NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F011169

Metagenome / Metatranscriptome Family F011169

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F011169
Family Type Metagenome / Metatranscriptome
Number of Sequences 294
Average Sequence Length 48 residues
Representative Sequence YDFRKVIDNSLVDRLVKEGFFESLFGPEIKAEEDRKAKLAFR
Number of Associated Samples 215
Number of Associated Scaffolds 294

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.68 %
% of genes near scaffold ends (potentially truncated) 97.28 %
% of genes from short scaffolds (< 2000 bps) 92.18 %
Associated GOLD sequencing projects 190
AlphaFold2 3D model prediction Yes
3D model pTM-score0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (83.333 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere
(6.803 % of family members)
Environment Ontology (ENVO) Unclassified
(47.959 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(58.163 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 38.57%    β-sheet: 0.00%    Coil/Unstructured: 61.43%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.39
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 294 Family Scaffolds
PF00005ABC_tran 40.14
PF02900LigB 11.56
PF13709DUF4159 3.06
PF03737RraA-like 2.72
PF00528BPD_transp_1 1.36
PF01717Meth_synt_2 1.02
PF13561adh_short_C2 0.68
PF03551PadR 0.68
PF09084NMT1 0.68
PF00498FHA 0.68
PF00645zf-PARP 0.34
PF06762LMF1 0.34
PF02700PurS 0.34
PF11716MDMPI_N 0.34
PF02518HATPase_c 0.34
PF13502AsmA_2 0.34
PF13231PMT_2 0.34
PF05157T2SSE_N 0.34
PF07519Tannase 0.34
PF04295GD_AH_C 0.34
PF13175AAA_15 0.34
PF00076RRM_1 0.34
PF08450SGL 0.34
PF13360PQQ_2 0.34
PF02371Transposase_20 0.34
PF07609DUF1572 0.34
PF00440TetR_N 0.34
PF02472ExbD 0.34
PF00583Acetyltransf_1 0.34
PF00501AMP-binding 0.34

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 294 Family Scaffolds
COG0684RNA degradosome component RraA (regulator of RNase E activity)Translation, ribosomal structure and biogenesis [J] 2.72
COG0620Methionine synthase II (cobalamin-independent)Amino acid transport and metabolism [E] 1.02
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.68
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 0.68
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.68
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.68
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.68
COG0848Biopolymer transport protein ExbDIntracellular trafficking, secretion, and vesicular transport [U] 0.34
COG1828Phosphoribosylformylglycinamidine (FGAM) synthase, PurS subunitNucleotide transport and metabolism [F] 0.34
COG2721Altronate dehydrataseCarbohydrate transport and metabolism [G] 0.34
COG3386Sugar lactone lactonase YvrECarbohydrate transport and metabolism [G] 0.34
COG3391DNA-binding beta-propeller fold protein YncEGeneral function prediction only [R] 0.34
COG3547TransposaseMobilome: prophages, transposons [X] 0.34


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms83.33 %
UnclassifiedrootN/A16.67 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459004|F62QY1Z02FJYDOAll Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis518Open in IMG/M
2170459024|GZRSKLJ02FWNDOAll Organisms → cellular organisms → Bacteria513Open in IMG/M
2199352024|deeps__Contig_92453All Organisms → cellular organisms → Bacteria789Open in IMG/M
2228664022|INPgaii200_c0563442Not Available652Open in IMG/M
3300000956|JGI10216J12902_118494602All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1671Open in IMG/M
3300001213|JGIcombinedJ13530_109559745All Organisms → cellular organisms → Bacteria859Open in IMG/M
3300001356|JGI12269J14319_10224528All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis718Open in IMG/M
3300004080|Ga0062385_10804813All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300004153|Ga0063455_100941767All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300005288|Ga0065714_10149368All Organisms → cellular organisms → Bacteria1116Open in IMG/M
3300005294|Ga0065705_10146164All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales2036Open in IMG/M
3300005327|Ga0070658_10474464All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1079Open in IMG/M
3300005329|Ga0070683_101971227All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300005332|Ga0066388_106492855All Organisms → cellular organisms → Bacteria → Acidobacteria590Open in IMG/M
3300005336|Ga0070680_100293170All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales1379Open in IMG/M
3300005337|Ga0070682_100859590All Organisms → cellular organisms → Bacteria742Open in IMG/M
3300005338|Ga0068868_102290950Not Available515Open in IMG/M
3300005338|Ga0068868_102380068All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis506Open in IMG/M
3300005339|Ga0070660_100924332All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis736Open in IMG/M
3300005345|Ga0070692_10050355All Organisms → cellular organisms → Bacteria2163Open in IMG/M
3300005345|Ga0070692_10691016All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis685Open in IMG/M
3300005347|Ga0070668_101354662All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300005353|Ga0070669_101264330All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300005356|Ga0070674_100021135All Organisms → cellular organisms → Bacteria → Proteobacteria4172Open in IMG/M
3300005366|Ga0070659_100697962Not Available877Open in IMG/M
3300005434|Ga0070709_10679060All Organisms → cellular organisms → Bacteria800Open in IMG/M
3300005436|Ga0070713_100118614All Organisms → cellular organisms → Bacteria2317Open in IMG/M
3300005436|Ga0070713_101240844Not Available722Open in IMG/M
3300005438|Ga0070701_11202839Not Available538Open in IMG/M
3300005455|Ga0070663_101977308All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis524Open in IMG/M
3300005458|Ga0070681_11205934Not Available679Open in IMG/M
3300005466|Ga0070685_10874053All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300005467|Ga0070706_102135445All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300005531|Ga0070738_10228086All Organisms → cellular organisms → Bacteria → Acidobacteria829Open in IMG/M
3300005533|Ga0070734_10651499All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300005539|Ga0068853_100092275All Organisms → cellular organisms → Bacteria → Proteobacteria2664Open in IMG/M
3300005544|Ga0070686_100570978All Organisms → cellular organisms → Bacteria887Open in IMG/M
3300005544|Ga0070686_101002298All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300005544|Ga0070686_101387147Not Available589Open in IMG/M
3300005545|Ga0070695_100199625All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales1429Open in IMG/M
3300005547|Ga0070693_101655478All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis504Open in IMG/M
3300005563|Ga0068855_101562091All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300005577|Ga0068857_102116360Not Available552Open in IMG/M
3300005578|Ga0068854_101311255All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium652Open in IMG/M
3300005578|Ga0068854_101970794All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis538Open in IMG/M
3300005591|Ga0070761_10551865All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis714Open in IMG/M
3300005614|Ga0068856_101260554All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300005614|Ga0068856_102514035All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300005615|Ga0070702_101688288All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis526Open in IMG/M
3300005616|Ga0068852_100451881All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis1272Open in IMG/M
3300005616|Ga0068852_100755142All Organisms → cellular organisms → Bacteria985Open in IMG/M
3300005618|Ga0068864_102672961All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis505Open in IMG/M
3300005713|Ga0066905_100981529All Organisms → cellular organisms → Bacteria744Open in IMG/M
3300005764|Ga0066903_102436614All Organisms → cellular organisms → Bacteria → Acidobacteria1012Open in IMG/M
3300005764|Ga0066903_103227743All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium882Open in IMG/M
3300005764|Ga0066903_108081365All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300005829|Ga0074479_10900791All Organisms → cellular organisms → Bacteria1785Open in IMG/M
3300005834|Ga0068851_10397749All Organisms → cellular organisms → Bacteria810Open in IMG/M
3300005836|Ga0074470_11666369All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300005836|Ga0074470_11708518All Organisms → cellular organisms → Bacteria3708Open in IMG/M
3300005841|Ga0068863_100970017All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis852Open in IMG/M
3300005842|Ga0068858_100553121All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis1114Open in IMG/M
3300005842|Ga0068858_101275901Not Available723Open in IMG/M
3300005842|Ga0068858_101497288All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi665Open in IMG/M
3300005843|Ga0068860_100269166All Organisms → cellular organisms → Bacteria1662Open in IMG/M
3300005844|Ga0068862_101149123All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis773Open in IMG/M
3300006046|Ga0066652_101138253All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300006046|Ga0066652_101151520Not Available734Open in IMG/M
3300006162|Ga0075030_101113799All Organisms → cellular organisms → Bacteria → Acidobacteria621Open in IMG/M
3300006175|Ga0070712_101243218All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium648Open in IMG/M
3300006176|Ga0070765_101119142All Organisms → cellular organisms → Bacteria744Open in IMG/M
3300006237|Ga0097621_100277356Not Available1475Open in IMG/M
3300006237|Ga0097621_100448469All Organisms → cellular organisms → Bacteria1162Open in IMG/M
3300006237|Ga0097621_101733347All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300006358|Ga0068871_101854204Not Available573Open in IMG/M
3300006806|Ga0079220_12057445All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300006853|Ga0075420_100227242All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae1626Open in IMG/M
3300006853|Ga0075420_101279976Not Available630Open in IMG/M
3300006881|Ga0068865_100264758All Organisms → cellular organisms → Bacteria → Acidobacteria1362Open in IMG/M
3300006881|Ga0068865_100463326Not Available1050Open in IMG/M
3300006914|Ga0075436_100432875All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis956Open in IMG/M
3300006954|Ga0079219_11903080All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium561Open in IMG/M
3300007004|Ga0079218_11861046Not Available678Open in IMG/M
3300009089|Ga0099828_11995426All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300009093|Ga0105240_10754044All Organisms → cellular organisms → Bacteria → Acidobacteria1058Open in IMG/M
3300009098|Ga0105245_10025043All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales5245Open in IMG/M
3300009098|Ga0105245_10656631Not Available1079Open in IMG/M
3300009098|Ga0105245_11580717All Organisms → cellular organisms → Bacteria707Open in IMG/M
3300009101|Ga0105247_11272692All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300009148|Ga0105243_10406941All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis1265Open in IMG/M
3300009148|Ga0105243_11615950All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300009148|Ga0105243_11928253All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis624Open in IMG/M
3300009148|Ga0105243_11969914All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis618Open in IMG/M
3300009156|Ga0111538_10257331All Organisms → cellular organisms → Bacteria2209Open in IMG/M
3300009156|Ga0111538_10564013All Organisms → cellular organisms → Bacteria1444Open in IMG/M
3300009174|Ga0105241_10593345All Organisms → cellular organisms → Bacteria1000Open in IMG/M
3300009174|Ga0105241_10598995All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis995Open in IMG/M
3300009174|Ga0105241_11172251All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis726Open in IMG/M
3300009176|Ga0105242_10305096All Organisms → cellular organisms → Bacteria1454Open in IMG/M
3300009176|Ga0105242_12813161Not Available537Open in IMG/M
3300009177|Ga0105248_10966919All Organisms → cellular organisms → Bacteria962Open in IMG/M
3300009177|Ga0105248_12303862All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300009218|Ga0103848_1094707All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 20-60-12601Open in IMG/M
3300009524|Ga0116225_1365106All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis642Open in IMG/M
3300009545|Ga0105237_11031311All Organisms → cellular organisms → Bacteria829Open in IMG/M
3300009545|Ga0105237_11503700All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis680Open in IMG/M
3300009700|Ga0116217_10554573All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis718Open in IMG/M
3300009824|Ga0116219_10544900All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis640Open in IMG/M
3300010362|Ga0126377_11877645Not Available675Open in IMG/M
3300010375|Ga0105239_11662275All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300010375|Ga0105239_12904614All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300010375|Ga0105239_13260988All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300010375|Ga0105239_13525053All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis509Open in IMG/M
3300010376|Ga0126381_101564486All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis953Open in IMG/M
3300010379|Ga0136449_100390927All Organisms → cellular organisms → Bacteria2474Open in IMG/M
3300010399|Ga0134127_12563599All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis590Open in IMG/M
3300010401|Ga0134121_10974971All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis830Open in IMG/M
3300010401|Ga0134121_13110745All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium512Open in IMG/M
3300010403|Ga0134123_13152938All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300011119|Ga0105246_10046434All Organisms → cellular organisms → Bacteria2962Open in IMG/M
3300011119|Ga0105246_10588045Not Available960Open in IMG/M
3300011119|Ga0105246_10910598All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis789Open in IMG/M
3300011120|Ga0150983_11012222All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300012038|Ga0137431_1065851Not Available999Open in IMG/M
3300012212|Ga0150985_119369853All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300012212|Ga0150985_121472255All Organisms → cellular organisms → Bacteria → Acidobacteria564Open in IMG/M
3300012469|Ga0150984_107334139All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS191596Open in IMG/M
3300012904|Ga0157282_10039565All Organisms → cellular organisms → Bacteria1099Open in IMG/M
3300012929|Ga0137404_11581617All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300012948|Ga0126375_11477903Not Available580Open in IMG/M
3300012971|Ga0126369_10055548All Organisms → cellular organisms → Bacteria3406Open in IMG/M
3300012986|Ga0164304_10436430All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus940Open in IMG/M
3300013296|Ga0157374_10171620All Organisms → cellular organisms → Bacteria2116Open in IMG/M
3300013297|Ga0157378_10042446All Organisms → cellular organisms → Bacteria → Acidobacteria4037Open in IMG/M
3300013297|Ga0157378_10984175All Organisms → cellular organisms → Bacteria877Open in IMG/M
3300013297|Ga0157378_11275087All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300013297|Ga0157378_13172960All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300013306|Ga0163162_12544995All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300013307|Ga0157372_11366892All Organisms → cellular organisms → Bacteria817Open in IMG/M
3300013308|Ga0157375_10780397All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis1105Open in IMG/M
3300013766|Ga0120181_1149039All Organisms → cellular organisms → Bacteria → Proteobacteria508Open in IMG/M
3300014325|Ga0163163_10234749All Organisms → cellular organisms → Bacteria1883Open in IMG/M
3300014325|Ga0163163_10926111All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis935Open in IMG/M
3300014325|Ga0163163_11034693All Organisms → cellular organisms → Bacteria884Open in IMG/M
3300014325|Ga0163163_11314025All Organisms → cellular organisms → Bacteria785Open in IMG/M
3300014325|Ga0163163_11878449All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300014638|Ga0181536_10036046All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3530Open in IMG/M
3300014658|Ga0181519_10190253All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1295Open in IMG/M
3300014745|Ga0157377_10622734All Organisms → cellular organisms → Bacteria773Open in IMG/M
3300014745|Ga0157377_11412999All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300014866|Ga0180090_1023529All Organisms → cellular organisms → Bacteria963Open in IMG/M
3300014968|Ga0157379_10793765All Organisms → cellular organisms → Bacteria893Open in IMG/M
3300014968|Ga0157379_11271580Not Available710Open in IMG/M
3300014968|Ga0157379_12422026Not Available524Open in IMG/M
3300014968|Ga0157379_12449409All Organisms → cellular organisms → Bacteria → Acidobacteria521Open in IMG/M
3300014968|Ga0157379_12668832Not Available501Open in IMG/M
3300014969|Ga0157376_10852243All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales927Open in IMG/M
3300014969|Ga0157376_11251509All Organisms → cellular organisms → Bacteria → Acidobacteria771Open in IMG/M
3300015264|Ga0137403_11117069All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300015264|Ga0137403_11226985All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300015372|Ga0132256_101588737All Organisms → cellular organisms → Bacteria764Open in IMG/M
3300017792|Ga0163161_10597338All Organisms → cellular organisms → Bacteria910Open in IMG/M
3300017926|Ga0187807_1264625All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis566Open in IMG/M
3300017943|Ga0187819_10574140All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS191640Open in IMG/M
3300017948|Ga0187847_10697218Not Available571Open in IMG/M
3300017959|Ga0187779_11101571All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS191555Open in IMG/M
3300017975|Ga0187782_11374001All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium555Open in IMG/M
3300018012|Ga0187810_10312701All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis651Open in IMG/M
3300018062|Ga0187784_10366617All Organisms → cellular organisms → Bacteria → Acidobacteria1166Open in IMG/M
3300018064|Ga0187773_11094974All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis529Open in IMG/M
3300018422|Ga0190265_11247504Not Available861Open in IMG/M
3300018466|Ga0190268_11658095Not Available567Open in IMG/M
3300018476|Ga0190274_10219442All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1693Open in IMG/M
3300018476|Ga0190274_12068123Not Available666Open in IMG/M
3300019377|Ga0190264_10322924All Organisms → cellular organisms → Bacteria → Proteobacteria950Open in IMG/M
3300020081|Ga0206354_10441263All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300020580|Ga0210403_10563450All Organisms → cellular organisms → Bacteria922Open in IMG/M
3300020583|Ga0210401_11133550All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300020583|Ga0210401_11246019All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis602Open in IMG/M
3300021168|Ga0210406_10625207All Organisms → cellular organisms → Bacteria838Open in IMG/M
3300021170|Ga0210400_10148686All Organisms → cellular organisms → Bacteria → Proteobacteria1886Open in IMG/M
3300021170|Ga0210400_10585841All Organisms → cellular organisms → Bacteria920Open in IMG/M
3300021181|Ga0210388_11428556All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis580Open in IMG/M
3300021406|Ga0210386_10793937All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis814Open in IMG/M
3300021433|Ga0210391_11489317All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales519Open in IMG/M
3300021478|Ga0210402_11981698Not Available508Open in IMG/M
3300022529|Ga0242668_1086918All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis616Open in IMG/M
3300022722|Ga0242657_1133367All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis641Open in IMG/M
3300022756|Ga0222622_11397236Not Available515Open in IMG/M
3300023067|Ga0247743_1050413Not Available602Open in IMG/M
3300025321|Ga0207656_10251374All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis866Open in IMG/M
3300025899|Ga0207642_10854474All Organisms → cellular organisms → Bacteria → Proteobacteria581Open in IMG/M
3300025903|Ga0207680_10957182All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300025904|Ga0207647_10345639All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis843Open in IMG/M
3300025906|Ga0207699_10629839All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300025911|Ga0207654_10352234All Organisms → cellular organisms → Bacteria1014Open in IMG/M
3300025911|Ga0207654_10520597All Organisms → cellular organisms → Bacteria842Open in IMG/M
3300025911|Ga0207654_10799159All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis681Open in IMG/M
3300025913|Ga0207695_11209742Not Available636Open in IMG/M
3300025914|Ga0207671_11278911All Organisms → cellular organisms → Bacteria → Proteobacteria572Open in IMG/M
3300025919|Ga0207657_10711002All Organisms → cellular organisms → Bacteria → Proteobacteria780Open in IMG/M
3300025919|Ga0207657_11225317All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis569Open in IMG/M
3300025924|Ga0207694_11806577All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis514Open in IMG/M
3300025927|Ga0207687_10783412Not Available813Open in IMG/M
3300025927|Ga0207687_10860965All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300025927|Ga0207687_11091347All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300025927|Ga0207687_11669300All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300025930|Ga0207701_11655457Not Available513Open in IMG/M
3300025934|Ga0207686_10143629All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1653Open in IMG/M
3300025934|Ga0207686_10352453Not Available1108Open in IMG/M
3300025934|Ga0207686_10388188All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1061Open in IMG/M
3300025935|Ga0207709_11111352All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300025937|Ga0207669_11550693All Organisms → cellular organisms → Bacteria → Acidobacteria565Open in IMG/M
3300025938|Ga0207704_10184134All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1512Open in IMG/M
3300025938|Ga0207704_10226962Not Available1386Open in IMG/M
3300025938|Ga0207704_10779235All Organisms → cellular organisms → Bacteria797Open in IMG/M
3300025939|Ga0207665_11552834All Organisms → cellular organisms → Bacteria → Acidobacteria525Open in IMG/M
3300025940|Ga0207691_11173206All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis637Open in IMG/M
3300025941|Ga0207711_10008304All Organisms → cellular organisms → Bacteria8692Open in IMG/M
3300025941|Ga0207711_10669827All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS191968Open in IMG/M
3300025941|Ga0207711_11149550All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300025944|Ga0207661_10793282Not Available872Open in IMG/M
3300025945|Ga0207679_11957193All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300025961|Ga0207712_11072142All Organisms → cellular organisms → Bacteria716Open in IMG/M
3300025981|Ga0207640_10637310Not Available906Open in IMG/M
3300025981|Ga0207640_11436134All Organisms → cellular organisms → Bacteria → Proteobacteria619Open in IMG/M
3300025986|Ga0207658_10763858All Organisms → cellular organisms → Bacteria → Proteobacteria876Open in IMG/M
3300026023|Ga0207677_10139842All Organisms → cellular organisms → Bacteria1852Open in IMG/M
3300026023|Ga0207677_11726144All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300026041|Ga0207639_12145674All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300026075|Ga0207708_10985438All Organisms → cellular organisms → Bacteria732Open in IMG/M
3300026088|Ga0207641_10525661All Organisms → cellular organisms → Bacteria → Proteobacteria1151Open in IMG/M
3300026089|Ga0207648_11244964All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS191699Open in IMG/M
3300026116|Ga0207674_10411636All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS1131307Open in IMG/M
3300026142|Ga0207698_10408586All Organisms → cellular organisms → Bacteria → Proteobacteria1299Open in IMG/M
3300026142|Ga0207698_10861659Not Available911Open in IMG/M
3300026142|Ga0207698_11744783All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS191638Open in IMG/M
3300026142|Ga0207698_11758532All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300027548|Ga0209523_1071860Not Available713Open in IMG/M
3300027639|Ga0209387_1202369All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium546Open in IMG/M
3300027812|Ga0209656_10548995All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300027853|Ga0209274_10590959All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300027854|Ga0209517_10005507All Organisms → cellular organisms → Bacteria16111Open in IMG/M
3300027886|Ga0209486_10050671All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2077Open in IMG/M
3300027886|Ga0209486_11272486Not Available508Open in IMG/M
3300027905|Ga0209415_10260691All Organisms → cellular organisms → Bacteria → Proteobacteria1546Open in IMG/M
3300027905|Ga0209415_10662752All Organisms → cellular organisms → Bacteria757Open in IMG/M
3300027907|Ga0207428_10651439Not Available756Open in IMG/M
3300028379|Ga0268266_11176910Not Available741Open in IMG/M
3300028381|Ga0268264_10248004All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1653Open in IMG/M
3300029636|Ga0222749_10807701All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300029984|Ga0311332_11670114Not Available518Open in IMG/M
3300031199|Ga0307495_10131727Not Available628Open in IMG/M
3300031231|Ga0170824_111369058All Organisms → cellular organisms → Bacteria → Proteobacteria512Open in IMG/M
3300031524|Ga0302320_10545607All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS1131381Open in IMG/M
3300031538|Ga0310888_10013248All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3242Open in IMG/M
3300031562|Ga0310886_10059455All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1766Open in IMG/M
3300031562|Ga0310886_10085746All Organisms → cellular organisms → Bacteria1533Open in IMG/M
3300031708|Ga0310686_101791058All Organisms → cellular organisms → Bacteria → Acidobacteria974Open in IMG/M
3300031708|Ga0310686_114557949All Organisms → cellular organisms → Bacteria730Open in IMG/M
3300031708|Ga0310686_118609821All Organisms → cellular organisms → Bacteria908Open in IMG/M
3300031716|Ga0310813_11564981All Organisms → cellular organisms → Bacteria → Acidobacteria615Open in IMG/M
3300031716|Ga0310813_11982052All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis549Open in IMG/M
3300031740|Ga0307468_102399274All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300031770|Ga0318521_11030847All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis505Open in IMG/M
3300031792|Ga0318529_10207300All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis910Open in IMG/M
3300031823|Ga0307478_11315750All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300031902|Ga0302322_103689886All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300031902|Ga0302322_103847092All Organisms → cellular organisms → Bacteria → Proteobacteria513Open in IMG/M
3300031913|Ga0310891_10004807All Organisms → cellular organisms → Bacteria → Proteobacteria2875Open in IMG/M
3300031939|Ga0308174_11055079All Organisms → cellular organisms → Bacteria690Open in IMG/M
3300031940|Ga0310901_10607392All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300031942|Ga0310916_11517801All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300031944|Ga0310884_10280242All Organisms → cellular organisms → Bacteria922Open in IMG/M
3300031946|Ga0310910_10548266All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis917Open in IMG/M
3300031981|Ga0318531_10572985All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis511Open in IMG/M
3300031996|Ga0308176_10631341All Organisms → cellular organisms → Bacteria1104Open in IMG/M
3300032012|Ga0310902_10014469All Organisms → cellular organisms → Bacteria → Proteobacteria3318Open in IMG/M
3300032017|Ga0310899_10037097All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1706Open in IMG/M
3300032017|Ga0310899_10220417All Organisms → cellular organisms → Bacteria849Open in IMG/M
3300032075|Ga0310890_11754677All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300032090|Ga0318518_10718935Not Available508Open in IMG/M
3300032144|Ga0315910_10481066Not Available956Open in IMG/M
3300032179|Ga0310889_10010873All Organisms → cellular organisms → Bacteria → Proteobacteria2932Open in IMG/M
3300032261|Ga0306920_102058391All Organisms → cellular organisms → Bacteria → Acidobacteria798Open in IMG/M
3300032421|Ga0310812_10112570All Organisms → cellular organisms → Bacteria → Proteobacteria1130Open in IMG/M
3300032515|Ga0348332_10546629All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1084Open in IMG/M
3300032892|Ga0335081_11724900All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus681Open in IMG/M
3300033004|Ga0335084_11088521All Organisms → cellular organisms → Bacteria802Open in IMG/M
3300033004|Ga0335084_11203509All Organisms → cellular organisms → Bacteria757Open in IMG/M
3300034090|Ga0326723_0106501All Organisms → cellular organisms → Bacteria → Proteobacteria1215Open in IMG/M
3300034177|Ga0364932_0283510All Organisms → cellular organisms → Bacteria626Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere6.80%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere6.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.46%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere5.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.10%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.42%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.74%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.40%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.06%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.38%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.38%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.04%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.04%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.70%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.70%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere1.70%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.70%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.70%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.36%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.36%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.36%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.36%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.36%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.36%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere1.36%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.02%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)1.02%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.02%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.02%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.02%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.02%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.68%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.68%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.68%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.68%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.68%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.68%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.68%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.68%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.34%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water0.34%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.34%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.34%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.34%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.34%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.34%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.34%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.34%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.34%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.34%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.34%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.34%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.34%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.34%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.34%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.34%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.34%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.34%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.34%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.34%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.34%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.34%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.34%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459004Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm (2)EnvironmentalOpen in IMG/M
2170459024Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml)EnvironmentalOpen in IMG/M
2199352024Bare-fallow DEEP SOILEnvironmentalOpen in IMG/M
2228664022Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300005288Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005531Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2EnvironmentalOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005829Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBCEnvironmentalOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009218Microbial communities of water from Amazon river, Brazil - RCM1EnvironmentalOpen in IMG/M
3300009524Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaGEnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012038Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012904Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300013766Permafrost microbial communities from Nunavut, Canada - A26_65cm_6MEnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014638Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaGEnvironmentalOpen in IMG/M
3300014658Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaGEnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014866Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT890_16_10DEnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300020081Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300022529Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022722Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300023067Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S221-509R-5EnvironmentalOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027548Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027639Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029984I_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300031199Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_SEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031913Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031940Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032017Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032144Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soilEnvironmentalOpen in IMG/M
3300032179Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032421Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300034090Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00NEnvironmentalOpen in IMG/M
3300034177Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
E4B_069111802170459004Grass SoilYDFRTVIDNSIVERLVREGXFEKLFGPGVKEEEERKAKTAFR
FD1_052321802170459024Grass SoilDNSTVDRLVKEGFFEKLFGNSIKSEQDKKSKLALR
deeps_015958502199352024SoilDNSIVDRLVKEKYFEMLMGVSIKAEEDRKAKLAFK
INPgaii200_056344222228664022SoilIDNSIVDRLVKEGFFEQLFGAGIKTEQERKAKLAYR
JGI10216J12902_11849460233300000956SoilLRAADFKKIIDNSVIDRLVREGFFQQVFGPGVKADEQSKAKLAFK*
JGIcombinedJ13530_10955974523300001213WetlandNSVVERLVKQGFFEQLFGKSIKEEQDRKAKLAFRK*
JGI12269J14319_1022452813300001356Peatlands SoilQVGARLKAYDFHKVIDNSVVERLVREHFFENLFGPSIKAEEDARAKLAFK*
Ga0062385_1080481313300004080Bog Forest SoilDFHKVIDNSYVSKLVKEGFFEQLFGPSVKAEEQRKAKLAFGK*
Ga0063455_10094176723300004153SoilFRKVIDNSTVERLVKEGFFEQLFGAEVKAEEQQRAKIAFQK*
Ga0065714_1014936813300005288Miscanthus RhizosphereRTVIDNSVVDRLVKEGFFEKTFGPGVKSEQEARSKQAMR*
Ga0065705_1014616413300005294Switchgrass RhizosphereRLSADLKAYDFHKVIDNGTVARLVKEGFFQSLFGPGVKAEETRKAGQAYK*
Ga0070658_1047446413300005327Corn RhizosphereDFRTVVDNATVDRLVREGFFEKLYGPAIKAAEDRQAKTAFR*
Ga0070683_10197122723300005329Corn RhizosphereVPYVLAGAVKSVVDQQADPQIAAQMKAYDFKKVVDNSIVERLVKQGFFDMLFGPSIKAEEDRKAKQAFGK*
Ga0066388_10649285513300005332Tropical Forest SoilFDYRKVADNGTVDRLVKEGFFEKLFGMSVKAEEDRKSRLAFK*
Ga0070680_10029317033300005336Corn RhizosphereIAARMKAYDFHQVIDNSTVARLVKEKYFETLFGPSIKAEEDRKAKLAFK*
Ga0070682_10085959013300005337Corn RhizosphereELYAKPKAFERIPYVLDDGVKAVVAQQSDPQLAAQMKAYDFRKVIDNSVIERLVKEKYFEMLMGASIKAEEDRKAKLAFK*
Ga0068868_10229095023300005338Miscanthus RhizosphereFNVKTIVDNSAIDRLVKEGFFEKLFGSSIKAEIDRKSKMAFR*
Ga0068868_10238006813300005338Miscanthus RhizosphereVLAPAVQWIVDHQADPQIGAQLKAYDFHKVIDNSVVERLVREKFFANLFGPTIRAEEERKGNLAFK*
Ga0070660_10092433223300005339Corn RhizosphereEHQADPQIGARMKAYDFRKVIDNSVVERLVREHFFENLFGPSIKAEEDRKGKLAFK*
Ga0070692_1005035513300005345Corn, Switchgrass And Miscanthus RhizosphereKAYDFHKVIDNSIIDRLVKEKYFETLFGATIKAEEDRKAKLAFK*
Ga0070692_1069101623300005345Corn, Switchgrass And Miscanthus RhizosphereEHQADAQTGARLKAYDFHKVIDNSVVERLVREHFFENLFGPSIKAEEDRKAKMAFK*
Ga0070668_10135466223300005347Switchgrass RhizosphereADLKAYDFHKVIDNGTVVRLVKEGFFQSLFGPGVKAEETRKAGQAYK*
Ga0070669_10126433013300005353Switchgrass RhizosphereADLKAYDFHKVIDNGTVARLVKEGFFQSLFGPGVKAEETRKAGQAYK*
Ga0070674_10002113563300005356Miscanthus RhizosphereGFDFRTVIDNGVVARLVREGYFQTLFGAGVKAEEDRKSKIAFR*
Ga0070659_10069796213300005366Corn RhizosphereAAVKFILDHVADPQISAQMRAYDFRKVIDNSLVDRLVKEGFFESLFGPEIKAEEDRKAKLAFR*
Ga0070709_1067906013300005434Corn, Switchgrass And Miscanthus RhizosphereAYDFHKVVDNSTVDRLVKEKFFDTLFGASIKAEEDRKAKLAFK*
Ga0070713_10011861413300005436Corn, Switchgrass And Miscanthus RhizosphereDFHKVIDNSTIDRLIKEKYFEMLFGPAIKAEEDRKAKLAFK*
Ga0070713_10124084423300005436Corn, Switchgrass And Miscanthus RhizosphereNFHTVIDNSIVERLVKEGFFEQLFGPRIKAEEDLKAKLAFR*
Ga0070701_1120283923300005438Corn, Switchgrass And Miscanthus RhizosphereKGYDFRKVIDNSVVARLVKDGYFQQVFGPGVKAEEQSKASMAFK*
Ga0070663_10197730813300005455Corn RhizosphereIGARLKAYDFHKVIDNSVVERLVREHFFENLFGPSIKAEEDARGKLAFK*
Ga0070681_1120593423300005458Corn RhizosphereYDFRKVIDNSLVDRLVKEGFFESLFGPEIKAEEDRKAKLAFR*
Ga0070685_1087405323300005466Switchgrass RhizosphereFRTVVDNSTVDRLVKEGFFQKLFGAGIKSEEERKSKLALR*
Ga0070706_10213544513300005467Corn, Switchgrass And Miscanthus RhizosphereELYAKPKAFERIPYVLADGVKAVVAQQSDPQLAAQMKAYDFHKVIDNSIIERLVKEKYFETLFGAPIRAEEDRKAKLAFK*
Ga0070738_1022808623300005531Surface SoilAAHQADPNLGAQMKAYDFHKVIDNSIVEKLVREHFFEQLFGSGIKAEEDSKARLAFR*
Ga0070734_1065149923300005533Surface SoilRMVVDNSVVDRLVKEGFFEQTFGKSIKAEEDRKSKTAFR*
Ga0068853_10009227543300005539Corn RhizosphereYDFHKVIDNSVVERLVREHFFENLFGSSIKAQEDARAKLAFK*
Ga0070686_10057097813300005544Switchgrass RhizosphereYERIPYVLAPAVQWIIEHQADPQIGARMKAYDFRKVIDNSVVERLVREKFFENLFGPSIKAEEDRKGKLAFK*
Ga0070686_10100229823300005544Switchgrass RhizosphereDPQLAAQMKAYDFHKVIDNSIIDRLVKEKYFETLFGATIKAEEDRKAKLAFK*
Ga0070686_10138714713300005544Switchgrass RhizosphereEHQPDAQIAAQMKAYDFTRVIDNSVVDRLVKEHFFEQLFGAGIKAEQDSKAKIAFK*
Ga0070695_10019962533300005545Corn, Switchgrass And Miscanthus RhizosphereVVEQQSDPQIAAQMKAYDFHKVVDNSTVDRLVKEKFFDTLFGASIKAEEDRKAKLAFK*
Ga0070693_10165547823300005547Corn, Switchgrass And Miscanthus RhizosphereDRKAESYERIPCVLAPAVQYIVEHQADAQVGARLKAYDFHKVIDNSVVERLVREHFFENLFGPSIKAEEDARAKLAFK*
Ga0068855_10156209123300005563Corn RhizosphereDPNISAQMKSYDFKKVIDNSYVDKVVKQGFFEQLFGPSIKADEQRRAKLAFGK*
Ga0068857_10211636013300005577Corn RhizosphereNATVDRLVKEGFFEKLYGSTIKAQEAQSAKTAYR*
Ga0068854_10131125513300005578Corn RhizosphereFDFRTVVDNATVDRLVREGFFEKLYGPAIKAAEDRQAKTAFR*
Ga0068854_10197079413300005578Corn RhizosphereHQADPQIGARMKAYDFRKVIDNSVVERLVREHFFENLFGPSIKAEEDRKGKLAFK*
Ga0070761_1055186523300005591SoilPAVQYIIDHQADARIAAQMKAYDFHNVIDNSVVDRLVKEHFFEQLFGPEIKAEQDSKARLEFK*
Ga0068856_10126055423300005614Corn RhizosphereYDFHKVIDNSYVERLVKQGFFEQTFGPSVKAEEQRKAKLDFGK*
Ga0068856_10251403523300005614Corn RhizosphereKAVVAQQSDPQLAAQMKAYDFHKVIDNSIVDRLVKEKYFEMLMGASIKAEEDRKAKLAFK
Ga0070702_10168828823300005615Corn, Switchgrass And Miscanthus RhizosphereFHKVIDNSVVEKLVREHFFENLYGPSVKAEQDRKAKLAFR*
Ga0068852_10045188113300005616Corn RhizosphereAVKYIQEHQADAQTGARLKAYDFHKVIDNSVVERLVREHFFENLFGPSIKAEEDRKAKMAFK*
Ga0068852_10075514223300005616Corn RhizosphereAKPKAFERIPYVLADGVKAVVAQQSDPQLAAQMKAYDFHKVIDNSVIERLVKEKYFEMLFGPTIKAEEDRKAKLAFK*
Ga0068864_10267296123300005618Switchgrass RhizosphereERIPYVLAPAVQWIVEHQADPQIGARLKAYDFHKVIDNSVVERLVREKFFENLFGPAIKAEEDRKGKLAFK*
Ga0066905_10098152923300005713Tropical Forest SoilNGTVARLVKEGYFQSLYGPAVKAEESRKAGQAYK*
Ga0066903_10243661433300005764Tropical Forest SoilNTLVARLVQEGYFEKLFGPSIKDEEERKAKLAFR*
Ga0066903_10322774323300005764Tropical Forest SoilVLDNSIVDKLVREGFFEQLFGLQVRAEQEQKQKIAFQ*
Ga0066903_10808136523300005764Tropical Forest SoilIDFKTVIDNSVVDKLAKEGFFEKTFGAGVKSEQESRSKQAMR*
Ga0074479_1090079113300005829Sediment (Intertidal)VDNSVIDRLVKEGFFEKLFGGGIKSEIDRRSKLAFR*
Ga0068851_1039774923300005834Corn RhizosphereAQMKAYDFHKVVDNSTVERLVKEKFFETLFGATIKAEEDRKAKLAFK*
Ga0074470_1166636913300005836Sediment (Intertidal)IDNSTVDRLVRSGFFEQLFGPAIKAEEERKAKLAFR*
Ga0074470_1170851813300005836Sediment (Intertidal)IVDNSIVTRLVKEKFFETLFGPSIKAEEDRKAKLAFK*
Ga0068863_10097001723300005841Switchgrass RhizosphereYVLAPAVQWIVEHQADAQIGAQLKAYDFHKVIDNSVVERLVREKFFENLFGPTIKAEEDRKGKLAFK*
Ga0068858_10055312123300005842Switchgrass RhizosphereLAPAVQWIVEHQADAQIGAQLKAYDFHKVIDNSVVEKLVREHFFENLYGPSVKAEQDRKAKIAFK*
Ga0068858_10127590133300005842Switchgrass RhizosphereKVIDNSIVERLVKAGYFVQLSGPGLKAEETMKASQAFK*
Ga0068858_10149728813300005842Switchgrass RhizosphereKYILDHVADPQISAQMKVFDFRKVIDNSLVDRLVKERYFENLFGPEIKAEEDRKTKTAFR
Ga0068860_10026916613300005843Switchgrass RhizosphereSAQMRAYDFRKVIDNSLVDRLVKERFFETLFGPEIKAEEDRKAKLAFR*
Ga0068862_10114912313300005844Switchgrass RhizosphereDNSVVERLVREHFFENLFGPSIKAEEDARAKLAFK*
Ga0066652_10113825313300006046SoilAFDFKKVVDNSIVDRLVKEGFFETLFGTTIKAEEERKSKLALR*
Ga0066652_10115152013300006046SoilMRAYDFRKVIDNSLVDRLVKEGFFESLFGPEIRAEEDRKAKLAFR*
Ga0075030_10111379913300006162WatershedsVVDHSIVDRLVKEGFFEQVFGPKIKEEEARKSKLAFR*
Ga0070712_10124321813300006175Corn, Switchgrass And Miscanthus RhizosphereFRTVIDNTAVDRLVREGFFEKLYGVGIKAEEDRQAKASFR*
Ga0070765_10111914223300006176SoilVAQQSDPQIAAQMKAYDFHQVIDNSTVERLVKEKFFETLFGATIKAEEDRKAKLAFK*
Ga0097621_10027735633300006237Miscanthus RhizosphereTIVDNSAIDRLVKEEFFEKLFGSSIKAEIDRKSKMAFR*
Ga0097621_10044846933300006237Miscanthus RhizosphereADLKAFDFRKVVDNSTVDRLVKEGFFEQLFGPDVKTEEQQRAKIAFGK*
Ga0097621_10173334723300006237Miscanthus RhizosphereVVEQQSDPQIAAQMKAYDFHKVVDDSTVDRLVKEKFFDTLFGASIKAEEDRKAKLAFK*
Ga0068871_10185420423300006358Miscanthus RhizosphereVADPQISAQMRAYDFHKVIDNGLVDRLVKEGFFESVFGPDVKAEEDRKAKLAFR*
Ga0079220_1205744523300006806Agricultural SoilAAAVKAVVEQQSDPQLAAQMKAYDFHKVVDNSTVDRLVKEKFFETLFGAPIKAEEDRKAKLAFK*
Ga0075420_10022724233300006853Populus RhizosphereNGTVARLVKEGFFQSLFGPGVKAEETRKAGQAYK*
Ga0075420_10127997613300006853Populus RhizosphereTVIDNSIVTRLVKEGFFQKLFGPAIKAEEDRKSKMAFR*
Ga0068865_10026475813300006881Miscanthus RhizosphereIDNSLVDRLVKEGFFETLFGPEIKAEEDRKAKLAFR*
Ga0068865_10046332623300006881Miscanthus RhizosphereAVIDNSVIDRLVKEGFFEKLFGAGVKSEIDRKSKLAFR*
Ga0075436_10043287513300006914Populus RhizosphereFHKVIDNSVVERLVREHFFENLYGASVKAEEDKKAKLAFK*
Ga0079219_1190308013300006954Agricultural SoilNSIVDRLVKEGFFEKLFGPSIKAEEERKAKLAFR*
Ga0079218_1186104623300007004Agricultural SoilDNSLVARLVKEGFFEKLFGAGVKAEEDRKAKLAFR*
Ga0099828_1199542613300009089Vadose Zone SoilNGLIDRLVKEGFFEKTFGPSIKSEQDKKSKAAYR*
Ga0105240_1075404433300009093Corn RhizosphereKKFDFRTVIDNAIVDRLVKEGFFEKLYGASIKAQEDRSAKSSFR*
Ga0105245_1002504313300009098Miscanthus RhizosphereSDPQIAAQMKAYDFHKVVDNGTVDRLVKEKFFETLFGATIKAEEDRKAKLAFK*
Ga0105245_1065663113300009098Miscanthus RhizosphereILEHVADPQISAQMRAYDFRKVIDNSLVDRLVKEGFFETLFGPEIKAEEDRKAKLAFR*
Ga0105245_1158071723300009098Miscanthus RhizosphereRKIIDNGVVDKLVKEGFFQQVFGPGVKAEEQSKAKLAFGK*
Ga0105247_1127269213300009101Switchgrass RhizosphereAYDFHKVVDNSTVERLVKEKFFETLFGATIKAEEDRKAKLAFK*
Ga0105243_1040694113300009148Miscanthus RhizosphereQADPQIGARMKAYDFRKVIDNSVVERLVREHFFENLFGPSIKAEEDRKGKLAFK*
Ga0105243_1161595023300009148Miscanthus RhizosphereFRKVIDNSVIERLVKEKYFEMLFGATIKAEEDRKAKLAFK*
Ga0105243_1192825323300009148Miscanthus RhizosphereIDNSIVQRLVEQGYFRDLFGAGVKAEEERKAAIAFR*
Ga0105243_1196991413300009148Miscanthus RhizosphereIVDNSAIDRLVKEGFFEKLFGSSIKAEIDRKSKMAFR*
Ga0111538_1025733143300009156Populus RhizosphereFDFRKIIDNGVVDKLVKEGFFQQVFGPGVKAEEQSKAKLAFGR*
Ga0111538_1056401333300009156Populus RhizosphereTKAIDFKTVIDNSVIDRLVKEGFFEKTFGAGVKSEQESRSKQAMR*
Ga0105241_1059334513300009174Corn RhizosphereAFERIPYVLADGVKAVVAQQSDPQLAAQMKAYDFHKVIDNSIVDRLVKEKYFEMLMGASIKAEEDRKAKLAFK*
Ga0105241_1059899523300009174Corn RhizosphereEHQADAQVGARLKAYDFHKVIDNSVVERLVREHFFENLYGTSVKAEEDKKAKLAFK*
Ga0105241_1117225113300009174Corn RhizosphereRIPYVLAPAVQWIIEHQADPQIGARMKAYDFRKVIDNSVVERLVREKFFENLFGPSIKAEEDRKGKLAFK*
Ga0105242_1030509613300009176Miscanthus RhizosphereKFDFRTVIDNATVDRLVRAGFFQKLFGPGVKEEEQRKEKLAFR*
Ga0105242_1281316123300009176Miscanthus RhizosphereVIDNSVIDRLVKEGFFEKLFGPGVKSEIDRKSKLAFR*
Ga0105248_1096691923300009177Switchgrass RhizosphereDVERIYELYAKPKAFERIPYVLGDGVKAVVAQQSDPQLAAQMKAYDFRKVIDNSVIERLVKEKYFEMLFGATIKAEEDRKAKLAFK*
Ga0105248_1230386223300009177Switchgrass RhizosphereYILEHVADPQISAQMRAYDFRKVIDNSLVDRLVKEGFFETLFGPEIKAEEDRKAKLAFR*
Ga0103848_109470723300009218River WaterVKSVLDQQADPQIAAQMKGYDWKKVIDNSYVEKLVKDGFYEQLFGASIKAEEQKKAKAAFGK*
Ga0116225_136510623300009524Peatlands SoilYERIPYVLAPAVQYIVEHQADAQVGARLKAYDFHKVIDNSVVERLVREHFFENLFGPSIKAEEDARAKLAFK*
Ga0105237_1103131123300009545Corn RhizosphereAVKAVVAEQSDPQIAAQMKAYDFHKVIDNSTIDRLIKEKYFEMLFGPAIKAEEDRKAKLAFK*
Ga0105237_1150370023300009545Corn RhizosphereQADAQVGARLKAYDFHKVIDNSVVERLVREHFFENLYGASVKAEEDKKAKLAFK*
Ga0116217_1055457313300009700Peatlands SoilQVGARLKAYDFHKVIDNSVVERLVREHFFENLFGSSIKAEEDARAQLAFK*
Ga0116219_1054490013300009824Peatlands SoilHDRKAESYERIPYVLAPAVQYIVEHQADAQVGARLKAYDFHKVIDNSVVERLVREHFFENLFGPSIKAEEDARAKLAFK*
Ga0126308_1117165523300010040Serpentine SoilMDAAVKSIVAQQVDQRLAADLKAFDFHKVVDNRTVDRLVKEGFFQTLFGQGIKTEEQRKASLAFK*
Ga0126377_1187764513300010362Tropical Forest SoilFDFKTVLDNSIVERLVKEGFFEKTFGPSIKAEIDRKSKMAFR*
Ga0105239_1166227523300010375Corn RhizosphereEQQSDPQISSQMKAYDFHKVIDNSTVERLVKEKFFETLFGATIKAEEDRKAKLAFK*
Ga0105239_1290461413300010375Corn RhizosphereNSTVDRLVKEKFFDTLFGASIKAEEDRKAKLAFK*
Ga0105239_1326098813300010375Corn RhizosphereGVKAVVAQQSDPQLAAQMKAYDFHKVIDNSIVDRLVKEKYFEMLMGASIKAEEDRKAKLAFK*
Ga0105239_1352505323300010375Corn RhizosphereYVLAPAVQYIVEHQADPQVGARLKAYDFHKVIDNSVVERLVREHFFENLFGPSIKAEEDARAKLAFK*
Ga0126381_10156448613300010376Tropical Forest SoilDFRTVIDNGTVDYLVRQGFFEKLFGPGVKAEENRKEKLATRK*
Ga0136449_10039092713300010379Peatlands SoilHKVIDNSYVSKLVKEGFFEQLFGPSVKAEEQRKAKLAFGK*
Ga0134127_1256359923300010399Terrestrial SoilVIDNSLVERLVREKFFENLFGPTIKAEEDRKGKLAFK*
Ga0134121_1097497113300010401Terrestrial SoilIDNSVVERLVREKFFENLFGPSIKAEEDRKGKLAFK*
Ga0134121_1311074513300010401Terrestrial SoilVDNGPVDRLVKAGFFEKLFGPSIKAEEDRKSKLALR*
Ga0134123_1315293813300010403Terrestrial SoilVVDNSIVDRLVKEGFFEKLFGSGIKAEEEHKSKLALR*
Ga0105246_1004643453300011119Miscanthus RhizosphereLAAQMKAYDFRKVIDNSVIERLVKEKYFEMLMGASIKAEEDRKAKLAFK*
Ga0105246_1058804523300011119Miscanthus RhizosphereVPAPGLDRLVKEGFFEKLFGSGIRAEIDRKSKMAFR*
Ga0105246_1091059813300011119Miscanthus RhizosphereMKAYDFRKVIDNSVVERLVREKFFENLFGPSIKAEEDRKGKLAFK*
Ga0150983_1101222213300011120Forest SoilYVLAGADKAVVAQQSDPQIAAQMKAYDFHKVIDNSTVERLVKEKFFETLFGATIKAEEDRKAKLAFK*
Ga0137431_106585113300012038SoilRTVIDNGVVARLVREGYFQKLFGPGVKAEEDRKSKLAFR*
Ga0150985_11936985323300012212Avena Fatua RhizosphereAVLKAFDAHKLVDNSYVDKLVKENFFVNLFGPSVKAEQERKSKLAFK*
Ga0150985_12147225513300012212Avena Fatua RhizosphereYDFHKVIDNSVVDRLVKQGFFENLFGADIKAEEQRKAKLAFR*
Ga0150984_10733413923300012469Avena Fatua RhizosphereKAYDFHKVIDNSFVDRLVKQGFFEQLFGPSIKAEEQRKAKLAFSR*
Ga0157282_1003956533300012904SoilVIDNGTVARLVKEGFFQSLFGPGVKAEETRKAGQAYK*
Ga0137404_1158161723300012929Vadose Zone SoilAAQMKAYDFHKVIDNSVIERLVKEKYFEMLFGATIKADEDRKAKLAFK*
Ga0126375_1147790323300012948Tropical Forest SoilQMAKFDFRTVLDNSIVDRLVKEGFFEKLFGAGIRAEEERKAKIVFK*
Ga0126369_1005554833300012971Tropical Forest SoilVLDNSIVEPLVKEGFFEKLFGAGIKAEEERKAKIAFR*
Ga0164304_1043643033300012986SoilFDFRTVIDNSAVDRLIKEGFFEKLYGAGIKAEEDRQAKTAFR*
Ga0157374_1017162013300013296Miscanthus RhizosphereNSIVQRLVEQGYFRDLFGAGVKAEEERKAAIAFR*
Ga0157378_1004244653300013297Miscanthus RhizosphereAQMRAYDFHKVIDNSLVDRLVKEGFFESLFGPEIKAEEDRKTKLAFR*
Ga0157378_1098417533300013297Miscanthus RhizosphereAQMRAYDFHKVIDNSLVDRLVKEGFFESLFGPEIKAEEDRKAKLAFR*
Ga0157378_1127508723300013297Miscanthus RhizosphereIDNSVIERLVKEKYFEMLFGATIKAEEDRKAKLAFK*
Ga0157378_1317296023300013297Miscanthus RhizosphereVIDNAAVDRLVREGFFEKLYGPTIKIQEDRSAKTAFR*
Ga0163162_1254499513300013306Switchgrass RhizosphereLYAKPKAFERIPYVLGDGVKAVVAQQSDPQLAAQMKAYDFRKVIDNSVIERLVKEKYFEMLFGATIKAEEDRKAKLAFK*
Ga0157372_1136689213300013307Corn RhizosphereIAAQMKAYDFHKVVDNSTVERLVKEKFFETLFGATIKADEDRKAKLAFK*
Ga0157375_1078039723300013308Miscanthus RhizosphereIDNSIVQRLVDQGYFRDLFGAGVKAEEERKAAIAFR*
Ga0120181_114903913300013766PermafrostYVLAPAVQYIVDHQADAQVGARLKAYDFHKVIDNSVVERLVREHFFENLFGPSVKAEEDRKAKLAFK*
Ga0163163_1023474943300014325Switchgrass RhizosphereVLADGVKAVVAQQSDPQLAAQMKAYDFHKVIDNSVIDRLVKEKYFEMLMGASIKTEEDRKAKLAFK*
Ga0163163_1092611113300014325Switchgrass RhizosphereSYERIPYVLAPAVQWIVDHQADPQIGAQLKAYDFHKVIDNSVVERLVREKFFANLFGPTIRAEEERKGNLAFK*
Ga0163163_1103469313300014325Switchgrass RhizosphereLKKFDFRTVIDNATVDRLVKEGFFEKLYGSGIKAAEDRQAKSAFR*
Ga0163163_1131402513300014325Switchgrass RhizosphereLEHVADPQIAAQMRAYDFHKVIDNSLVDRLVKEGFFEQLFGANIKSEEQQRAKIAFGK*
Ga0163163_1187844923300014325Switchgrass RhizosphereYDFRKVIDNSVIERLVKEKYFEMLFGATIKAEEDRKAKLAFK*
Ga0181536_1003604613300014638BogAQMKAYDFHKVIDNSYVSKLVKDGFFEQLFGPSIKAEEQRKARLAFGK*
Ga0181519_1019025333300014658BogVIDNSYVSKLVKEGFFEQLFGPSIKAEEQRKAKLAFGK*
Ga0157377_1062273413300014745Miscanthus RhizosphereVIDNSTVDRLVKEGFFDQLFGASIKTEEQQRAKIAFGK*
Ga0157377_1141299923300014745Miscanthus RhizosphereAQMKAYDFRKVIDNSVIERLVKEKYFEMLFGATIKAEEDRKAKLAFK*
Ga0180090_102352913300014866SoilHKVIDNGTVARLVKEGFFQSLFGPGVKAEETRKAGQAYK*
Ga0157379_1079376513300014968Switchgrass RhizosphereLKKFDFRTVIDNATVDRLVKEGFFEKLYGAGIKAQEDRSAKTAFR*
Ga0157379_1127158013300014968Switchgrass RhizosphereNSLVDRLVKERFFESLFGPEIKAEEDRKAKLAFR*
Ga0157379_1242202613300014968Switchgrass RhizosphereAKCRLLALNRLVKEGFFENLFGNGIRAEIDRKSKMAFR*
Ga0157379_1244940923300014968Switchgrass RhizosphereKAVVDQQSDAQIMAQMKAYDFHKIIDNSTVDHLVKEKFFETLFGAKIKAEEDRKAKLAFK
Ga0157379_1266883213300014968Switchgrass RhizosphereHQPDAQIAAQMKAYDFTKVIDNSVIDRLVKEHFFEQLFGAGIKAEQDSKAKIAFK*
Ga0157376_1085224323300014969Miscanthus RhizosphereVPYVLAPAAKAVVEQQSDPQIAAQMKAYDFHKVIDNSTVERLVKEKFFETLFGTTIKAEEDRKAKLAFK*
Ga0157376_1125150923300014969Miscanthus RhizosphereQIMAQMKAYDFHKIIDNSTVDHLVKEKFFETLFGAKIKAEEDRKAKLAFK*
Ga0137403_1111706923300015264Vadose Zone SoilSDPQLAAQMKAYDFHKVIDNSVIERLVKEKYFEMLFGATIKADEDRKAKLAFK*
Ga0137403_1122698513300015264Vadose Zone SoilQLAEQMSKFDFHKAIDNSYVDRLVKEGFFEMLFGPSIKAEEQRKAKLAFK*
Ga0132256_10158873713300015372Arabidopsis RhizosphereNGVVDRLVKAGFFKRLFGDEIRAEEELKAKIAFR*
Ga0163161_1059733813300017792Switchgrass RhizosphereVVDNSTVDRLVKEGFFEKLFGTEIKSEENRKSKLALR
Ga0187807_126462523300017926Freshwater SedimentVPYVLAPAVDYIIHHQADANIAKQMQAYDFHKVIDNSVIDRLVKEHFFEQLFGSGIKAEEDAKSKLAFK
Ga0187819_1057414023300017943Freshwater SedimentAQMKAYDFHKVIDNSYVEKLVKDGSFEKIFGASIKADEERKAKEMYK
Ga0187847_1069721813300017948PeatlandIDNSMVARLVREGFFEKLFGPGVKAEQDRKEKLAYR
Ga0187779_1110157113300017959Tropical PeatlandILEHVADPQIAAQMKAYDFHKVVDNSTVERLVKEKFFEMLFGASIKAEEDRKAKLAFK
Ga0187782_1137400123300017975Tropical PeatlandVDNSIVDRLVRRGFFEDLFGPGIKSEQQKKAALAL
Ga0187810_1031270113300018012Freshwater SedimentYDFHKVIDNSVVERLVQEHFFEQLFGSGIQAEEERKAKLAFK
Ga0187784_1036661713300018062Tropical PeatlandRGYDYRKVIDNSYVDRLVKEGFFEMLYGPSIKAEEDRKARLQFK
Ga0187773_1109497423300018064Tropical PeatlandPYVLAPAVQYIVEHQADPQVGARLKAYDFHKVIDNSVVDRLVKEHFFENLFGPGVKAEEDRKKKMAF
Ga0190265_1124750413300018422SoilKGFDYHTVIDNSTVRRLVKEGFFRQLFGSGIKAEEDRKAKLAF
Ga0190268_1165809513300018466SoilNAGNYRTLIDNSTVDRLVKEGFFQKLFGPSIRAEEERKAKLAFR
Ga0190274_1021944213300018476SoilRLSADLKAYDFHKVIDNGTVVRLVKEGFFQSLFGPGVKAEETRKAGQAYK
Ga0190274_1206812323300018476SoilDNGVVARLVREGYFQTLFGAGVKAEEDRKSKIAFR
Ga0190264_1032292413300019377SoilFKKVVDNSAVDKLVKEGFFQKVFGPQIKAEEQSKAKLAFR
Ga0206354_1044126323300020081Corn, Switchgrass And Miscanthus RhizosphereQMKAYDFRKSIDNSVIDRLVKEHYFEQLFGPSVKAEEEAKSKIAVR
Ga0210403_1056345023300020580SoilQIAAQMKAYDFHKVIDNSTVERLVKEKFFETLFGATIKAEEDRKAKLAFK
Ga0210401_1113355023300020583SoilIDNTIVDRLVKEGFFEQLFGASVKAEEESKTKLAFR
Ga0210401_1124601923300020583SoilHQADANIAAQMKAFDFRKVIDNSVTDRLVREHFFEHLFGPGVKAEEESKAKIAVK
Ga0210406_1062520723300021168SoilDFHMVIDNSIVDSLVKQGFFEQLFGPSIKAEEQRKSKLAFRK
Ga0210400_1014868643300021170SoilAQQSDPQIAAQMKAYDFHKVIDNSTVERLVKEKFFETLFGPTVKAEEDRKAKLAFK
Ga0210400_1058584123300021170SoilDFHKVIDNSYVSKLVKEDFFEKLYGPSIKAEQQRKAKLAYGR
Ga0210388_1142855623300021181SoilVQYIVDHQADARIAAQMKAYDFHKVIDNSVVERLVREHYFEQLFGPEIKAEQDSKARLEF
Ga0210386_1079393723300021406SoilVPYVLAPAVQYIVEHQADANIAAQMKAYDFHKVIDNSVVERLVKEHFFEQLFGQGIKAEQDSKGRLEFK
Ga0210391_1148931713300021433SoilDPQIAAQMKAYDFHKVIDNSYVSKLMKEGFFEQLFGPSIKAEEQRKAKLAFGK
Ga0210402_1198169813300021478SoilFHKVIDNSLVDRLVKEGFFESLFGPGVKAEEDRKAKIAFR
Ga0242668_108691823300022529SoilADANIAAQMKAFDFRKVIDNSVTDRLVREHFFEHLFGPGVKAEEESKAKIAVK
Ga0242657_113336723300022722SoilKVIDNSVVERLVREHFFEHLFGPAIKAEQDSKAKLAFK
Ga0222622_1139723613300022756Groundwater SedimentDNSAIDRLVKEGFFEKLFGPTIKSEIERKSKMAFR
Ga0247743_105041313300023067SoilHTVIDNSLVARLVKEGFFEKLFGPGVKAEEDRKAKAAFK
Ga0207656_1025137413300025321Corn RhizosphereAVQWIIEHQADPQIGARMKAYDFRKVNDNSVVERLVREHFFENLFGPSIKAEEDRKGKLAFK
Ga0207642_1085447413300025899Miscanthus RhizospherePQIGARMKAYDFRKVIDNSVVERLVREKFFENLFGPSIKAEEDRKGKLAFK
Ga0207680_1095718213300025903Switchgrass RhizosphereHKVIDNSIVDRLVKEKYFEMLMGASIKAEEDRKAKLAFK
Ga0207647_1034563923300025904Corn RhizosphereIDNSVVERLVREHFFENLFGPSIKAEEDRKGKLAFK
Ga0207699_1062983923300025906Corn, Switchgrass And Miscanthus RhizosphereLAAAVKAVVEQQSDPQIAAQMKAYDFHKIIDNGTVERLVKEKFFETLFGASIKAEEDRKAKLAFK
Ga0207654_1035223413300025911Corn RhizosphereDGVKAVVEQQSDPQLAAQMKAYDFHKVIDNSIVDRLVKEKYFEMLMGVSIKAEEDRKAKLAFK
Ga0207654_1052059723300025911Corn RhizosphereAYDFHKVVDNSTVDRLVKEKFFDTLFGASIKAEEDRKAKLAFK
Ga0207654_1079915923300025911Corn RhizosphereHQADAQVGARLKAYDFHKVIDNSVVERLVREHFFENLYGTSVKAEEDKKAKLAFK
Ga0207695_1120974213300025913Corn RhizosphereRAYDFHKVIDNGLVDRLVKEGFFESVFGPDVKAEEDRKAKLAFR
Ga0207671_1127891113300025914Corn RhizosphereLAPAVQWIIEHQADPQIGARMKAYDFRKVIDNSVVERLVREHFFENLFGPSIKAEEDRKGKLAFK
Ga0207657_1071100213300025919Corn RhizosphereERIPYVLAPAVQWIIEHQADPQIGARMKAYDFRKVIDNSVVERLVREHFFENLFGPSIKAEEDRKGKLAFK
Ga0207657_1122531723300025919Corn RhizosphereVIDNSVVERLVREHFFENLFGPSIKAEEDARGKLAFK
Ga0207694_1180657723300025924Corn RhizosphereQWIVEHQADAQIGAQLKAYDFHKVIDNSVVDKLVREHFFENLYGPSVKAEQDRKSKLAFR
Ga0207687_1078341223300025927Miscanthus RhizosphereVIDNSLVDRLVKEGFFETLFGPEIKAEEDRKAKLAFR
Ga0207687_1086096523300025927Miscanthus RhizosphereQQSDPQIAAQMKAYDFHKVVDNGTVDRLVKEKFFETLFGATIKAEEDRKAKLAFK
Ga0207687_1109134713300025927Miscanthus RhizosphereDNSTVERLVKEKFFETLFGVTIKAEEDRKAKLAFK
Ga0207687_1166930023300025927Miscanthus RhizosphereQLAAQMKAYDFHKVIDNSVIDRLVKEKYFETLLGASIKSEEDRKAKLAFK
Ga0207701_1165545713300025930Corn, Switchgrass And Miscanthus RhizosphereDLKGYDFKKVIDNSVVARLVKDGYFQQVFGPGVKAEEQSKASMAFK
Ga0207686_1014362913300025934Miscanthus RhizosphereVKAVVAQQSDPQLAAQMKAYDFHKVIDNSIIDRLVKEKYFEMLMGASIKTEEDRKAKLAF
Ga0207686_1035245323300025934Miscanthus RhizosphereDPQISAQMRAYDFRKVIDNSLVDRLVKEGFFESLFGPEIKAEEDRKAKLAFR
Ga0207686_1038818813300025934Miscanthus RhizosphereQMKAYDFHKVVDNSTVERLVKEKFFETLFGATIKAEEDRKAKLAFK
Ga0207709_1111135223300025935Miscanthus RhizosphereFRKVIDNSVIERLVKEKYFEMLFGATIKAEEDRKAKLAFK
Ga0207669_1155069323300025937Miscanthus RhizosphereKFDFRTVIDNATVDRLVKEGFFEKLYGSGIKAAEERQAKSSFR
Ga0207704_1018413433300025938Miscanthus RhizosphereVDNSVVDKLVKEGFFQQVFGPGVKAEEQAKAKLAFGK
Ga0207704_1022696213300025938Miscanthus RhizosphereQISAQMRAYDFRKVIDNSLVDRLVKEGFFQSLFGPDVKAEEDRKAKLAFR
Ga0207704_1077923513300025938Miscanthus RhizosphereIDNSLVDRLVKEGFFETLFGPEIKAEEDRKAKLAFR
Ga0207665_1155283413300025939Corn, Switchgrass And Miscanthus RhizosphereRAWDVADPQIGAQMRVFDFRKVIDNSVIDRLVREHYFEQLFGPAIKAEQERKAKLAFK
Ga0207691_1117320623300025940Miscanthus RhizosphereADAQIGAQLKAYDFHKVIDNSVVEKLVREHFFENLYGPSVKAEQDRKAKIAFK
Ga0207711_1000830413300025941Switchgrass RhizosphereYDFHKVVDNSTVDRLAKEKFFETLFGATIKAEEDRKAKLAFK
Ga0207711_1066982713300025941Switchgrass RhizosphereDVERIYELYAKPKAFERIPYVLGDGVKAVVAQQSDPQLAAQMKAYDFRKVIDNSVIERLVKEKYFEMLFGATIKAEEDRKAKLAFK
Ga0207711_1114955013300025941Switchgrass RhizosphereFRKVIDNSLVDRLVKEGFFETLFGPEIKAEEDRKAKLAFR
Ga0207661_1079328223300025944Corn RhizosphereTVIDNSVVARLVKEGFFEKLFGPGVKAEEDRKSKLAFR
Ga0207679_1195719323300025945Corn RhizosphereFKAFDFKKIIDNSVVDKLVKEGFFQQVFGPGVKAEEQSKAKLAFGR
Ga0207712_1107214223300025961Switchgrass RhizosphereLYAKPKAFERIPYVLSDGVKAVIAQQSDPQLAAQMKAYDFRKVIDNSVIERLVKEKYFEMLFGATIKAEEDRKAKLAFK
Ga0207640_1063731023300025981Corn RhizosphereIAAQMKAYDFRKSIDNSVIDRLVKEHYFEQLFGPSEKAEEEAIASLPST
Ga0207640_1143613423300025981Corn RhizosphereIIEHQADPQIGARMKAYDFRKVIDNSVVERLVREHFFENLFGPSIKAEEDRKGKLAFK
Ga0207658_1076385813300025986Switchgrass RhizospherePYVLAPAVQWIIEHQADPQIGARMKAYDFRKVIDNSVVERLVREKFFENLFGPSIKAEEDRKGKLAFK
Ga0207677_1013984243300026023Miscanthus RhizosphereQQSDPQLAAQMKAYDFHKVIDNSVIERLVKEKYFEMLFGATIKAEEDRKAKLAFK
Ga0207677_1172614423300026023Miscanthus RhizosphereMIDNATVDRLVKEGFFEKLYGSGIKAAEDRQAKSAFR
Ga0207639_1214567413300026041Corn RhizosphereFHKVIDNSTIDRLIKEKYFEMLFGPAIKAEEDRKAKLAFK
Ga0207708_1098543823300026075Corn, Switchgrass And Miscanthus RhizosphereLKAYDFHKVIDNGTVARLVKEGFFQSLFGPGVKAEETRKAGQAYK
Ga0207641_1052566123300026088Switchgrass RhizosphereQADPQIGARMKAYDFRKVIDNSVVERLVREHFFENLFGPSIKAEEDRKGKLAFK
Ga0207648_1124496413300026089Miscanthus RhizosphereDPQIAAQMKAYDFRKVVDNSTIERLVKEKYFETLFGASIKAEQDRKAKLAFK
Ga0207674_1041163613300026116Corn RhizosphereMKAYDFHKVIDNSIVDRLVKEKYFEMLMGASIKAEEDRKAKLAFK
Ga0207698_1040858613300026142Corn RhizosphereAVKYIQEHQADAQTGARLKAYDFHKVIDNSVVERLVREHFFENLFGPSIKAEEDRKAKMAFK
Ga0207698_1086165913300026142Corn RhizosphereIDNGVVDKLVKEGFFQQVFGPGVKAEEQSKAKLAFGK
Ga0207698_1174478323300026142Corn RhizospherePYVLAPAVKAVVEQQSDPQIAAQMKAYDFHKVVDNSTVERLVKEKFFETLFGATIKAEEDRKAKLAFK
Ga0207698_1175853223300026142Corn RhizosphereIDNSVIERLVKEKYFEMLFGPTIKAEEDRKAKLAFK
Ga0209523_107186013300027548Forest SoilFDFHKSVDNSYVEKLVKEHFFEQLFGPSIKAEEDRKAKLAFR
Ga0209387_120236913300027639Agricultural SoilYDFHKVIDNGTVARLVKEGFFQSLFGPTVKTEETRKAGQAYK
Ga0209656_1054899513300027812Bog Forest SoilIDNRPVRKLIEEGFFEKLFGPDIRAEEERKLKVAFA
Ga0209274_1059095913300027853SoilFDFRAVIDNSVVERLVREGYFEKLFGVSIKDEEERKAKQAFR
Ga0209517_10005507193300027854Peatlands SoilYDFHKVIDNSVVERLVREHFFENLFGPSIKAEEDARAKLAFK
Ga0209486_1005067143300027886Agricultural SoilKAYDFHKVIDNGTVARLVKEGFFQSLFGPTVKTEETRKAGQAYK
Ga0209486_1127248613300027886Agricultural SoilDNSLVARLVKEGFFEKLFGAGVKAEEDRKAKLAFR
Ga0209415_1026069133300027905Peatlands SoilHKVIDNSYVSKLVKEGFFEQLFGPSVKAEEQRKAKLAFGK
Ga0209415_1066275213300027905Peatlands SoilDNSYVSKLVKEGFFDQLFGPSVKAEEQGKAKLAFGK
Ga0207428_1065143913300027907Populus RhizosphereDFHTVIDNSLVARLVKEGFFEKLFGPGVKAEEDRKAKAAFK
Ga0268266_1117691023300028379Switchgrass RhizosphereDNSVVARLVKEGFFQKLFGPGVKAEEDRKSKLAFR
Ga0268264_1024800433300028381Switchgrass RhizosphereQMKAYDFRKVVDNSIVERLVKEKFFETLFGATIKAEQDRKAKLAFK
Ga0222749_1080770113300029636SoilAYDFRKVVDNSTIDRLVKEKFFETLFGASVKTEEDRKAKLAFK
Ga0311332_1167011413300029984FenKGYDWKQVIDNSVVEKLVKQGFFEQLFGKEIKAEQDRKAKLAFRK
Ga0307495_1013172723300031199SoilVRTVVDNSVIDRLVKEGFFEKLFGPAIKPEIDRKSKMAFR
Ga0170824_11136905823300031231Forest SoilFDFRKVIDNSMIERLVKEGFFEQLFGPSIKAEEEKKAKLAFR
Ga0302320_1054560733300031524BogAAQMKAYDFHKVIDNSYVSKLVKEGFFEQVFGPSVKAEEQRKAKLAFGK
Ga0310888_1001324853300031538SoilKAYDFHKVIDNGTVARLVKEGFFQSLFGPGVKAEETRKAGQAYK
Ga0310886_1005945533300031562SoilLKAFDFRKIVDNSVVDKLVKEGFFQQVFGPGVKAEEQSKAKLAFGR
Ga0310886_1008574633300031562SoilVIDNSLVARLVKEGFFEKLFGPGVKAEEDRKAKAAFK
Ga0310686_10179105823300031708SoilIDNSLVDRLVREGFFEKLFGPEIKAEEERKAKLAFR
Ga0310686_11455794923300031708SoilMKAFDFHRVIDNGTVQRLVREGFFEELFGTGIKTEEETKARIAFGR
Ga0310686_11860982123300031708SoilDFRKVIDNSLVDRLVREGFFEKLFGPEIKSEEERKAKIAFR
Ga0310813_1156498123300031716SoilLKRFDFRTVIDNAAVDRLVREGFFEKLYGSGIKAEEDRQAKTAFR
Ga0310813_1198205223300031716SoilYDFHKVIDNSVVERLVREHFFENLFGPSIKAEEDARGKLAFK
Ga0307468_10239927413300031740Hardwood Forest SoilTDLKAYDFHKVIDNGTVARLVKEGFFQSLFGPAIKAEESRKAGQAYK
Ga0318521_1103084713300031770SoilMKAFDFHKTIDNSYVDRLVKEGFFEQVFGAQIKAEEQKKSKLAFR
Ga0318529_1020730023300031792SoilRSVIDNGTVDYLVRQGFFEKLFGPGVKAEENRKEKLAMRK
Ga0307478_1131575013300031823Hardwood Forest SoilVPYVLAPAVKAVIAQQSDPQTAAQMKAYDFHKVIDNSTVERLVKEKFFETLFGPTIKAEEDRKAKLAFK
Ga0302322_10368988613300031902FenIDNSVVERLVKQGFFEQLFGKANIKAEQDRKAKLAFRK
Ga0302322_10384709223300031902FenNPQLKTFDFSKLVDNSVVLKLVREGWFEKLYGPSVKAEQDRKLKEAFGV
Ga0306921_1267285313300031912SoilFDFHAVIDNAVVERLVREGYFEKLFGPAIKDEEARKAKLAYR
Ga0310891_1000480743300031913SoilDLKAYDFHKVIDNGTVARLVKEGFFQSVFGPGVKAEETRKAGQAYK
Ga0308174_1105507923300031939SoilDNTAVDRLVREGFFEKLYGTNIKPEEDRQAKASFR
Ga0310901_1060739223300031940SoilRAIDFKTVIDNSIVDRLVKEGFFEKTFGASVKSEQESRSKQAMR
Ga0310916_1151780123300031942SoilKLKPADLRMVVDNSVVDRLVKDGFFVQTFGPNIKSEQDRKSKAAFR
Ga0310884_1028024223300031944SoilNSVVDKLVKEGFFQQVFGPGVKAEEQSKAKLAFGR
Ga0310910_1054826623300031946SoilSFDFRTVIDNGTVDYLVRQGFFEKLFGPGVKAEENRKEKLAMRK
Ga0318531_1057298513300031981SoilMKSFDFRTVIDNGTVDYLVRQGFFEKLFGPGVKAEENRKEKLAMRK
Ga0308176_1063134113300031996SoilDLKNYDFHKVIDNSAVDRLVKEGFFENLFGAGIKAEEQRKAKLAFR
Ga0310902_1001446913300032012SoilLSADLKAYDFHKVIDNGTVARLVKEGFFQSVFGPGVKAEETRKAGQAYK
Ga0310899_1003709733300032017SoilNGVVDKLVKEGFFQQVFGPGVKAEEQSKAKLAFGK
Ga0310899_1022041713300032017SoilDFHKVIDNGTVARLVKEGFFQSLFGPGVKAEETRKAGQAYK
Ga0310890_1175467723300032075SoilDFKTVIDNSIVDRLVKEGFFEKTFGASVKSEQESRSKQAMR
Ga0318518_1071893523300032090SoilTVADQSIVDKLVREGFFEKLFGPGVKEEEARKAKTAFR
Ga0315910_1048106623300032144SoilDAKLVAQMKTFDFRTVIDNSIVARLVKEGFFEMLFGPGVKAEEDRKAKAAFR
Ga0310889_1001087313300032179SoilKVIDNGTVARLVKEGFFQSVFGPGVKAEETRKAGQAYK
Ga0306920_10205839123300032261SoilAQLRAFDFRKVIDNSLVERLVREGFFENLFGAGIKAEEDRKAKLAYR
Ga0310812_1011257033300032421SoilIIDNSVVDKLVKEGFFQQVFGPGVKAEEQSKAKLAFGR
Ga0348332_1054662913300032515Plant LitterADARIEAQMKAYDFHKVIDNSVIERLVREHFFEQLFGPEIKAEQDSKARLEFK
Ga0335081_1172490033300032892SoilPQLAAQMKGFDFRKVIDNSIVDRLVKQGFFEQLFGPSIKAEEESKAKLAFR
Ga0335084_1108852113300033004SoilDPHKVIDNSVVDRLVKEGFFEKTFGPSIKSEQEKKSKAAYR
Ga0335084_1120350933300033004SoilDNSMVARLVRDGFFERLFGPQVKSEEDRKEKLAFR
Ga0326723_0106501_1029_12143300034090Peat SoilVNAVVAQQSDPQIAAQMKAFDFHKVVDNSTVDRLVKEKFFETLFGATIKAEEDRKAKLAF
Ga0364932_0283510_3_1133300034177SedimentDNSTVDRLVKEGFFETLFGPAIKAEQQSKARLAFGK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.