| Basic Information | |
|---|---|
| Family ID | F010961 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 297 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MQRVTAMMAYVVSEGRLCALKPAEWSLLLTGVALCGIATLLFLMLHA |
| Number of Associated Samples | 219 |
| Number of Associated Scaffolds | 297 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 61.95 % |
| % of genes near scaffold ends (potentially truncated) | 43.43 % |
| % of genes from short scaffolds (< 2000 bps) | 74.75 % |
| Associated GOLD sequencing projects | 205 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (58.923 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (8.754 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.875 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.108 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.00% β-sheet: 0.00% Coil/Unstructured: 48.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 297 Family Scaffolds |
|---|---|---|
| PF00459 | Inositol_P | 15.82 |
| PF14023 | DUF4239 | 7.41 |
| PF06411 | HdeA | 4.38 |
| PF04964 | Flp_Fap | 3.37 |
| PF00015 | MCPsignal | 3.03 |
| PF00497 | SBP_bac_3 | 2.69 |
| PF03886 | ABC_trans_aux | 2.69 |
| PF01734 | Patatin | 1.68 |
| PF00672 | HAMP | 1.68 |
| PF06186 | DUF992 | 1.35 |
| PF13649 | Methyltransf_25 | 1.35 |
| PF13458 | Peripla_BP_6 | 1.01 |
| PF06742 | DUF1214 | 1.01 |
| PF00027 | cNMP_binding | 1.01 |
| PF07719 | TPR_2 | 0.67 |
| PF00781 | DAGK_cat | 0.67 |
| PF12200 | DUF3597 | 0.67 |
| PF08238 | Sel1 | 0.67 |
| PF01370 | Epimerase | 0.34 |
| PF03699 | UPF0182 | 0.34 |
| PF07690 | MFS_1 | 0.34 |
| PF00082 | Peptidase_S8 | 0.34 |
| PF03706 | LPG_synthase_TM | 0.34 |
| PF01757 | Acyl_transf_3 | 0.34 |
| PF12860 | PAS_7 | 0.34 |
| PF06078 | DUF937 | 0.34 |
| PF04226 | Transgly_assoc | 0.34 |
| PF10101 | DUF2339 | 0.34 |
| PF00903 | Glyoxalase | 0.34 |
| PF12071 | DUF3551 | 0.34 |
| PF04536 | TPM_phosphatase | 0.34 |
| PF13561 | adh_short_C2 | 0.34 |
| PF01557 | FAA_hydrolase | 0.34 |
| COG ID | Name | Functional Category | % Frequency in 297 Family Scaffolds |
|---|---|---|---|
| COG0840 | Methyl-accepting chemotaxis protein (MCP) | Signal transduction mechanisms [T] | 6.06 |
| COG3847 | Flp pilus assembly protein, pilin Flp | Extracellular structures [W] | 3.37 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 1.68 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 1.68 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 1.68 |
| COG1597 | Phosphatidylglycerol kinase, diacylglycerol kinase family | Lipid transport and metabolism [I] | 1.35 |
| COG5361 | Uncharacterized conserved protein | Mobilome: prophages, transposons [X] | 1.01 |
| COG5402 | Uncharacterized protein, contains DUF1214 domain | Function unknown [S] | 1.01 |
| COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 0.34 |
| COG1615 | Uncharacterized membrane protein, UPF0182 family | Function unknown [S] | 0.34 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.34 |
| COG3753 | Uncharacterized conserved protein YidB, DUF937 family | Function unknown [S] | 0.34 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 58.92 % |
| Unclassified | root | N/A | 41.08 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2032320006|FACEOR_FYWIORV02FSQ77 | Not Available | 521 | Open in IMG/M |
| 2162886013|SwBSRL2_contig_10030663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 920 | Open in IMG/M |
| 2162886013|SwBSRL2_contig_1174364 | Not Available | 1001 | Open in IMG/M |
| 2162886013|SwBSRL2_contig_2433038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 885 | Open in IMG/M |
| 2166559005|cont_contig27239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1121 | Open in IMG/M |
| 2170459012|GOYVCMS01CO565 | Not Available | 517 | Open in IMG/M |
| 2189573000|GPBTN7E01EKERO | Not Available | 516 | Open in IMG/M |
| 2228664021|ICCgaii200_c0799189 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1361 | Open in IMG/M |
| 2228664022|INPgaii200_c0849749 | Not Available | 734 | Open in IMG/M |
| 3300000156|NODE_c0730550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 7890 | Open in IMG/M |
| 3300000443|F12B_10036616 | Not Available | 500 | Open in IMG/M |
| 3300000787|JGI11643J11755_11608666 | Not Available | 825 | Open in IMG/M |
| 3300001991|JGI24743J22301_10109375 | Not Available | 600 | Open in IMG/M |
| 3300002074|JGI24748J21848_1006533 | Not Available | 1358 | Open in IMG/M |
| 3300003319|soilL2_10278259 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1540 | Open in IMG/M |
| 3300003659|JGI25404J52841_10134001 | Not Available | 524 | Open in IMG/M |
| 3300003994|Ga0055435_10189894 | Not Available | 588 | Open in IMG/M |
| 3300003995|Ga0055438_10021933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1456 | Open in IMG/M |
| 3300004114|Ga0062593_101662468 | Not Available | 696 | Open in IMG/M |
| 3300004156|Ga0062589_101263630 | Not Available | 711 | Open in IMG/M |
| 3300004463|Ga0063356_106314742 | Not Available | 508 | Open in IMG/M |
| 3300004479|Ga0062595_100353370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1025 | Open in IMG/M |
| 3300004479|Ga0062595_101277299 | Not Available | 658 | Open in IMG/M |
| 3300004479|Ga0062595_101564077 | Not Available | 612 | Open in IMG/M |
| 3300004633|Ga0066395_10536919 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 678 | Open in IMG/M |
| 3300004798|Ga0058859_11659987 | Not Available | 627 | Open in IMG/M |
| 3300005093|Ga0062594_101213818 | Not Available | 749 | Open in IMG/M |
| 3300005162|Ga0066814_10040859 | Not Available | 733 | Open in IMG/M |
| 3300005162|Ga0066814_10058226 | Not Available | 652 | Open in IMG/M |
| 3300005164|Ga0066815_10004193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 1499 | Open in IMG/M |
| 3300005183|Ga0068993_10257540 | Not Available | 621 | Open in IMG/M |
| 3300005218|Ga0068996_10063976 | Not Available | 754 | Open in IMG/M |
| 3300005288|Ga0065714_10235184 | Not Available | 807 | Open in IMG/M |
| 3300005293|Ga0065715_10118185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium | 2313 | Open in IMG/M |
| 3300005294|Ga0065705_10830854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 586 | Open in IMG/M |
| 3300005330|Ga0070690_100145257 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1613 | Open in IMG/M |
| 3300005332|Ga0066388_100057229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4085 | Open in IMG/M |
| 3300005332|Ga0066388_100057352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4082 | Open in IMG/M |
| 3300005332|Ga0066388_100182129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2710 | Open in IMG/M |
| 3300005332|Ga0066388_100765422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1563 | Open in IMG/M |
| 3300005332|Ga0066388_101176877 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1308 | Open in IMG/M |
| 3300005332|Ga0066388_101254702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1273 | Open in IMG/M |
| 3300005332|Ga0066388_104630314 | Not Available | 700 | Open in IMG/M |
| 3300005332|Ga0066388_107003400 | Not Available | 567 | Open in IMG/M |
| 3300005334|Ga0068869_100000629 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 19915 | Open in IMG/M |
| 3300005336|Ga0070680_101694756 | Not Available | 548 | Open in IMG/M |
| 3300005337|Ga0070682_101812443 | Not Available | 533 | Open in IMG/M |
| 3300005341|Ga0070691_10177601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium | 1106 | Open in IMG/M |
| 3300005344|Ga0070661_100108603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium | 2070 | Open in IMG/M |
| 3300005353|Ga0070669_100000648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 25758 | Open in IMG/M |
| 3300005353|Ga0070669_101492160 | Not Available | 588 | Open in IMG/M |
| 3300005434|Ga0070709_10000366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 27730 | Open in IMG/M |
| 3300005434|Ga0070709_10985385 | Not Available | 670 | Open in IMG/M |
| 3300005436|Ga0070713_100236700 | Not Available | 1661 | Open in IMG/M |
| 3300005438|Ga0070701_10155728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium | 1320 | Open in IMG/M |
| 3300005439|Ga0070711_100020556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4256 | Open in IMG/M |
| 3300005439|Ga0070711_100073674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2413 | Open in IMG/M |
| 3300005445|Ga0070708_100593599 | Not Available | 1044 | Open in IMG/M |
| 3300005457|Ga0070662_100803514 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 800 | Open in IMG/M |
| 3300005518|Ga0070699_100113693 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2378 | Open in IMG/M |
| 3300005526|Ga0073909_10303751 | Not Available | 726 | Open in IMG/M |
| 3300005529|Ga0070741_10019850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 10693 | Open in IMG/M |
| 3300005541|Ga0070733_10011402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5602 | Open in IMG/M |
| 3300005545|Ga0070695_100045618 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2794 | Open in IMG/M |
| 3300005546|Ga0070696_100947014 | Not Available | 717 | Open in IMG/M |
| 3300005546|Ga0070696_101382804 | Not Available | 600 | Open in IMG/M |
| 3300005549|Ga0070704_101079234 | Not Available | 729 | Open in IMG/M |
| 3300005564|Ga0070664_101131764 | Not Available | 738 | Open in IMG/M |
| 3300005564|Ga0070664_101461053 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 647 | Open in IMG/M |
| 3300005578|Ga0068854_100599616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 940 | Open in IMG/M |
| 3300005614|Ga0068856_100582806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus | 1140 | Open in IMG/M |
| 3300005615|Ga0070702_101693130 | Not Available | 525 | Open in IMG/M |
| 3300005618|Ga0068864_100597309 | Not Available | 1071 | Open in IMG/M |
| 3300005713|Ga0066905_100015355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3861 | Open in IMG/M |
| 3300005713|Ga0066905_100043542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2684 | Open in IMG/M |
| 3300005713|Ga0066905_100192958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 1515 | Open in IMG/M |
| 3300005713|Ga0066905_100467093 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
| 3300005713|Ga0066905_100474303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1034 | Open in IMG/M |
| 3300005713|Ga0066905_101859522 | Not Available | 556 | Open in IMG/M |
| 3300005718|Ga0068866_11161743 | Not Available | 556 | Open in IMG/M |
| 3300005719|Ga0068861_101297937 | Not Available | 708 | Open in IMG/M |
| 3300005764|Ga0066903_100084183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4176 | Open in IMG/M |
| 3300005764|Ga0066903_100104727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3843 | Open in IMG/M |
| 3300005764|Ga0066903_100419040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 2216 | Open in IMG/M |
| 3300005764|Ga0066903_103077804 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 903 | Open in IMG/M |
| 3300005764|Ga0066903_103448235 | Not Available | 853 | Open in IMG/M |
| 3300005840|Ga0068870_11324580 | Not Available | 525 | Open in IMG/M |
| 3300005841|Ga0068863_100642739 | Not Available | 1052 | Open in IMG/M |
| 3300005843|Ga0068860_101093251 | Not Available | 817 | Open in IMG/M |
| 3300005843|Ga0068860_101767354 | Not Available | 640 | Open in IMG/M |
| 3300005937|Ga0081455_10006749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 12253 | Open in IMG/M |
| 3300005937|Ga0081455_10073104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2836 | Open in IMG/M |
| 3300005937|Ga0081455_10325991 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1092 | Open in IMG/M |
| 3300006041|Ga0075023_100017964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 1929 | Open in IMG/M |
| 3300006041|Ga0075023_100119003 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 937 | Open in IMG/M |
| 3300006041|Ga0075023_100172596 | Not Available | 814 | Open in IMG/M |
| 3300006047|Ga0075024_100148777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 1066 | Open in IMG/M |
| 3300006047|Ga0075024_100210982 | Not Available | 914 | Open in IMG/M |
| 3300006050|Ga0075028_100223625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1024 | Open in IMG/M |
| 3300006057|Ga0075026_100435955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 743 | Open in IMG/M |
| 3300006057|Ga0075026_100786459 | Not Available | 576 | Open in IMG/M |
| 3300006163|Ga0070715_10155757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aestuariivirgaceae → Aestuariivirga → Aestuariivirga litoralis | 1124 | Open in IMG/M |
| 3300006172|Ga0075018_10456827 | Not Available | 659 | Open in IMG/M |
| 3300006579|Ga0074054_11726937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium | 817 | Open in IMG/M |
| 3300006580|Ga0074049_11643981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1094 | Open in IMG/M |
| 3300006804|Ga0079221_10281262 | Not Available | 964 | Open in IMG/M |
| 3300006804|Ga0079221_10588680 | Not Available | 747 | Open in IMG/M |
| 3300006845|Ga0075421_101722158 | Not Available | 677 | Open in IMG/M |
| 3300006847|Ga0075431_101256526 | Not Available | 702 | Open in IMG/M |
| 3300006852|Ga0075433_10052895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3539 | Open in IMG/M |
| 3300006852|Ga0075433_10631821 | Not Available | 939 | Open in IMG/M |
| 3300006854|Ga0075425_100026858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 6357 | Open in IMG/M |
| 3300006854|Ga0075425_100474625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1440 | Open in IMG/M |
| 3300006871|Ga0075434_101939376 | Not Available | 595 | Open in IMG/M |
| 3300006904|Ga0075424_100329151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 1627 | Open in IMG/M |
| 3300006954|Ga0079219_10237410 | Not Available | 1071 | Open in IMG/M |
| 3300009081|Ga0105098_10761600 | Not Available | 519 | Open in IMG/M |
| 3300009094|Ga0111539_10004629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 17966 | Open in IMG/M |
| 3300009094|Ga0111539_10339469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1749 | Open in IMG/M |
| 3300009098|Ga0105245_10179079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2024 | Open in IMG/M |
| 3300009137|Ga0066709_101194794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1119 | Open in IMG/M |
| 3300009156|Ga0111538_13691507 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 530 | Open in IMG/M |
| 3300009545|Ga0105237_10266340 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1716 | Open in IMG/M |
| 3300009792|Ga0126374_11121888 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 625 | Open in IMG/M |
| 3300010046|Ga0126384_10003466 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9607 | Open in IMG/M |
| 3300010047|Ga0126382_10006169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 5447 | Open in IMG/M |
| 3300010047|Ga0126382_10109470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1806 | Open in IMG/M |
| 3300010047|Ga0126382_10254437 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1289 | Open in IMG/M |
| 3300010048|Ga0126373_10020102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5627 | Open in IMG/M |
| 3300010154|Ga0127503_10673103 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 558 | Open in IMG/M |
| 3300010358|Ga0126370_11303731 | Not Available | 681 | Open in IMG/M |
| 3300010359|Ga0126376_10341306 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1323 | Open in IMG/M |
| 3300010359|Ga0126376_10750461 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 946 | Open in IMG/M |
| 3300010359|Ga0126376_11181118 | Not Available | 779 | Open in IMG/M |
| 3300010359|Ga0126376_11898903 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 635 | Open in IMG/M |
| 3300010359|Ga0126376_12464160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 568 | Open in IMG/M |
| 3300010362|Ga0126377_10002153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 13431 | Open in IMG/M |
| 3300010362|Ga0126377_10041232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3974 | Open in IMG/M |
| 3300010362|Ga0126377_10487848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1262 | Open in IMG/M |
| 3300010366|Ga0126379_12062684 | Not Available | 672 | Open in IMG/M |
| 3300010366|Ga0126379_12121679 | Not Available | 664 | Open in IMG/M |
| 3300010371|Ga0134125_10194655 | All Organisms → cellular organisms → Bacteria | 2257 | Open in IMG/M |
| 3300010371|Ga0134125_11577522 | Not Available | 715 | Open in IMG/M |
| 3300010373|Ga0134128_12176071 | Not Available | 611 | Open in IMG/M |
| 3300010396|Ga0134126_10156021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 2762 | Open in IMG/M |
| 3300010398|Ga0126383_10046425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3587 | Open in IMG/M |
| 3300010398|Ga0126383_10990377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → unclassified Cupriavidus → Cupriavidus sp. UYMMa02A | 929 | Open in IMG/M |
| 3300010400|Ga0134122_10057159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium | 3007 | Open in IMG/M |
| 3300010401|Ga0134121_10457005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1167 | Open in IMG/M |
| 3300012499|Ga0157350_1001300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium | 1357 | Open in IMG/M |
| 3300012500|Ga0157314_1030160 | Not Available | 605 | Open in IMG/M |
| 3300012505|Ga0157339_1006471 | Not Available | 956 | Open in IMG/M |
| 3300012507|Ga0157342_1048239 | Not Available | 591 | Open in IMG/M |
| 3300012900|Ga0157292_10006536 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2425 | Open in IMG/M |
| 3300012910|Ga0157308_10010334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1895 | Open in IMG/M |
| 3300012911|Ga0157301_10003614 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2710 | Open in IMG/M |
| 3300012931|Ga0153915_10299325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 1796 | Open in IMG/M |
| 3300012943|Ga0164241_10919339 | Not Available | 640 | Open in IMG/M |
| 3300012948|Ga0126375_10005214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes | 4944 | Open in IMG/M |
| 3300012948|Ga0126375_11859561 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 527 | Open in IMG/M |
| 3300012951|Ga0164300_10447892 | Not Available | 723 | Open in IMG/M |
| 3300012957|Ga0164303_10008480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3454 | Open in IMG/M |
| 3300012957|Ga0164303_10086775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1510 | Open in IMG/M |
| 3300012960|Ga0164301_10621852 | Not Available | 800 | Open in IMG/M |
| 3300012971|Ga0126369_10637800 | Not Available | 1138 | Open in IMG/M |
| 3300012971|Ga0126369_10669078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → unclassified Cupriavidus → Cupriavidus sp. UYMMa02A | 1113 | Open in IMG/M |
| 3300012971|Ga0126369_10717224 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1078 | Open in IMG/M |
| 3300012971|Ga0126369_11026819 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 913 | Open in IMG/M |
| 3300012984|Ga0164309_10219654 | Not Available | 1320 | Open in IMG/M |
| 3300013296|Ga0157374_12612026 | Not Available | 533 | Open in IMG/M |
| 3300013306|Ga0163162_11723524 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 716 | Open in IMG/M |
| 3300014308|Ga0075354_1114777 | Not Available | 579 | Open in IMG/M |
| 3300014325|Ga0163163_11774318 | Not Available | 677 | Open in IMG/M |
| 3300014326|Ga0157380_11226372 | Not Available | 795 | Open in IMG/M |
| 3300014745|Ga0157377_10003830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 6839 | Open in IMG/M |
| 3300015371|Ga0132258_10010510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 19219 | Open in IMG/M |
| 3300015371|Ga0132258_10064018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 8491 | Open in IMG/M |
| 3300015371|Ga0132258_10109256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6541 | Open in IMG/M |
| 3300015371|Ga0132258_10116525 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6338 | Open in IMG/M |
| 3300015371|Ga0132258_13447365 | Not Available | 1085 | Open in IMG/M |
| 3300015373|Ga0132257_104121438 | Not Available | 529 | Open in IMG/M |
| 3300016319|Ga0182033_10651712 | Not Available | 919 | Open in IMG/M |
| 3300016445|Ga0182038_10770490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Rhodoblastus | 842 | Open in IMG/M |
| 3300017927|Ga0187824_10014207 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2311 | Open in IMG/M |
| 3300017933|Ga0187801_10511884 | Not Available | 506 | Open in IMG/M |
| 3300017939|Ga0187775_10008768 | All Organisms → cellular organisms → Bacteria | 2525 | Open in IMG/M |
| 3300017939|Ga0187775_10084635 | Not Available | 1038 | Open in IMG/M |
| 3300017944|Ga0187786_10012949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 2075 | Open in IMG/M |
| 3300017944|Ga0187786_10017228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 1865 | Open in IMG/M |
| 3300017947|Ga0187785_10000593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 13173 | Open in IMG/M |
| 3300017947|Ga0187785_10003336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5265 | Open in IMG/M |
| 3300017947|Ga0187785_10009463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3283 | Open in IMG/M |
| 3300017947|Ga0187785_10226996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 826 | Open in IMG/M |
| 3300017959|Ga0187779_10019087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3904 | Open in IMG/M |
| 3300017959|Ga0187779_10092836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 1810 | Open in IMG/M |
| 3300017959|Ga0187779_10143936 | All Organisms → cellular organisms → Bacteria | 1466 | Open in IMG/M |
| 3300017959|Ga0187779_11293927 | Not Available | 516 | Open in IMG/M |
| 3300017961|Ga0187778_10056768 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2395 | Open in IMG/M |
| 3300017974|Ga0187777_10032799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3333 | Open in IMG/M |
| 3300017974|Ga0187777_10199990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 1347 | Open in IMG/M |
| 3300018006|Ga0187804_10475236 | Not Available | 560 | Open in IMG/M |
| 3300018028|Ga0184608_10388359 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 608 | Open in IMG/M |
| 3300018032|Ga0187788_10024124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1954 | Open in IMG/M |
| 3300018064|Ga0187773_10051281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1900 | Open in IMG/M |
| 3300018067|Ga0184611_1068053 | Not Available | 1208 | Open in IMG/M |
| 3300018072|Ga0184635_10190523 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 818 | Open in IMG/M |
| 3300018089|Ga0187774_10707986 | Not Available | 667 | Open in IMG/M |
| 3300019356|Ga0173481_10000971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6642 | Open in IMG/M |
| 3300019356|Ga0173481_10017607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 2129 | Open in IMG/M |
| 3300019361|Ga0173482_10003606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3472 | Open in IMG/M |
| 3300019876|Ga0193703_1064044 | Not Available | 551 | Open in IMG/M |
| 3300020018|Ga0193721_1165055 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 523 | Open in IMG/M |
| 3300021078|Ga0210381_10205665 | Not Available | 688 | Open in IMG/M |
| 3300021560|Ga0126371_10003135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 14403 | Open in IMG/M |
| 3300022737|Ga0247747_1004777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium | 1301 | Open in IMG/M |
| 3300022756|Ga0222622_10631596 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 775 | Open in IMG/M |
| 3300022880|Ga0247792_1139143 | Not Available | 520 | Open in IMG/M |
| 3300022883|Ga0247786_1052117 | Not Available | 830 | Open in IMG/M |
| 3300022893|Ga0247787_1002980 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1818 | Open in IMG/M |
| 3300025582|Ga0209386_1069852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 623 | Open in IMG/M |
| 3300025898|Ga0207692_10071104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1834 | Open in IMG/M |
| 3300025899|Ga0207642_10239513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1024 | Open in IMG/M |
| 3300025900|Ga0207710_10050941 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1859 | Open in IMG/M |
| 3300025901|Ga0207688_10923766 | Not Available | 552 | Open in IMG/M |
| 3300025905|Ga0207685_10593553 | Not Available | 594 | Open in IMG/M |
| 3300025905|Ga0207685_10757131 | Not Available | 532 | Open in IMG/M |
| 3300025906|Ga0207699_11141838 | Not Available | 577 | Open in IMG/M |
| 3300025911|Ga0207654_10045870 | Not Available | 2490 | Open in IMG/M |
| 3300025916|Ga0207663_10151781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 1626 | Open in IMG/M |
| 3300025921|Ga0207652_11043350 | Not Available | 717 | Open in IMG/M |
| 3300025933|Ga0207706_10083978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2799 | Open in IMG/M |
| 3300025936|Ga0207670_10940499 | Not Available | 725 | Open in IMG/M |
| 3300025937|Ga0207669_10235369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1354 | Open in IMG/M |
| 3300025938|Ga0207704_11376708 | Not Available | 604 | Open in IMG/M |
| 3300025942|Ga0207689_10310739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1307 | Open in IMG/M |
| 3300025961|Ga0207712_10289497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1340 | Open in IMG/M |
| 3300025979|Ga0210078_1038570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 648 | Open in IMG/M |
| 3300026023|Ga0207677_10477793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1073 | Open in IMG/M |
| 3300026067|Ga0207678_12003491 | Not Available | 504 | Open in IMG/M |
| 3300026095|Ga0207676_10017348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 5217 | Open in IMG/M |
| 3300026116|Ga0207674_12265498 | Not Available | 506 | Open in IMG/M |
| 3300026319|Ga0209647_1007235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys | 7830 | Open in IMG/M |
| 3300026861|Ga0207503_1004234 | Not Available | 781 | Open in IMG/M |
| 3300026940|Ga0207521_101325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium | 849 | Open in IMG/M |
| 3300027390|Ga0207435_101573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 1110 | Open in IMG/M |
| 3300027401|Ga0208637_1006495 | Not Available | 1108 | Open in IMG/M |
| 3300027455|Ga0207504_101986 | Not Available | 686 | Open in IMG/M |
| 3300027560|Ga0207981_1056996 | Not Available | 715 | Open in IMG/M |
| 3300027560|Ga0207981_1090700 | Not Available | 562 | Open in IMG/M |
| 3300027614|Ga0209970_1008972 | All Organisms → cellular organisms → Bacteria | 1638 | Open in IMG/M |
| 3300027617|Ga0210002_1015577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium | 1198 | Open in IMG/M |
| 3300027682|Ga0209971_1062484 | Not Available | 902 | Open in IMG/M |
| 3300027765|Ga0209073_10337221 | Not Available | 605 | Open in IMG/M |
| 3300027876|Ga0209974_10048437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 1425 | Open in IMG/M |
| 3300027894|Ga0209068_10020807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3195 | Open in IMG/M |
| 3300027907|Ga0207428_11305327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 503 | Open in IMG/M |
| 3300027909|Ga0209382_11549260 | Not Available | 658 | Open in IMG/M |
| 3300027910|Ga0209583_10051054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 1456 | Open in IMG/M |
| 3300027915|Ga0209069_10013764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3866 | Open in IMG/M |
| 3300027915|Ga0209069_10995695 | Not Available | 514 | Open in IMG/M |
| 3300027993|Ga0247749_1000539 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3226 | Open in IMG/M |
| 3300028380|Ga0268265_10507963 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1137 | Open in IMG/M |
| 3300028784|Ga0307282_10470938 | Not Available | 610 | Open in IMG/M |
| 3300028814|Ga0307302_10027562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2600 | Open in IMG/M |
| 3300028819|Ga0307296_10035511 | All Organisms → cellular organisms → Bacteria | 2632 | Open in IMG/M |
| 3300031184|Ga0307499_10134106 | Not Available | 712 | Open in IMG/M |
| 3300031226|Ga0307497_10055735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 1404 | Open in IMG/M |
| 3300031231|Ga0170824_104604805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4545 | Open in IMG/M |
| 3300031231|Ga0170824_127088084 | Not Available | 694 | Open in IMG/M |
| 3300031241|Ga0265325_10000053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 77918 | Open in IMG/M |
| (restricted) 3300031248|Ga0255312_1000702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7058 | Open in IMG/M |
| 3300031250|Ga0265331_10478807 | Not Available | 560 | Open in IMG/M |
| 3300031547|Ga0310887_10094518 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1466 | Open in IMG/M |
| 3300031564|Ga0318573_10752258 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 524 | Open in IMG/M |
| 3300031680|Ga0318574_10364663 | Not Available | 843 | Open in IMG/M |
| 3300031716|Ga0310813_10061865 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2795 | Open in IMG/M |
| 3300031716|Ga0310813_10282003 | Not Available | 1395 | Open in IMG/M |
| 3300031740|Ga0307468_100103588 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1700 | Open in IMG/M |
| 3300031858|Ga0310892_10425039 | Not Available | 870 | Open in IMG/M |
| 3300031912|Ga0306921_12452798 | Not Available | 542 | Open in IMG/M |
| 3300031944|Ga0310884_10011125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3370 | Open in IMG/M |
| 3300032003|Ga0310897_10115570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1086 | Open in IMG/M |
| 3300032044|Ga0318558_10425163 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 662 | Open in IMG/M |
| 3300032076|Ga0306924_11937038 | Not Available | 610 | Open in IMG/M |
| 3300032090|Ga0318518_10476732 | Not Available | 639 | Open in IMG/M |
| 3300032205|Ga0307472_100047949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2638 | Open in IMG/M |
| 3300032205|Ga0307472_100499345 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1048 | Open in IMG/M |
| 3300032205|Ga0307472_101400633 | Not Available | 678 | Open in IMG/M |
| 3300032421|Ga0310812_10136507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 1034 | Open in IMG/M |
| 3300032828|Ga0335080_10819405 | Not Available | 961 | Open in IMG/M |
| 3300033433|Ga0326726_10008737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 8986 | Open in IMG/M |
| 3300033433|Ga0326726_10098768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2610 | Open in IMG/M |
| 3300033433|Ga0326726_10168111 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2009 | Open in IMG/M |
| 3300033433|Ga0326726_10679874 | Not Available | 992 | Open in IMG/M |
| 3300033513|Ga0316628_101289369 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300034090|Ga0326723_0060819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1606 | Open in IMG/M |
| 3300034090|Ga0326723_0379019 | Not Available | 641 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.41% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.73% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.73% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 6.06% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.38% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.03% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.36% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.36% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.02% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 2.02% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.02% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.02% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.68% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.68% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.35% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.35% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.35% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.35% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.01% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.01% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.01% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.01% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.01% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.01% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.01% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.01% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.67% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.67% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.67% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.67% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.67% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.34% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.34% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.34% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.34% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.34% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.34% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.34% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.34% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.34% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.34% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.34% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.34% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.34% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.34% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.34% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.34% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.34% |
| Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.34% |
| Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.34% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2032320006 | Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2+ | Environmental | Open in IMG/M |
| 2162886013 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
| 2170459012 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO1O1 lysis Rhizosphere grass | Environmental | Open in IMG/M |
| 2189573000 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms) | Environmental | Open in IMG/M |
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
| 3300000443 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly | Environmental | Open in IMG/M |
| 3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Host-Associated | Open in IMG/M |
| 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Host-Associated | Open in IMG/M |
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300003994 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300003995 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005162 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB | Environmental | Open in IMG/M |
| 3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
| 3300005183 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300005218 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012499 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.2.yng.030610 | Environmental | Open in IMG/M |
| 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Host-Associated | Open in IMG/M |
| 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Host-Associated | Open in IMG/M |
| 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012900 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1 | Environmental | Open in IMG/M |
| 3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014308 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019876 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3a2 | Environmental | Open in IMG/M |
| 3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022737 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S094-311B-5 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300022880 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S106-311C-6 | Environmental | Open in IMG/M |
| 3300022883 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4 | Environmental | Open in IMG/M |
| 3300022893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S126-311R-4 | Environmental | Open in IMG/M |
| 3300025582 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-two (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025979 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026861 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A5a-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300026940 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A1-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027390 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A1-11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027401 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC (SPAdes) | Environmental | Open in IMG/M |
| 3300027455 | Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G06K3-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027560 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC (SPAdes) | Environmental | Open in IMG/M |
| 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027993 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S199-509C-5 | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
| 3300031248 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5 | Environmental | Open in IMG/M |
| 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Host-Associated | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FACEORE_630190 | 2032320006 | Soil | VEAKMQKVSSVFAYVVNDGRVCALKPSEWSILLTGVALCGVVTMVVLLARI |
| SwBSRL2_0091.00004270 | 2162886013 | Switchgrass Rhizosphere | MQRVTAMMAYVVSEGRVCALKPAEWSLLLTGVALCGIATLLF |
| SwBSRL2_0427.00006390 | 2162886013 | Switchgrass Rhizosphere | MQKMSSVLAYVVSEGRVCALKPSEWSILLAGVVICGFATMIFLASGV |
| SwBSRL2_0210.00005360 | 2162886013 | Switchgrass Rhizosphere | MQRVTAMMAYVVSEGRVCALKPAEWSLLLTGVALCGIATL |
| cont_0239.00002390 | 2166559005 | Simulated | MQKVSSVLAYVVNDGRVCALKPSEWSILLAGVVLCGFVTLVVLLARV |
| N56_08092100 | 2170459012 | Grass Soil | MERVSALMAYVVNEGRLCALKPSEWSLLLAGVALCGFATLVFLISGL |
| N55_00840100 | 2189573000 | Grass Soil | MQKVSSVLAYVVIDGRVCALKPSEWSILLAGVVLCGFVTLVVLLARV |
| ICCgaii200_07991892 | 2228664021 | Soil | MQIMSSVLAYVVSEGRVCALKPSDWSILLAGVVICGFATMIFLASGV |
| INPgaii200_08497492 | 2228664022 | Soil | MQIMSSVLAYVVSEGRVCALKPSEWSILLAGVVICGFATMIFLASGV |
| NODE_07305508 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | MQRVTAMMAYVVSEGRLCALNPAEWSLLLIGVALCGIATLLFLMIHA* |
| F12B_100366161 | 3300000443 | Soil | MQKMSSMLAYVVSDGRVCALKPSEWSILLAGVVICGFATMLFLASQ |
| JGI11643J11755_116086661 | 3300000787 | Soil | MQRVTAMMAYVVSEGRLCALKPAEWSLLLTGVAVCGIATLLFLVLHA* |
| JGI24743J22301_101093752 | 3300001991 | Corn, Switchgrass And Miscanthus Rhizosphere | IRVTARXRHRRRYNFNKISFAVEAKMQRVTAMMAYVVSEGRLCALKPAEWSFLLVGVTLCGIATLLFLMLHA* |
| JGI24748J21848_10065332 | 3300002074 | Corn, Switchgrass And Miscanthus Rhizosphere | ARKRHRRRYNFNKISFAVEAKMQRVTAMMAYVVSEGRLCALKPAEWSFLLVGVTLCGIATLLFLMLHA* |
| soilL2_102782591 | 3300003319 | Sugarcane Root And Bulk Soil | MQRVTAMMTYVMSEGRLCALKPSEWSLLLAGIGLCGFATVLFLVIHT* |
| JGI25404J52841_101340012 | 3300003659 | Tabebuia Heterophylla Rhizosphere | MQKMSSVLAYVVSEGRICALKPSEWSILLAGVVICGFATMIFLASQV* |
| Ga0055435_101898941 | 3300003994 | Natural And Restored Wetlands | MQKVSAMLAYVVSEGRLCAMKPSEWSILLAGVALCGFVTLVFLITRL* |
| Ga0055438_100219331 | 3300003995 | Natural And Restored Wetlands | MQKVSAMLAYVVSEGRLCAMKPSEWSILLAGVALCGFVTLVFLIT |
| Ga0062593_1016624681 | 3300004114 | Soil | FAVEAKMQRVTAMMAYVVSEGRLCALKPAEWSLLLAGVTLCGIATLLFLMLHA* |
| Ga0062589_1012636302 | 3300004156 | Soil | ISFAVEAKMQRVTAMMAYVVSEGRLCALKPAEWSLLLTGVAVCGIATLLFLVLHA* |
| Ga0063356_1063147421 | 3300004463 | Arabidopsis Thaliana Rhizosphere | FNKISFAVEAKMQRVTAMMAYVVSEGRLCALKPAEWSLLLSGVVLCGIATLLFLMLHA* |
| Ga0062595_1003533702 | 3300004479 | Soil | QKVSSVFAYVVNDGRVCALKPSEWSILLTGVALCGVVTMVVLLVRV* |
| Ga0062595_1012772992 | 3300004479 | Soil | MSSMLAYVVSDGRVCALKPSEWSILLAGVVICGFATMLFLASQV* |
| Ga0062595_1015640772 | 3300004479 | Soil | MQRVSAMVSFVMSEGRLCALKPSEWSLLLFGVAICGLATVLFLFARL* |
| Ga0066395_105369191 | 3300004633 | Tropical Forest Soil | MQKVSSVFAYVVNDGRVCALKPSEWSILLAGVALCGVVTMVVLLARV* |
| Ga0058859_116599872 | 3300004798 | Host-Associated | MQRVTAMMAYVVSEGRVCALKPAEWSLLLTGVALCGIATLLFLMLHA* |
| Ga0062594_1012138181 | 3300005093 | Soil | MSFAVEAKMQRVTAMMAYVVSEGRLCALKPAEWSLLLAGVTLCGIATLLFLMLHA* |
| Ga0066814_100408592 | 3300005162 | Soil | MQRVTAMMAYVVSEGRLCALKPAEWSLLLTGVALCGIATLLFLMLHA* |
| Ga0066814_100582261 | 3300005162 | Soil | MQKVSAVLAYVMNEGRLCALKPSEWSILLVGVALCGFGTLVFLTARL* |
| Ga0066815_100041931 | 3300005164 | Soil | MQRVTAMMAYVVSEGRLCALKPAEWSLLLTGVALCGIATLLFLM |
| Ga0068993_102575401 | 3300005183 | Natural And Restored Wetlands | MERVSAFMAFVASEGRLCGLKPTEWAMLLLGVSVCGFATLVF* |
| Ga0068996_100639761 | 3300005218 | Natural And Restored Wetlands | MQKVSAMLAYVVSEGRLCAMKPSEWSILLAGVALCGFVTLVFL |
| Ga0065714_102351841 | 3300005288 | Miscanthus Rhizosphere | MQRVTAMMAYVVSEGRLCALKPAEWSLLLTGVALCGVATLLFLMLHA* |
| Ga0065715_101181855 | 3300005293 | Miscanthus Rhizosphere | FNKISFAVEAKMQRVTAMMAYVVSEGRLCALKPAEWSFLLVGVTLCGIATLLFLMLHA* |
| Ga0065705_108308542 | 3300005294 | Switchgrass Rhizosphere | MQKASSVFAYVVNDGRVCALKPSEWSILLTGVALCGVVTMVVLLVRV* |
| Ga0070690_1001452571 | 3300005330 | Switchgrass Rhizosphere | ISFAVEGKMQRVTAMMAYVVSEGRLCALKPAEWSLLLTGVALCGVATLLFLMLHA* |
| Ga0066388_1000572292 | 3300005332 | Tropical Forest Soil | MQKVSSVVAYLVHEGRVCALKPSEWSILLAGIAICGFGTLVFLTARL* |
| Ga0066388_1000573524 | 3300005332 | Tropical Forest Soil | MQRVSSVLAYVVNEGRVCALKPSEWSILLGGVALCGFGTLIFLAIPV* |
| Ga0066388_1001821295 | 3300005332 | Tropical Forest Soil | MQRVTAMMAYVVSDGRLCALKPAEWSLLLFGVALCGIATLVFLVIHA* |
| Ga0066388_1007654221 | 3300005332 | Tropical Forest Soil | MQKVSSVFAYVVSDGRMCALKPSEWSILLIGVALCGIVTMVVLFVRV* |
| Ga0066388_1011768772 | 3300005332 | Tropical Forest Soil | VEAKMQKVSSVLAYVVNDGRVCALKPSEWSILLTGVTLCGVVTMVVLLARV* |
| Ga0066388_1012547022 | 3300005332 | Tropical Forest Soil | MQKVSSVFAYVVNDGRVCALKPSEWSILLSGVALCGVVTMVVLLARI* |
| Ga0066388_1046303142 | 3300005332 | Tropical Forest Soil | MQKVSSVLSFVVNEGRVCALKPSEWSILLAGVALCGFATLIFPG* |
| Ga0066388_1070034001 | 3300005332 | Tropical Forest Soil | MQRVSAMLTYVVNEGRLCALKPSEWSILLVGVALCGFGTLVFLTARL* |
| Ga0068869_1000006291 | 3300005334 | Miscanthus Rhizosphere | MQRVTAMMAYVVSEGRLCALKPAEWSFLLVGVTLCGIATLLFLMLHA* |
| Ga0070680_1016947561 | 3300005336 | Corn Rhizosphere | RVSAMLTYVVNEGRLCALKPSEWSILLAGVAICGVGTLVFLTARL* |
| Ga0070682_1018124431 | 3300005337 | Corn Rhizosphere | RRYNFNKISFAVEAKMQRVTAMMAYVVSEGRLCALKPAEWSLLLTGVALCGVATLLFLMLHA* |
| Ga0070691_101776013 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | VEAKMQRVTAMMAYVVSEGRVCALKPAEWSLLLTGVALCGIATLLFLMLHA* |
| Ga0070661_1001086031 | 3300005344 | Corn Rhizosphere | RHRRRYNFNKISFAVEAKMQRVTAMMAYVVSEGRLCALKPAEWSFLLVGVTLCGIATLLFLMLHA* |
| Ga0070669_10000064827 | 3300005353 | Switchgrass Rhizosphere | YNFNKISFAVEAKMQRVTAMMAYVVSEGRLCALKPAEWSFLLVGVTLCGIATLLFLMLHA |
| Ga0070669_1014921601 | 3300005353 | Switchgrass Rhizosphere | NKISFAVEAKMQRVTAMMAYVVSEGRLCALKPAEWSLLLTGVALCGIATLLFLMLHA* |
| Ga0070709_100003663 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MQKVSSVFAYVVNDGRVCALKPSEWSILLTGVALCGVVTMVVLLARI* |
| Ga0070709_109853851 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | KMQRVSAMLTYVVNEGRLCALKPSEWSILLAGVAICGVGTLVFLTARL* |
| Ga0070713_1002367002 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MERVSALMAYVVNEGRVCALKPSEWSLLLAGVALCGFATLVFLISGL* |
| Ga0070701_101557281 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | RYNFNKISFAVEAKMQRVTAMMAYVVSEGRLCALKPAEWSLLLTGVALCGIATLLFLMLHA* |
| Ga0070711_1000205563 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MQKVSAMLAYVVNEGRLCALKPSDWSILLIGVTLCGCATLFFLAARV* |
| Ga0070711_1000736744 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTYVVNEGRLCALKPSEWSILLAGVAICGVGTLVFLTARL* |
| Ga0070708_1005935992 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MQKVSSALGYVLNEGRLCALKPSEWSILLAGVALCGFGTLLFLVSPL* |
| Ga0070662_1008035142 | 3300005457 | Corn Rhizosphere | MQKVSSVFGYVVNDGRVCALKPSEWSILLTGVALCGVVTMVVLLARI* |
| Ga0070699_1001136931 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | ISFAVEAKMQRVTAMMAYVVSEGRVCALKPAEWSLLLTGVALCGIATLLFLMLHA* |
| Ga0073909_103037511 | 3300005526 | Surface Soil | MQRVTAMMAYVVNEGRLCALKPAEWSLLLAGVALCGIATLLFLMLLA* |
| Ga0070741_100198508 | 3300005529 | Surface Soil | MQRVTAMMALVVSEGRLCALKPSEWSLLLAGVGLCGFATVLFLVLHT* |
| Ga0070733_100114027 | 3300005541 | Surface Soil | SVVEERVPAMVAYVMSEGRLFWLKPSEWLLLLVSAATICGFLTLLL* |
| Ga0070695_1000456181 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | RARHRRRYNFNKISFAVEAKMQRVTAMMAYVVSEGRLCALKPAEWSFLLVGVTLCGIATLLFLMLHA* |
| Ga0070696_1009470141 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MQRVTAMMAYVVSEGRLCALKPAEWSLLLAGVTLCGIATLLFLMLHA* |
| Ga0070696_1013828042 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MQRVTAMMAYVVSEGRLCALKPAEWSLLLTGVVLCGIATLLFLMLHA* |
| Ga0070704_1010792341 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | YNFNKISFAVEAKMQRVTAMMAYVVSEGRLCALKPAEWSLLLTGVALCGIATLLFLMLHA |
| Ga0070664_1011317641 | 3300005564 | Corn Rhizosphere | RRYNFNKISFAVEARMQRVTAMMAYVVSEGRLCALKPAEWSLLLTGVALCGIATLLFLMLHA* |
| Ga0070664_1014610531 | 3300005564 | Corn Rhizosphere | SSVFAYVVNDGRVCALKPSEWSILLTGVALCGVVTMVVLLARI* |
| Ga0068854_1005996162 | 3300005578 | Corn Rhizosphere | MQKVSSVFAYVVNDGRVCALKPSEWSILLTGVALCGVV |
| Ga0068856_1005828062 | 3300005614 | Corn Rhizosphere | SFAVEAKMQRVTAMMAYVVSEGRLCALKPAEWSLLLTGVALCGVATLLFLMLHA* |
| Ga0070702_1016931301 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MQKVSSVFAYVVNDGRVCALKPSEWSILLTGVALCGVVTMVV |
| Ga0068864_1005973092 | 3300005618 | Switchgrass Rhizosphere | YNFNKISFAVEAKMQRVTAMMAYVVSEGRLCALKPAEWSLLLTGVALCGVATLLFLMLHA |
| Ga0066905_1000153553 | 3300005713 | Tropical Forest Soil | MQKMSSVLAYVVSEGRVCALKPSEWSILLAGVVICGFATMVFLASRV* |
| Ga0066905_1000435423 | 3300005713 | Tropical Forest Soil | MQKVSSVFAYVVNDGRVCALKPSEWSILLTGVALCGVVTMVVLLARV* |
| Ga0066905_1001929583 | 3300005713 | Tropical Forest Soil | MQRVTAMMAYVVSDGRLCALKPAEWSLLLFGVALCGVATLLFLALHA* |
| Ga0066905_1004670932 | 3300005713 | Tropical Forest Soil | VEEKMQIMSSMLAYVVSEGRVCALKPSEWSILLAGVVICGFATMLFLGSRI* |
| Ga0066905_1004743033 | 3300005713 | Tropical Forest Soil | MLAYVLNEGRLCALKPSEWSILLAGVVLCGFAMLIFLVSRV* |
| Ga0066905_1018595221 | 3300005713 | Tropical Forest Soil | MQRVTAMMTFVVSEGRLCALKPAEWSLLLFGVALCGIATLLFLALHA* |
| Ga0068866_111617431 | 3300005718 | Miscanthus Rhizosphere | VEAKMQRVSAMLTYVVNEGRLCALKPSEWSILLAGVAICGVGTLVFLTARL* |
| Ga0068861_1012979371 | 3300005719 | Switchgrass Rhizosphere | SFAVEAKMQRVTAMMAYVVSEGRLCALKPAEWSLLLTGVALCGIATLLFLMLHA* |
| Ga0066903_1000841835 | 3300005764 | Tropical Forest Soil | MQKVSSVLAYVVNDGRVCALKPSEWSILLTGVTLCGVVTMVVLLARV* |
| Ga0066903_1001047274 | 3300005764 | Tropical Forest Soil | MQKVSSVLAYVVNEGRVCALKPSEWSLLLVGVALCGFATMVFVTARL* |
| Ga0066903_1004190403 | 3300005764 | Tropical Forest Soil | MQRVTAMMAYVVSEGRVCALKPAEWSLLLFGVALCGIATLLFVVLHA* |
| Ga0066903_1030778041 | 3300005764 | Tropical Forest Soil | MEKVSSVLAYVVNEGRLCALKPSEWSILLVGVALCGFGTLVVLTARL* |
| Ga0066903_1034482352 | 3300005764 | Tropical Forest Soil | SLNRGFRDPCHSTDLLHRRRYNFNKISFAVEAKMQRVTAMMAYVVSDGRLCALKPAEWSLLLFGVALCGIATLVFLVIHA* |
| Ga0068870_113245801 | 3300005840 | Miscanthus Rhizosphere | RALGVEAKMQRVSAMLTYVVNEGRLCALKPSEWSILLAGVAICGVGTLVFLTARL* |
| Ga0068863_1006427391 | 3300005841 | Switchgrass Rhizosphere | NKISFAVEAKMQRVTAMMAYVVSEGRLCALKPAEWSLLLTGVALCGVATLLFLMLHA* |
| Ga0068860_1010932511 | 3300005843 | Switchgrass Rhizosphere | RYNFNKISFAVEAKMQRVTAMMAYVVSEGRLCALKPAEWSLLLTGVALCGVATLLFLMLHA* |
| Ga0068860_1017673541 | 3300005843 | Switchgrass Rhizosphere | MQRVSAMLTYVVNEGRLCALKPSEWSILLAGVAICGVGTLVFLTARL* |
| Ga0081455_1000674910 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MQKMSSVLAFVVSEGRLCALKPSDWSILLAGVVICGFATMVFLASGV* |
| Ga0081455_100731044 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MQKMSSVLAYVVSEGRVCALKPSEWSILLAGVVICGFATMAFLASRV* |
| Ga0081455_103259912 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MSSMLAYVVSEGRVCALKPSEWSILLAGVVICGFATMLFLGSRI* |
| Ga0075023_1000179644 | 3300006041 | Watersheds | MERVSALMAYVVSEGRLCALKPSEWSLLLAGVALCGFATLVFLISGL* |
| Ga0075023_1001190032 | 3300006041 | Watersheds | MVVSHEAVQQRVSAMMAYVVSEGRLFALKPSEWTMLLVGVALCGFITLLF* |
| Ga0075023_1001725962 | 3300006041 | Watersheds | MQKVSSVFAYVVNEGRVCALKPSEWSILLAGVALCGVVTMGVLLARV* |
| Ga0075024_1001487771 | 3300006047 | Watersheds | GFAVEAKMERVSALMAYVVSEGRLCALKPSEWSLLLAGVALCGFATLVFLISGL* |
| Ga0075024_1002109823 | 3300006047 | Watersheds | MQKVSTVLAYLMNEGRLCALKPSEWSILLVGVALCGFGTLVFLTARL* |
| Ga0075028_1002236252 | 3300006050 | Watersheds | VFDGGNLALEAEMQSVSAMMAYVVSEGRLCALKPSDWAMLLVGVALCGFIALLF* |
| Ga0075026_1004359551 | 3300006057 | Watersheds | MQKVSSVFAYVVNEGRVCALKPSEWSILLAGVALC |
| Ga0075026_1007864592 | 3300006057 | Watersheds | MQKVSAMLAYVVSEGRVCAMKPSEWSILLAGVALCGFVTLVFLITRL* |
| Ga0070715_101557573 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | VEAKMQRVSAMLTYVVNEGRLCALKPSEWSILLAGVAICGFGTLVFLTARL* |
| Ga0075018_104568273 | 3300006172 | Watersheds | AVEAKMERVSALMAYVVSEGRLCALKPSEWSLLLAGVALCGFATLVFLISGL* |
| Ga0074054_117269373 | 3300006579 | Soil | YVVSEGRLCALKPAEWSLLLTGVALCGIATLLFLMLHA* |
| Ga0074049_116439812 | 3300006580 | Soil | VEAKMQKVSSVFAYVVNEGRVCALKPSEWSILLAGVALCGVVTMGVLLARV* |
| Ga0079221_102812622 | 3300006804 | Agricultural Soil | MQQRVSAIMAYVVSEGRLCALKPSEWSLLLAGVTLCGLVTMLYVVTGF* |
| Ga0079221_105886801 | 3300006804 | Agricultural Soil | RVTAMMAYVVNEGRLCALKPAEWSLLLSGVALCGIATLFFLMLHA* |
| Ga0075421_1017221582 | 3300006845 | Populus Rhizosphere | MLAYVVSDGRVCALKPSEWSILLAGVVICGFATMLFLASQV* |
| Ga0075431_1012565262 | 3300006847 | Populus Rhizosphere | MLAYVVSDGRICALKPSEWSILLAGVVICGFATMLFLASQV* |
| Ga0075433_100528957 | 3300006852 | Populus Rhizosphere | MQKMSSMLAYVVSDGRVCALKPSEWSILLAGVVICGFATMLFLA |
| Ga0075433_106318212 | 3300006852 | Populus Rhizosphere | MQRVNAMMAYVVSEGRLCALKPAEWSLLLFGVALCGIATLLFLALHA* |
| Ga0075425_1000268583 | 3300006854 | Populus Rhizosphere | MQKMSSMLAYVVSDGRVCALKPSEWSILLAGVVICGFATMLFLASQV* |
| Ga0075425_1004746253 | 3300006854 | Populus Rhizosphere | FAYVVNDGRVCALKPSEWSILLTGVALCGVATMAVLLARI* |
| Ga0075434_1019393761 | 3300006871 | Populus Rhizosphere | SFAVEAKMQRVTAMMAYVVSEGRLCALNPAEWSLLLIGVALCGIATLLFLMIHA* |
| Ga0075424_1003291511 | 3300006904 | Populus Rhizosphere | MQRVTAMMAYVVSEGRVCALKPAEWSLLLTGVALCGIATLLFLM |
| Ga0079219_102374102 | 3300006954 | Agricultural Soil | NKVSFAVEAKMQRVTAMMAYVVSEGRLCALNPAEWSLLLIGVALCGIATLLFLMIHA* |
| Ga0105098_107616001 | 3300009081 | Freshwater Sediment | MQKMSSVLAYVVSEGRVCALKPSDWSILLAGVVICGFATMIFLASGV* |
| Ga0111539_1000462919 | 3300009094 | Populus Rhizosphere | MSSVLAYVVSEGRVCALKPSDWSILLAGVVICGFATMIFLASGV* |
| Ga0111539_103394691 | 3300009094 | Populus Rhizosphere | MQKVSSVFAYVVNDGRVCALKPSEWSILLTGVALCGVATMAVLLARI* |
| Ga0105245_101790792 | 3300009098 | Miscanthus Rhizosphere | MQRVSSMLAYVVNEGRVCALKPSEWSILLAGVAICGFGTLVFLTARL* |
| Ga0066709_1011947941 | 3300009137 | Grasslands Soil | MEKVSAMLAYVVNEGRLCALKPSEWSILLVGVALCGFATLLFMTARL* |
| Ga0111538_136915071 | 3300009156 | Populus Rhizosphere | YVVNDGRVCALKPSEWSILLTGVALCGVVTMVVLLARI* |
| Ga0105237_102663404 | 3300009545 | Corn Rhizosphere | MQRVTAMMAYVVSEGRLCALNPAEWSLLLIGVALCGIATLLFLMLHA* |
| Ga0126374_111218881 | 3300009792 | Tropical Forest Soil | MEKVSSVLAYVVNEGRVCALKPSEWSILLVGVALCGFGTLVFLTARL* |
| Ga0126384_1000346612 | 3300010046 | Tropical Forest Soil | MQKISSMLAYVVNEGRLCALKPSDWSILLAGVVLCGFAMLIFLVSRV* |
| Ga0126382_100061691 | 3300010047 | Tropical Forest Soil | MQKISLMLAYVLNEGRLCALKPSEWSILLAGVVLCGFAMLIFLVSRV* |
| Ga0126382_101094703 | 3300010047 | Tropical Forest Soil | MQIMSSMLAYVVSEGRVCALKPSEWSILLAGVVICGFATMLFLGSRI* |
| Ga0126382_102544373 | 3300010047 | Tropical Forest Soil | MQKMSSVLAYVVSEGRICALKPSEWSILLAGVVICGFATMVFLASQV* |
| Ga0126373_100201023 | 3300010048 | Tropical Forest Soil | LDVEAKMEKVSSVLAYVVNEGRVCALKPSEWSILLVGVALCGFGTLVFLTARL* |
| Ga0127503_106731031 | 3300010154 | Soil | YVVSEGRVCALKPSEWSILLAGVALCGAATMVVLLARV* |
| Ga0126370_113037313 | 3300010358 | Tropical Forest Soil | MQRVSTIMAYVVSEGRLCALKPSEWSLLLSGVAICGFLTFLYLVTSF* |
| Ga0126376_103413062 | 3300010359 | Tropical Forest Soil | MLAYVVSEGRVCALKPSEWSILLAGVVICGFATMLFLGSRI* |
| Ga0126376_107504612 | 3300010359 | Tropical Forest Soil | AYVVNDGRVCALKPSEWSILLTGVALCGVVTMVVLLARV* |
| Ga0126376_111811183 | 3300010359 | Tropical Forest Soil | MQRVTAMMAYVVSDGRLCALKPAEWSLLLLGVALCGVATLLFLALHA* |
| Ga0126376_118989032 | 3300010359 | Tropical Forest Soil | MQKVSSVLAYVVNEGRLCALKPSEWSILLVGVALCGFGTLVVLTARL* |
| Ga0126376_124641602 | 3300010359 | Tropical Forest Soil | MERVSALMAYVVNEGRVCALKPSEWSLLLTGVALCGFATLVFLISGL* |
| Ga0126377_1000215316 | 3300010362 | Tropical Forest Soil | MQRVTAMMAYVVSDGRLCALKPAEWSLLLLGITLCGVATLLFLALHA* |
| Ga0126377_100412327 | 3300010362 | Tropical Forest Soil | MQRVTAMMAYVVSEGRLCALKPAEWSLLLFGVTLCGVATLLFLVLHA* |
| Ga0126377_104878483 | 3300010362 | Tropical Forest Soil | AYVVSEGRVCALKPSEWSILLAGVVICGFATMLFLGSRI* |
| Ga0126379_120626841 | 3300010366 | Tropical Forest Soil | MQQRVSTLMAYVVSDGRLCALKLSEWSLLLAGVALCGILTL |
| Ga0126379_121216792 | 3300010366 | Tropical Forest Soil | MQKVSSVFAYVVNDGRVCALKPSEWSILLAGVALCGAVTMVVLLARV* |
| Ga0134125_101946553 | 3300010371 | Terrestrial Soil | VSFAVEAKMQRVTAMMAYVVSEGRLCALNPAEWSLLLIGVALCGIATLLFLMIHA* |
| Ga0134125_115775223 | 3300010371 | Terrestrial Soil | YNFNKISFAVEAKMQRVTAMMAYVVSEGRLCALKPSEWSLLLAGVALCGAATLLFVMLHA |
| Ga0134128_121760712 | 3300010373 | Terrestrial Soil | MQRVTAMMAYVVSEGRLCALKPAEWSLLLIGVALCGIATLLFLMLHA* |
| Ga0134126_101560215 | 3300010396 | Terrestrial Soil | MQRVSAMVSFVMSEGRLCALKPSEWSLLLFGVAICGLATVLFLFARV* |
| Ga0126383_100464251 | 3300010398 | Tropical Forest Soil | MQKVSSVLAYVVNEGRVCALKPSEWSLLLVGVALCGFAT |
| Ga0126383_109903771 | 3300010398 | Tropical Forest Soil | NMRIALPREAEMQRVSTIMAYVVSEGRLCALKPSEWSLLLSGVAICGFLTFLYLVTSF* |
| Ga0134122_100571593 | 3300010400 | Terrestrial Soil | MQRVTAMMAYVVSEGRLCALKPSEWSLLLAGVALCGAATLLFVMLHA* |
| Ga0134121_104570053 | 3300010401 | Terrestrial Soil | FAYVVNDGRVCALKPSEWSILLTGVALCGVVTMVVLLARI* |
| Ga0157350_10013001 | 3300012499 | Unplanted Soil | RRYNFNKISFAVEAKMQRVTAMMAYVVSEGRVCALKPAEWSLLLTGVALCGIATLLFLMLHA* |
| Ga0157314_10301601 | 3300012500 | Arabidopsis Rhizosphere | MAYVVSEGRVCALKPAEWSLLLTGVALCGIATLLFLMLHA* |
| Ga0157339_10064712 | 3300012505 | Arabidopsis Rhizosphere | MQRVTSMMAYVVSEGRVCALKPAEWSLLLTGVALCGIATLLFLMLHA* |
| Ga0157342_10482391 | 3300012507 | Arabidopsis Rhizosphere | NFNKISFAVEAKMQRVTAMMAYVVSEGRVCALKPAEWSLLLTGVALCGIATLLFLMLHA* |
| Ga0157292_100065361 | 3300012900 | Soil | RRYNFNKISFAVEAKMQRVTAMMAYVVSEGRLCALKPAEWSFLLVGVTLCGIATLLFLMLHA* |
| Ga0157308_100103341 | 3300012910 | Soil | NFNKLSFAVEAKMQRVTAMMAYVVSEGRLCALKPAEWSLLLIGVALCGIATLLFLMLHA* |
| Ga0157301_100036141 | 3300012911 | Soil | AVEAKMQRVTAMMAYVVSEGRLCALKPAEWSFLLVGVTLCGIATLLFLMLHA* |
| Ga0153915_102993253 | 3300012931 | Freshwater Wetlands | MERVSALMAYVVNEGRLCALKPSEWSLLLAGVALCGFATLLFLLAHL* |
| Ga0164241_109193391 | 3300012943 | Soil | QRVTAMMAYVVSEGRLCALKPAEWSLLLIGVALCGIATLFFLMLHA* |
| Ga0126375_100052141 | 3300012948 | Tropical Forest Soil | MQKISLMLAYVVNEGRLCALKPSEWSILLAGVVLCGFAMLIFLVSRV* |
| Ga0126375_118595611 | 3300012948 | Tropical Forest Soil | VEAKMQRVSSVLAYVVNEGRVCALKPSDWSILLAGVALCGFATLIFLASHV* |
| Ga0164300_104478923 | 3300012951 | Soil | MQRVTAMMAYVVSEGRLCALKSAEWSLLLTGVAVCGIATLLF |
| Ga0164303_100084803 | 3300012957 | Soil | MQKVSAMLAYVVNEGRLCALKPSEWSILLVGVALCGFATLLFLTARL* |
| Ga0164303_100867753 | 3300012957 | Soil | MQKVSSVFAYVVNDGRVCALKPSEWSILLTGVALCGVVTMVVLLVRV* |
| Ga0164301_106218521 | 3300012960 | Soil | PNRPCPRVQSVKSFAVEAKMERVSALMAYVVNEGRLCALKPSEWSLLLAGVALCGFATLVFLISGL* |
| Ga0126369_106378002 | 3300012971 | Tropical Forest Soil | MQRVSTIMAYVVNEGRLCALKPSEWSLLLSGVAICGLLTFLYLVTF* |
| Ga0126369_106690783 | 3300012971 | Tropical Forest Soil | MQQRVSAIMAYVVSDGRLCALKPSEWSLLLAGVTVCGVATLLYLVTSF* |
| Ga0126369_107172241 | 3300012971 | Tropical Forest Soil | MQKVSSVFAYVVNDGRVCALKPSDWSILLAGVALCGVFTMVVLLARV* |
| Ga0126369_110268192 | 3300012971 | Tropical Forest Soil | AKMQKVSSVLAYVVNEGRVCALKPSEWSLLLVGVALCGFATMVFVTARL* |
| Ga0164309_102196542 | 3300012984 | Soil | MERVSALMAYVVNEGRLCALKPSEWSLLLAGVALCGFATLVFLISGL* |
| Ga0157374_126120262 | 3300013296 | Miscanthus Rhizosphere | AVEAKMQRVTAMMAYVVSEGRLCALKPAEWSLLLTGVALCGIATLLFLMLHA* |
| Ga0163162_117235242 | 3300013306 | Switchgrass Rhizosphere | QKVSSVFAYVVNDGRVCALKPSEWSILLTGVALCGVVTMVVLLARI* |
| Ga0075354_11147772 | 3300014308 | Natural And Restored Wetlands | VEAKMQKVSAMLAYVVSEGRLCAMKPSEWSILLAGVALCGFVTLVFLSTRL* |
| Ga0163163_117743182 | 3300014325 | Switchgrass Rhizosphere | VVNEGRLCALKPSEWSILLAGVAICGVGTLVFLTARL* |
| Ga0157380_112263722 | 3300014326 | Switchgrass Rhizosphere | MLAYVVNEGRVCALKPSEWSILLAGVAICGFGTLVFLT |
| Ga0157377_100038301 | 3300014745 | Miscanthus Rhizosphere | VIRVEPGFRRSRRYNFNKISFAVEAKMQRVTAMMAYVVSEGRLCALKPAEWSFLLVGVTLCGIATLLFLMLHA* |
| Ga0132258_1001051016 | 3300015371 | Arabidopsis Rhizosphere | MQHRVSAIMAYVVSEGRLCALKPSEWSLLLAGVTLCGLMTLLYAATGF* |
| Ga0132258_100640184 | 3300015371 | Arabidopsis Rhizosphere | MQRVTAIMAYVVSEGRLCALRPAEWSLLLFGVALCGIATLLFLVLHA* |
| Ga0132258_101092562 | 3300015371 | Arabidopsis Rhizosphere | MLAYVVNEGRVCALKLSEWSILLAGVAICGFGTLVFLTARL* |
| Ga0132258_101165254 | 3300015371 | Arabidopsis Rhizosphere | MQHRVSTIMAYVVSEGRLCALKPSEWSLLLAGVTLCGLVTMLYVATGF* |
| Ga0132258_134473651 | 3300015371 | Arabidopsis Rhizosphere | PPIDNAVRVEAKMQRVSSMLAYVVNEGRVCALKPSEWSILLAGVAICGFGTLVFLTARL* |
| Ga0132257_1041214382 | 3300015373 | Arabidopsis Rhizosphere | SFAVEAKMQRVTAMMAYVVSEGRLCALKPAEWSLLLTGVTLCGIATLLFLMLHA* |
| Ga0182033_106517121 | 3300016319 | Soil | VEAKMQKVSSMFAYVVNDGRVCALKPSEWSILLIGIALCGFATLVFLTARL |
| Ga0182038_107704901 | 3300016445 | Soil | MQKVSSMFAYVVNDGRVCALKPSEWSILLIGIALCGFATLVFLTAR |
| Ga0187824_100142074 | 3300017927 | Freshwater Sediment | MQRVSAMVAFVMSDGRLCALKPSEWSLLLSGVAMCGIATALFLFVRV |
| Ga0187801_105118841 | 3300017933 | Freshwater Sediment | MVEILSAVEERVPAMVAYVMSEGRLFWLKPSEWLLLLVSAAICGFLTLLL |
| Ga0187775_100087682 | 3300017939 | Tropical Peatland | MQQRVSAIMAYVVSDGRLCALKPSEWSFLLAGVTLCGLVTLVYVVTGF |
| Ga0187775_100846351 | 3300017939 | Tropical Peatland | MQKVSAVLAYVVSEGRLCAMKPSEWSILLAGVALCGFVTLVFLTTRL |
| Ga0187786_100129491 | 3300017944 | Tropical Peatland | MNDGGVCALKPSEWSILLAGVALCGVVTMVVLLARV |
| Ga0187786_100172282 | 3300017944 | Tropical Peatland | MARVSALMAYVVNDGRLCALKPSEWSLLLAGVALCGFATLVFLISSL |
| Ga0187785_1000059315 | 3300017947 | Tropical Peatland | MQKVSSMLAFVMNEGRLCALKPSEWSILLVGVALCGFATLVFLTARL |
| Ga0187785_100033363 | 3300017947 | Tropical Peatland | MQRVAALMSYVVSEGRVCALKPSEWSLLLVGVALCGLVTVLYLMAGV |
| Ga0187785_100094634 | 3300017947 | Tropical Peatland | MQKVSSVFAYVVNDGRVCALKPSEWSILLAGVALCGVATMVVLLARV |
| Ga0187785_102269963 | 3300017947 | Tropical Peatland | MARVSALMAYVVNEGRLCALKPSEWSLLLAGVALCGFATLVFLISGL |
| Ga0187779_100190872 | 3300017959 | Tropical Peatland | MQHRVSAIMAYVVSEGRLCALKPSEWSLLLAGVTLCGLMTVLYVATGI |
| Ga0187779_100928363 | 3300017959 | Tropical Peatland | MQRVSALMSYVVSEGRVCALKPSEWSLLLAGVALCGIVTVLYLMAGV |
| Ga0187779_101439361 | 3300017959 | Tropical Peatland | MQQHVSAIMSYVVSEGRLCALNLSDWSLLLAGVAVCGLATLLYLVTSF |
| Ga0187779_112939272 | 3300017959 | Tropical Peatland | AKCFAVEAKMERVSALMAYVVNEGRLCALKPSEWSLLLAGVALCGFATLVFLISGL |
| Ga0187778_100567682 | 3300017961 | Tropical Peatland | MQHRVSAIMAYVVSEGRLCALKPSEWSLLLAGVTLCGLMTLLYVATGI |
| Ga0187777_100327994 | 3300017974 | Tropical Peatland | MQHRRVTAIMAYVVSEGRLCALKPSEWSLLLAGVTLCGLMTLLYVATGI |
| Ga0187777_101999903 | 3300017974 | Tropical Peatland | MQRVSALMSYVVSEGRVCALKPSEWSLLLAGVALCGLVTVLYLMAGV |
| Ga0187804_104752362 | 3300018006 | Freshwater Sediment | VETLSAVEERVPAMVAYVMSEGRLFWLKPSEWLLLLVSAAICGFLTLLL |
| Ga0184608_103883591 | 3300018028 | Groundwater Sediment | MQKVSSVLSYVVNEGRVCALKPSEWSILLAGVALCGFATLLFLASHV |
| Ga0187788_100241241 | 3300018032 | Tropical Peatland | SARSRIAFGVEAKMQKVSAVLAYVVSEGRLCAMKPSEWSILLAGVALCGFVTLVFLTTRL |
| Ga0187773_100512813 | 3300018064 | Tropical Peatland | MQKVSAMLAYVVGEGRLCAMKPSEWSILLAGVALCGFVTLVFLITHL |
| Ga0184611_10680532 | 3300018067 | Groundwater Sediment | MQKVSSVLAYVVNDGRVCALKPSEWSILLAGVVLCGFVTLFVLLARV |
| Ga0184635_101905231 | 3300018072 | Groundwater Sediment | MQKVSSVLSFVVNEGRVCALKPSEWSILLAGVALCGFATLLFPG |
| Ga0187774_107079862 | 3300018089 | Tropical Peatland | VEAKMQKVSAMLASVVSEGRLCAMKPSEWSILLAGVALCGFVTLVFLITHL |
| Ga0173481_100009717 | 3300019356 | Soil | MQRVTAMMAYVVSEGRLCALKPAEWSFLLVGVTLCGIATLLFLMLHA |
| Ga0173481_100176072 | 3300019356 | Soil | MQRVTAMMAYVVSEGRVCALKPAEWSLLLTGVALCGIATLLFLMLHA |
| Ga0173482_100036065 | 3300019361 | Soil | MQRVTAMMAYVVSEGRLCALKPAEWSLLLTGVALCGIATLLFLMLHA |
| Ga0193703_10640442 | 3300019876 | Soil | MQKVSSVLAYVVNDGRVCALKPSEWSILLAGVVLCGFVTLVVLLARA |
| Ga0193721_11650551 | 3300020018 | Soil | LPLGVEAKMQKVSSVLAYVVNDGRVCALKPSEWSILLAGVALCGFVTLLVLLARV |
| Ga0210381_102056652 | 3300021078 | Groundwater Sediment | MQKVSSVLAYVVNDGRVFALKPSEWSILLAGVVLCGFVTLVVLLARA |
| Ga0126371_1000313516 | 3300021560 | Tropical Forest Soil | MEKVSSVLAYVVNEGRVCALKPSEWSILLVGVALCGFGTLVFLTARL |
| Ga0247747_10047771 | 3300022737 | Soil | AVEARMQRVTAMMAYVVSEGRLCALKPAEWSLLLTGVALCGIATLLFLMLHA |
| Ga0222622_106315962 | 3300022756 | Groundwater Sediment | MQKVSSVLAYVVNDGRVCALKPSEWSILLAGVALCGFVTLLVLLARV |
| Ga0247792_11391432 | 3300022880 | Soil | MQRVTAMMAYVVSEGRLCALKPAEWSLLLIGVALCGIATLLFLMLHA |
| Ga0247786_10521172 | 3300022883 | Soil | VVFVIRVTARARHRRRYNFNKISFAVEAKMQRVTAMMAYVVSEGRLCALKPAEWSFLLVGVTLCGIATLLFLMLHA |
| Ga0247787_10029804 | 3300022893 | Soil | RKRHRRRYNFNKISFAVEAKMQRVTAMMAYVVSEGRLCALKPAEWSFLLVGVTLCGIATLLFLMLHA |
| Ga0209386_10698523 | 3300025582 | Arctic Peat Soil | PYGVRLEGGQQRVSAMLAYVVSEGRLFALNPSEWSMLLVGVALCGFVTLLF |
| Ga0207692_100711043 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MQRVSEMLAYVVNEGRLCALKPSEWSILLAGVAICGVGTLVFLTARL |
| Ga0207642_102395131 | 3300025899 | Miscanthus Rhizosphere | MQKVSSVFAYVVNDGRVCALKPSEWSILLTGVALCGVVTMV |
| Ga0207710_100509413 | 3300025900 | Switchgrass Rhizosphere | MQRVTAMMAYVVSEGRLCALKPAEWSLLLTGVALCGVATLLFLMLHA |
| Ga0207688_109237661 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | ISFAVEAKMQRVTAMMAYVVSEGRVCALKPAEWSLLLTGVALCGIATLLVLMLHA |
| Ga0207685_105935532 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MLAYVVNEGRVCALKPSEWSILLAGVAICGFGTLVFLTARL |
| Ga0207685_107571311 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | METVSALMAYVVNEGRLCALKPSEWSLLLAGVALCGFATLVFLISGL |
| Ga0207699_111418381 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | TQQQDRFAVEAKMQRVSAMVSFVMSEGRLCALKPSEWSLLLFGVAICGLATVLFLFARL |
| Ga0207654_100458702 | 3300025911 | Corn Rhizosphere | MQRVSSMLAYVVNEGRVCALKPSEWSILLAGVAICGFGTLVFLTARL |
| Ga0207663_101517813 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MERVSALMAYVVNEGRLCALKPSEWSLLLAGVALCGFATLVFLIS |
| Ga0207652_110433502 | 3300025921 | Corn Rhizosphere | RRYNFNKMSFAVEAKMQRVTAMMAYVVSEGRLCALKPAEWSLLLAGVTLCGIATLLFLMLHA |
| Ga0207706_100839781 | 3300025933 | Corn Rhizosphere | MQKVSSVFGYVVNDGRVCALKPSEWSILLTGVALCGVVTMVVLLART |
| Ga0207670_109404992 | 3300025936 | Switchgrass Rhizosphere | MQRVTAMMAYVVSEGRLCALKPAEWSLLLTGVVLCGIATLLFLMLHA |
| Ga0207669_102353691 | 3300025937 | Miscanthus Rhizosphere | AYVVNDGRVCALKPSEWSILLTGVALCGVVTMVVLLARI |
| Ga0207704_113767081 | 3300025938 | Miscanthus Rhizosphere | KISFAVEAKMQRVTAMMAYVVSEGRVCALKPAEWSLLLTGVALCGIATLLFLMLHA |
| Ga0207689_103107393 | 3300025942 | Miscanthus Rhizosphere | MQKVSSVFAYVVNDGRVCALKPSEWSILLTGVALCGVVTMVVLLARV |
| Ga0207712_102894971 | 3300025961 | Switchgrass Rhizosphere | MQKVSSVFAYVVNDGRVCALKPSEWSILLTGVALCGVVTMVVLLVRI |
| Ga0210078_10385702 | 3300025979 | Natural And Restored Wetlands | YVARHETAQQRVSAMMAYVVSEGRLFALKPSEWSMLLAGVAICGVATLLF |
| Ga0207677_104777932 | 3300026023 | Miscanthus Rhizosphere | YVVNDGRVCALKPSEWSILLTGVALCGVVTMVVLLARI |
| Ga0207678_120034911 | 3300026067 | Corn Rhizosphere | MQRVSAMLAYVVNEGRVCALKPSEWSILLAGVAICGFGTLVFLTARL |
| Ga0207676_100173481 | 3300026095 | Switchgrass Rhizosphere | SASQRGHGIGVRYNFNKISFAVEAKMQRVTAMMAYVVSEGRLCALKPAEWSFLLVGVTLCGIATLLFLMLHA |
| Ga0207674_122654982 | 3300026116 | Corn Rhizosphere | RMQRVTAMMAYVVSEGRLCALKPAEWSLLLTGVALCGIATLLFLMLHA |
| Ga0209647_10072356 | 3300026319 | Grasslands Soil | LTNKIALPWEAKLQRVSAIMSYVVSEGRVCALKPSEWSLLLVGVALCGIVALLL |
| Ga0207503_10042341 | 3300026861 | Soil | RGSRHQRRYNFNKISFAVEARMQRVTAMMAYVVSEGRLCALKPAEWSLLLTGVALCGIATLLFLMLHA |
| Ga0207521_1013251 | 3300026940 | Soil | NKLSFAVEAKMQRVTAMMAYVVSEGRLCALKPAEWSFLLVGVTLCGIATLLFLMLHA |
| Ga0207435_1015733 | 3300027390 | Soil | MQRVTAMMAYVVSEGRLCALKPAEWSFLLVGVTLCGIATL |
| Ga0208637_10064951 | 3300027401 | Soil | MQRVTAMMAYVVNEGRLCALKPAEWSLLLAGVALCGIATLLFLMLLA |
| Ga0207504_1019861 | 3300027455 | Soil | RHRRRYNFNKISFAVEAKMQRVTAMMAYVVSEGRLCALKPAEWSFLLVGVTLCGIATLLFLMLHA |
| Ga0207981_10569961 | 3300027560 | Soil | MQRVTAMMAYVVSEGRLCALKPAEWSLLLTGVALCGIATLLFLMLLA |
| Ga0207981_10907001 | 3300027560 | Soil | MQKVSSVFAYVVNDGRVCALKPSEWSILLTGVALCGV |
| Ga0209970_10089722 | 3300027614 | Arabidopsis Thaliana Rhizosphere | MSFAVEAKMQRVTAMMAYVVSEGRLCALKPAEWSFLLVGVTLCGIATLLFLMLHA |
| Ga0210002_10155771 | 3300027617 | Arabidopsis Thaliana Rhizosphere | ASQRGSRRPRRYNFNKIAFAVEAKMQRVTAMMAYVVSEGRLCALKPAEWSLLLTGVALCGIATLLFLMLHA |
| Ga0209971_10624842 | 3300027682 | Arabidopsis Thaliana Rhizosphere | SRHQRRYNFNKISFAVEAKMQRVTAMMAYVVSEGRLCALKPAEWSFLLVGVTLCGIATLLFLMLHA |
| Ga0209073_103372212 | 3300027765 | Agricultural Soil | MQQRVSAIMAYVVSEGRLCALKPSEWSLLLAGVTLCGLVTMLYVVTGF |
| Ga0209974_100484371 | 3300027876 | Arabidopsis Thaliana Rhizosphere | MQRVTAMMAYVVSEGRLCALKPAEWSLLLAGVTLCGIATLLFLMLHA |
| Ga0209068_100208072 | 3300027894 | Watersheds | MQKVSTVLAYLMNEGRLCALKPSEWSILLVGVALCGFGTLVFLTARL |
| Ga0207428_113053271 | 3300027907 | Populus Rhizosphere | MLAYVVSDGRVCALKPSEWSILLAGVVICGFATMLFLASQV |
| Ga0209382_115492601 | 3300027909 | Populus Rhizosphere | MSSMLAYVVSDGRVCALKPSEWSILLAGVVICGFATMLFLASQV |
| Ga0209583_100510541 | 3300027910 | Watersheds | MERVSALMAYVVSEGRLCALKPSEWSLLLAGVALCGFATLVFLISGL |
| Ga0209069_100137647 | 3300027915 | Watersheds | MERVSALMAYVVSEGRLCALKPSEWSLLLAGVALCGFVTLVFLVSGL |
| Ga0209069_109956952 | 3300027915 | Watersheds | YVAHATIQQRVSAMLAYVVNEGRLFALKPSEWSMLLGGVTLCGLLTLLF |
| Ga0247749_10005395 | 3300027993 | Soil | MQRVTAMMAYVVSEGRLCALKPAEWSLLLTVVALCGIATLLFLMLHA |
| Ga0268265_105079632 | 3300028380 | Switchgrass Rhizosphere | MQKVPSVFAYVVNDGRVCALKPSEWSILLTGVALCGVVTMVVLLARI |
| Ga0307282_104709382 | 3300028784 | Soil | MQKVSSVLAYVVNDGRVCALKPSEWSILLAGVVLCGFVTLVVLL |
| Ga0307302_100275624 | 3300028814 | Soil | MQKVSSVLSYVVNEGRVCALKPSEWSILLAGVALCGFATLLFLASRV |
| Ga0307296_100355111 | 3300028819 | Soil | VRETVQQRVRAMMAYVASEGRLFALKPSEWGILLVGVALCGFATLLF |
| Ga0307499_101341062 | 3300031184 | Soil | MQRVSAMLAYVVNEGRVCALKPSEWSILLAGVAICGFGTLVFLT |
| Ga0307497_100557351 | 3300031226 | Soil | MQRVTAMMAYVVSEGRVCALKPAEWSLLLTGVALCGIATLLFLMLH |
| Ga0170824_1046048055 | 3300031231 | Forest Soil | MQRVSAVLAYVVNEGRVCALKPSEWSILLAGVAICGFGTLVFLTARL |
| Ga0170824_1270880842 | 3300031231 | Forest Soil | EAKMERVSALMAYVVNEGRLCALKPSEWSLLLAGVALCGFATLVFLISGL |
| Ga0265325_100000533 | 3300031241 | Rhizosphere | MERVSALMAYVVNEGRLCALKPSEWSLLLAGVALCGFATLVFLISGH |
| (restricted) Ga0255312_10007029 | 3300031248 | Sandy Soil | MQRVTAMMAYVVSEGRLCALKPAEWSLLLAGVTLCGIATLLF |
| Ga0265331_104788072 | 3300031250 | Rhizosphere | VSALMAYVVNEGRLCALKPSEWSLLLAGVALCGFATLVFLISGH |
| Ga0310887_100945181 | 3300031547 | Soil | VFAYVVNDGRVCALKPSEWSILLTGVALCGVVTMVVLLARI |
| Ga0318573_107522582 | 3300031564 | Soil | NDGRVCALKPSEWSILLAGVALCGVVTMVVLLARV |
| Ga0318574_103646632 | 3300031680 | Soil | MQKVSSVFAYVVNDGRVCALKPSEWSILLAGVALCGVVTMVV |
| Ga0310813_100618651 | 3300031716 | Soil | RVTAMMAYVVSEGRLCALKPAEWSLLLTGVALCGIATLLFLMLHA |
| Ga0310813_102820032 | 3300031716 | Soil | MQKVSAMLAYVVNEGRLCALKPSEWSILLVGVALCGFATLLFLTARL |
| Ga0307468_1001035881 | 3300031740 | Hardwood Forest Soil | MQKVSSVLSFVVNEGRVCALKPSEWSILLAGVALCGFATLIFHG |
| Ga0310892_104250391 | 3300031858 | Soil | MQRVTAMMAYVVNEGRLCALKPAEWSLLLAGVALCGIATL |
| Ga0306921_124527981 | 3300031912 | Soil | MQKVSSMFAYVVNDGRVCALKPSEWSILLIGIALCGFATL |
| Ga0310884_100111255 | 3300031944 | Soil | MQKVSSVFAYVVNDGRVCALKPSEWSILLTGVALCGVATMAV |
| Ga0310897_101155702 | 3300032003 | Soil | VEAKMQKVSSVFAYVVNDGRVCALKPSEWSILLTGVALCGVATMAVLLARI |
| Ga0318558_104251632 | 3300032044 | Soil | VFAYVVNDGRVCALKPSEWSILLAGVALCGVVTMVVLLARV |
| Ga0306924_119370381 | 3300032076 | Soil | MQKVSSMFAYVVNDGRVCALKPSEWSILLIGIALCGFAT |
| Ga0318518_104767322 | 3300032090 | Soil | MQKVSSVFAYVVNDGRVCALKPSEWSILLAGVALCGVVTM |
| Ga0307472_1000479493 | 3300032205 | Hardwood Forest Soil | MQKVSSVFGYVVNDGRVCALKPSEWSILLTGVALCGVVTMVVLLARI |
| Ga0307472_1004993453 | 3300032205 | Hardwood Forest Soil | SCPREADMQHHVSAIMAYVVSEGRLCALKPSEWSLLLAGVTLCGLMTLLYVATGF |
| Ga0307472_1014006331 | 3300032205 | Hardwood Forest Soil | MQQRVSAIMAYVVSEGRLCALKPSEWSLLLAGVTLCGLVTLLYLVTSI |
| Ga0310812_101365071 | 3300032421 | Soil | MQRVTAMMAYVVSEGRLCALKPAEWSLLLSGVVLCGIATLLFLMLHA |
| Ga0335080_108194052 | 3300032828 | Soil | MTRVSALMAYVVNDGRVCALKPSEWSLLLAGVALCGFATLVFLVSGL |
| Ga0326726_100087372 | 3300033433 | Peat Soil | MQKVSAVLAYVMNEGRLCALKPSEWSILLVGVALCGFGTLVFLTARL |
| Ga0326726_100987685 | 3300033433 | Peat Soil | MQKVSAMLGYVVSEGRLCALKPSEWSILLAGVVLCGFVTLVFLISRL |
| Ga0326726_101681111 | 3300033433 | Peat Soil | MQQRVSAIMAYVINEGRLCALKPSEWSLLLVGVALCGFLTLLYLITSF |
| Ga0326726_106798741 | 3300033433 | Peat Soil | MQKVSAVLAYVMNEGRLCALKPSEWSILLVGVALCGFGTLV |
| Ga0316628_1012893693 | 3300033513 | Soil | MQRVSAMMAYVMSEGRLCALKPSEWSLLLAGVAVCGFVTLLFLVLHA |
| Ga0326723_0060819_1_126 | 3300034090 | Peat Soil | MQKVSAVLAYVMNEGRLCALKPSEWSILLVGVALCGFGTLVF |
| Ga0326723_0379019_223_378 | 3300034090 | Peat Soil | VEAKMQKVSAMLAYVVSEGRLCAMKPSEWSILLAGVALCGFVTLVFLITHL |
| ⦗Top⦘ |