 3300031792 | Soil | RSVIDNGTVDYLVRQGFFEKLFGPGVKAEENRKEKLAMRK |
| Ga0307478_113157501 | 3300031823 | Hardwood Forest Soil | VPYVLAPAVKAVIAQQSDPQTAAQMKAYDFHKVIDNSTVERLVKEKFFETLFGPTIKAEEDRKAKLAFK |
| Ga0302322_1036898861 | 3300031902 | Fen | IDNSVVERLVKQGFFEQLFGKANIKAEQDRKAKLAFRK |
| Ga0302322_1038470922 | 3300031902 | Fen | NPQLKTFDFSKLVDNSVVLKLVREGWFEKLYGPSVKAEQDRKLKEAFGV |
| Ga0306921_126728531 | 3300031912 | Soil | FDFHAVIDNAVVERLVREGYFEKLFGPAIKDEEARKAKLAYR |
| Ga0310891_100048074 | 3300031913 | Soil | DLKAYDFHKVIDNGTVARLVKEGFFQSVFGPGVKAEETRKAGQAYK |
| Ga0308174_110550792 | 3300031939 | Soil | DNTAVDRLVREGFFEKLYGTNIKPEEDRQAKASFR |
| Ga0310901_106073922 | 3300031940 | Soil | RAIDFKTVIDNSIVDRLVKEGFFEKTFGASVKSEQESRSKQAMR |
| Ga0310916_115178012 | 3300031942 | Soil | KLKPADLRMVVDNSVVDRLVKDGFFVQTFGPNIKSEQDRKSKAAFR |
| Ga0310884_102802422 | 3300031944 | Soil | NSVVDKLVKEGFFQQVFGPGVKAEEQSKAKLAFGR |
| Ga0310910_105482662 | 3300031946 | Soil | SFDFRTVIDNGTVDYLVRQGFFEKLFGPGVKAEENRKEKLAMRK |
| Ga0318531_105729851 | 3300031981 | Soil | MKSFDFRTVIDNGTVDYLVRQGFFEKLFGPGVKAEENRKEKLAMRK |
| Ga0308176_106313411 | 3300031996 | Soil | DLKNYDFHKVIDNSAVDRLVKEGFFENLFGAGIKAEEQRKAKLAFR |
| Ga0310902_100144691 | 3300032012 | Soil | LSADLKAYDFHKVIDNGTVARLVKEGFFQSVFGPGVKAEETRKAGQAYK |
| Ga0310899_100370973 | 3300032017 | Soil | NGVVDKLVKEGFFQQVFGPGVKAEEQSKAKLAFGK |
| Ga0310899_102204171 | 3300032017 | Soil | DFHKVIDNGTVARLVKEGFFQSLFGPGVKAEETRKAGQAYK |
| Ga0310890_117546772 | 3300032075 | Soil | DFKTVIDNSIVDRLVKEGFFEKTFGASVKSEQESRSKQAMR |
| Ga0318518_107189352 | 3300032090 | Soil | TVADQSIVDKLVREGFFEKLFGPGVKEEEARKAKTAFR |
| Ga0315910_104810662 | 3300032144 | Soil | DAKLVAQMKTFDFRTVIDNSIVARLVKEGFFEMLFGPGVKAEEDRKAKAAFR |
| Ga0310889_100108731 | 3300032179 | Soil | KVIDNGTVARLVKEGFFQSVFGPGVKAEETRKAGQAYK |
| Ga0306920_1020583912 | 3300032261 | Soil | AQLRAFDFRKVIDNSLVERLVREGFFENLFGAGIKAEEDRKAKLAYR |
| Ga0310812_101125703 | 3300032421 | Soil | IIDNSVVDKLVKEGFFQQVFGPGVKAEEQSKAKLAFGR |
| Ga0348332_105466291 | 3300032515 | Plant Litter | ADARIEAQMKAYDFHKVIDNSVIERLVREHFFEQLFGPEIKAEQDSKARLEFK |
| Ga0335081_117249003 | 3300032892 | Soil | PQLAAQMKGFDFRKVIDNSIVDRLVKQGFFEQLFGPSIKAEEESKAKLAFR |
| Ga0335084_110885211 | 3300033004 | Soil | DPHKVIDNSVVDRLVKEGFFEKTFGPSIKSEQEKKSKAAYR |
| Ga0335084_112035093 | 3300033004 | Soil | DNSMVARLVRDGFFERLFGPQVKSEEDRKEKLAFR |
| Ga0326723_0106501_1029_1214 | 3300034090 | Peat Soil | VNAVVAQQSDPQIAAQMKAFDFHKVVDNSTVDRLVKEKFFETLFGATIKAEEDRKAKLAF |
| Ga0364932_0283510_3_113 | 3300034177 | Sediment | DNSTVDRLVKEGFFETLFGPAIKAEQQSKARLAFGK |
| ⦗Top⦘ |