| Basic Information | |
|---|---|
| Family ID | F010783 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 299 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MTGWYAERTPDRSAKAVIAVTLLALLLVAAVPVALLAGVV |
| Number of Associated Samples | 217 |
| Number of Associated Scaffolds | 299 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 94.61 % |
| % of genes near scaffold ends (potentially truncated) | 98.33 % |
| % of genes from short scaffolds (< 2000 bps) | 91.64 % |
| Associated GOLD sequencing projects | 210 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (57.860 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (38.127 % of family members) |
| Environment Ontology (ENVO) | Unclassified (40.803 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (42.809 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.12% β-sheet: 0.00% Coil/Unstructured: 55.88% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 299 Family Scaffolds |
|---|---|---|
| PF02518 | HATPase_c | 2.34 |
| PF00296 | Bac_luciferase | 2.34 |
| PF02894 | GFO_IDH_MocA_C | 2.01 |
| PF01408 | GFO_IDH_MocA | 1.67 |
| PF00196 | GerE | 1.34 |
| PF00027 | cNMP_binding | 1.34 |
| PF04266 | ASCH | 1.34 |
| PF13649 | Methyltransf_25 | 1.34 |
| PF11716 | MDMPI_N | 1.34 |
| PF10604 | Polyketide_cyc2 | 1.34 |
| PF12680 | SnoaL_2 | 1.00 |
| PF00300 | His_Phos_1 | 1.00 |
| PF04237 | YjbR | 1.00 |
| PF01266 | DAO | 1.00 |
| PF04978 | DUF664 | 1.00 |
| PF03737 | RraA-like | 1.00 |
| PF07730 | HisKA_3 | 0.67 |
| PF14525 | AraC_binding_2 | 0.67 |
| PF08044 | DUF1707 | 0.67 |
| PF08241 | Methyltransf_11 | 0.67 |
| PF13424 | TPR_12 | 0.67 |
| PF00872 | Transposase_mut | 0.67 |
| PF00583 | Acetyltransf_1 | 0.67 |
| PF00005 | ABC_tran | 0.67 |
| PF03795 | YCII | 0.67 |
| PF14464 | Prok-JAB | 0.67 |
| PF00324 | AA_permease | 0.33 |
| PF02594 | DUF167 | 0.33 |
| PF04672 | Methyltransf_19 | 0.33 |
| PF00406 | ADK | 0.33 |
| PF03704 | BTAD | 0.33 |
| PF10017 | Methyltransf_33 | 0.33 |
| PF00069 | Pkinase | 0.33 |
| PF09594 | GT87 | 0.33 |
| PF07883 | Cupin_2 | 0.33 |
| PF13404 | HTH_AsnC-type | 0.33 |
| PF13676 | TIR_2 | 0.33 |
| PF08240 | ADH_N | 0.33 |
| PF07311 | Dodecin | 0.33 |
| PF00857 | Isochorismatase | 0.33 |
| PF04116 | FA_hydroxylase | 0.33 |
| PF13669 | Glyoxalase_4 | 0.33 |
| PF05973 | Gp49 | 0.33 |
| PF01047 | MarR | 0.33 |
| PF13193 | AMP-binding_C | 0.33 |
| PF13378 | MR_MLE_C | 0.33 |
| PF02899 | Phage_int_SAM_1 | 0.33 |
| PF01906 | YbjQ_1 | 0.33 |
| PF13302 | Acetyltransf_3 | 0.33 |
| PF13847 | Methyltransf_31 | 0.33 |
| PF02579 | Nitro_FeMo-Co | 0.33 |
| PF08281 | Sigma70_r4_2 | 0.33 |
| PF00400 | WD40 | 0.33 |
| PF13474 | SnoaL_3 | 0.33 |
| PF02775 | TPP_enzyme_C | 0.33 |
| PF07859 | Abhydrolase_3 | 0.33 |
| PF01636 | APH | 0.33 |
| PF02156 | Glyco_hydro_26 | 0.33 |
| PF01402 | RHH_1 | 0.33 |
| PF09922 | DUF2154 | 0.33 |
| PF01494 | FAD_binding_3 | 0.33 |
| PF02583 | Trns_repr_metal | 0.33 |
| PF01909 | NTP_transf_2 | 0.33 |
| PF00378 | ECH_1 | 0.33 |
| PF12706 | Lactamase_B_2 | 0.33 |
| PF00355 | Rieske | 0.33 |
| PF13156 | Mrr_cat_2 | 0.33 |
| PF06792 | UPF0261 | 0.33 |
| PF13460 | NAD_binding_10 | 0.33 |
| PF03861 | ANTAR | 0.33 |
| COG ID | Name | Functional Category | % Frequency in 299 Family Scaffolds |
|---|---|---|---|
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 2.34 |
| COG0673 | Predicted dehydrogenase | General function prediction only [R] | 2.01 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 1.34 |
| COG4405 | Predicted RNA-binding protein YhfF, contains PUA-like ASCH domain | General function prediction only [R] | 1.34 |
| COG3097 | Uncharacterized conserved protein YqfB, UPF0267 family | Function unknown [S] | 1.34 |
| COG2411 | Predicted RNA-binding protein, contains PUA-like ASCH domain | General function prediction only [R] | 1.34 |
| COG0684 | RNA degradosome component RraA (regulator of RNase E activity) | Translation, ribosomal structure and biogenesis [J] | 1.00 |
| COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 1.00 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.67 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.67 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.67 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.67 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.67 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.67 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 0.67 |
| COG3657 | Putative component of the toxin-antitoxin plasmid stabilization module | Defense mechanisms [V] | 0.33 |
| COG5441 | ATP-binding helicase-inhibiting domain, Tm-1/UPF0261 family | Defense mechanisms [V] | 0.33 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.33 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.33 |
| COG4679 | Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system | Defense mechanisms [V] | 0.33 |
| COG0531 | Serine transporter YbeC, amino acid:H+ symporter family | Amino acid transport and metabolism [E] | 0.33 |
| COG0563 | Adenylate kinase or related kinase | Nucleotide transport and metabolism [F] | 0.33 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.33 |
| COG4124 | Beta-mannanase | Carbohydrate transport and metabolism [G] | 0.33 |
| COG3947 | Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains | Transcription [K] | 0.33 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.33 |
| COG3707 | Two-component response regulator, AmiR/NasT family, consists of REC and RNA-binding antiterminator (ANTAR) domains | Transcription [K] | 0.33 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.33 |
| COG3629 | DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domain | Transcription [K] | 0.33 |
| COG3360 | Flavin-binding protein dodecin | General function prediction only [R] | 0.33 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.33 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.33 |
| COG3000 | Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamily | Lipid transport and metabolism [I] | 0.33 |
| COG0833 | Amino acid permease | Amino acid transport and metabolism [E] | 0.33 |
| COG0393 | Uncharacterized pentameric protein YbjQ, UPF0145 family | Function unknown [S] | 0.33 |
| COG1113 | L-asparagine transporter or related permease | Amino acid transport and metabolism [E] | 0.33 |
| COG1115 | Na+/alanine symporter | Amino acid transport and metabolism [E] | 0.33 |
| COG1937 | DNA-binding transcriptional regulator, FrmR family | Transcription [K] | 0.33 |
| COG1872 | Uncharacterized conserved protein YggU, UPF0235/DUF167 family | Function unknown [S] | 0.33 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.33 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 57.86 % |
| Unclassified | root | N/A | 42.14 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_116116489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 641 | Open in IMG/M |
| 3300001593|JGI12635J15846_10337550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 928 | Open in IMG/M |
| 3300004092|Ga0062389_104650586 | Not Available | 517 | Open in IMG/M |
| 3300004268|Ga0066398_10044059 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300005330|Ga0070690_101743253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 507 | Open in IMG/M |
| 3300005332|Ga0066388_100058434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 4055 | Open in IMG/M |
| 3300005332|Ga0066388_104989799 | Not Available | 674 | Open in IMG/M |
| 3300005332|Ga0066388_107651767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 541 | Open in IMG/M |
| 3300005363|Ga0008090_15296063 | Not Available | 616 | Open in IMG/M |
| 3300005434|Ga0070709_10675651 | Not Available | 802 | Open in IMG/M |
| 3300005434|Ga0070709_11482540 | Not Available | 550 | Open in IMG/M |
| 3300005436|Ga0070713_100212097 | All Organisms → cellular organisms → Bacteria | 1753 | Open in IMG/M |
| 3300005471|Ga0070698_101282610 | Not Available | 682 | Open in IMG/M |
| 3300005548|Ga0070665_100282493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → unclassified Nocardioides → Nocardioides sp. YR527 | 1662 | Open in IMG/M |
| 3300005591|Ga0070761_11105114 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300005602|Ga0070762_10693290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 683 | Open in IMG/M |
| 3300005610|Ga0070763_10867387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 536 | Open in IMG/M |
| 3300005617|Ga0068859_100602291 | All Organisms → cellular organisms → Bacteria | 1192 | Open in IMG/M |
| 3300005764|Ga0066903_105801841 | Not Available | 648 | Open in IMG/M |
| 3300005921|Ga0070766_10285645 | Not Available | 1056 | Open in IMG/M |
| 3300006028|Ga0070717_10480796 | Not Available | 1121 | Open in IMG/M |
| 3300006028|Ga0070717_10891601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia jejuensis | 810 | Open in IMG/M |
| 3300006041|Ga0075023_100623407 | Not Available | 505 | Open in IMG/M |
| 3300006059|Ga0075017_100036596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3254 | Open in IMG/M |
| 3300006059|Ga0075017_100845545 | Not Available | 709 | Open in IMG/M |
| 3300006173|Ga0070716_100471596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Cellulomonas | 920 | Open in IMG/M |
| 3300006174|Ga0075014_100975822 | Not Available | 512 | Open in IMG/M |
| 3300006176|Ga0070765_100042657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3644 | Open in IMG/M |
| 3300006572|Ga0074051_10008430 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300006755|Ga0079222_10634642 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300006903|Ga0075426_10131190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1805 | Open in IMG/M |
| 3300006904|Ga0075424_102122590 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300006914|Ga0075436_101544464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 504 | Open in IMG/M |
| 3300006954|Ga0079219_11599475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella lactea | 597 | Open in IMG/M |
| 3300006954|Ga0079219_11675038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus | 588 | Open in IMG/M |
| 3300009038|Ga0099829_10233850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1495 | Open in IMG/M |
| 3300009088|Ga0099830_11310225 | Not Available | 602 | Open in IMG/M |
| 3300009137|Ga0066709_101299011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1067 | Open in IMG/M |
| 3300009522|Ga0116218_1234027 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300009551|Ga0105238_12876781 | Not Available | 517 | Open in IMG/M |
| 3300009624|Ga0116105_1180429 | Not Available | 574 | Open in IMG/M |
| 3300009698|Ga0116216_10371068 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300009700|Ga0116217_10420278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 847 | Open in IMG/M |
| 3300009764|Ga0116134_1073075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1271 | Open in IMG/M |
| 3300009792|Ga0126374_10215769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1226 | Open in IMG/M |
| 3300010043|Ga0126380_10011559 | Not Available | 3984 | Open in IMG/M |
| 3300010043|Ga0126380_10738121 | Not Available | 797 | Open in IMG/M |
| 3300010046|Ga0126384_11862300 | Not Available | 572 | Open in IMG/M |
| 3300010048|Ga0126373_10070170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3164 | Open in IMG/M |
| 3300010048|Ga0126373_10276811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1663 | Open in IMG/M |
| 3300010048|Ga0126373_10455407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1315 | Open in IMG/M |
| 3300010048|Ga0126373_11775925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → unclassified Kribbella → Kribbella sp. VKM Ac-2575 | 680 | Open in IMG/M |
| 3300010048|Ga0126373_11902732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 658 | Open in IMG/M |
| 3300010048|Ga0126373_12144693 | Not Available | 620 | Open in IMG/M |
| 3300010358|Ga0126370_12297497 | Not Available | 533 | Open in IMG/M |
| 3300010359|Ga0126376_11140596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 790 | Open in IMG/M |
| 3300010360|Ga0126372_10684879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 998 | Open in IMG/M |
| 3300010360|Ga0126372_11355091 | Not Available | 742 | Open in IMG/M |
| 3300010360|Ga0126372_12321722 | Not Available | 586 | Open in IMG/M |
| 3300010361|Ga0126378_10471859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1369 | Open in IMG/M |
| 3300010361|Ga0126378_11389515 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300010366|Ga0126379_13588675 | Not Available | 520 | Open in IMG/M |
| 3300010376|Ga0126381_100849947 | All Organisms → cellular organisms → Bacteria | 1312 | Open in IMG/M |
| 3300010376|Ga0126381_101718897 | Not Available | 906 | Open in IMG/M |
| 3300010376|Ga0126381_102496647 | Not Available | 740 | Open in IMG/M |
| 3300010379|Ga0136449_102659553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 712 | Open in IMG/M |
| 3300010403|Ga0134123_12202515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus | 613 | Open in IMG/M |
| 3300010867|Ga0126347_1488843 | Not Available | 538 | Open in IMG/M |
| 3300010880|Ga0126350_12220272 | Not Available | 508 | Open in IMG/M |
| 3300012189|Ga0137388_10548560 | Not Available | 1074 | Open in IMG/M |
| 3300012198|Ga0137364_10449706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 966 | Open in IMG/M |
| 3300012207|Ga0137381_10865024 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300012210|Ga0137378_10693894 | Not Available | 929 | Open in IMG/M |
| 3300012210|Ga0137378_11813737 | Not Available | 514 | Open in IMG/M |
| 3300012211|Ga0137377_11152633 | Not Available | 705 | Open in IMG/M |
| 3300012350|Ga0137372_10747493 | Not Available | 705 | Open in IMG/M |
| 3300012359|Ga0137385_10782856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter | 793 | Open in IMG/M |
| 3300012362|Ga0137361_10764294 | Not Available | 881 | Open in IMG/M |
| 3300012363|Ga0137390_10278011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1658 | Open in IMG/M |
| 3300012930|Ga0137407_10031633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4131 | Open in IMG/M |
| 3300012987|Ga0164307_11486158 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300014155|Ga0181524_10119434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1426 | Open in IMG/M |
| 3300014657|Ga0181522_10061315 | Not Available | 2130 | Open in IMG/M |
| 3300015371|Ga0132258_11224053 | All Organisms → cellular organisms → Bacteria | 1898 | Open in IMG/M |
| 3300015372|Ga0132256_101212863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 868 | Open in IMG/M |
| 3300016294|Ga0182041_12336332 | Not Available | 500 | Open in IMG/M |
| 3300016357|Ga0182032_10971743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 724 | Open in IMG/M |
| 3300016387|Ga0182040_10100036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1965 | Open in IMG/M |
| 3300016422|Ga0182039_10350804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1239 | Open in IMG/M |
| 3300016445|Ga0182038_10880368 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300017928|Ga0187806_1029397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1623 | Open in IMG/M |
| 3300017932|Ga0187814_10174008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 805 | Open in IMG/M |
| 3300017932|Ga0187814_10434974 | Not Available | 513 | Open in IMG/M |
| 3300017936|Ga0187821_10428298 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300017937|Ga0187809_10400362 | Not Available | 523 | Open in IMG/M |
| 3300017938|Ga0187854_10062026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1833 | Open in IMG/M |
| 3300017946|Ga0187879_10178667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1194 | Open in IMG/M |
| 3300017959|Ga0187779_10806482 | Not Available | 641 | Open in IMG/M |
| 3300017975|Ga0187782_11313357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 568 | Open in IMG/M |
| 3300017975|Ga0187782_11534263 | Not Available | 525 | Open in IMG/M |
| 3300017995|Ga0187816_10252128 | Not Available | 770 | Open in IMG/M |
| 3300018007|Ga0187805_10397274 | Not Available | 640 | Open in IMG/M |
| 3300018016|Ga0187880_1442185 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 539 | Open in IMG/M |
| 3300018029|Ga0187787_10462867 | Not Available | 513 | Open in IMG/M |
| 3300018033|Ga0187867_10348046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 825 | Open in IMG/M |
| 3300018034|Ga0187863_10176980 | Not Available | 1189 | Open in IMG/M |
| 3300018037|Ga0187883_10522750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 613 | Open in IMG/M |
| 3300018037|Ga0187883_10530107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 608 | Open in IMG/M |
| 3300018044|Ga0187890_10751269 | Not Available | 551 | Open in IMG/M |
| 3300018058|Ga0187766_10633618 | Not Available | 733 | Open in IMG/M |
| 3300018058|Ga0187766_10966231 | Not Available | 604 | Open in IMG/M |
| 3300018062|Ga0187784_11310954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales | 574 | Open in IMG/M |
| 3300018085|Ga0187772_10073086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 2159 | Open in IMG/M |
| 3300018085|Ga0187772_11474902 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 506 | Open in IMG/M |
| 3300019888|Ga0193751_1158625 | Not Available | 803 | Open in IMG/M |
| 3300021080|Ga0210382_10406426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 603 | Open in IMG/M |
| 3300021088|Ga0210404_10598014 | Not Available | 627 | Open in IMG/M |
| 3300021181|Ga0210388_10935992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 745 | Open in IMG/M |
| 3300021404|Ga0210389_10458998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1002 | Open in IMG/M |
| 3300021404|Ga0210389_10784984 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 744 | Open in IMG/M |
| 3300021404|Ga0210389_11476630 | Not Available | 517 | Open in IMG/M |
| 3300021406|Ga0210386_11742183 | Not Available | 514 | Open in IMG/M |
| 3300021407|Ga0210383_10340166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1292 | Open in IMG/M |
| 3300021475|Ga0210392_10709346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei → Conexibacter woesei DSM 14684 | 749 | Open in IMG/M |
| 3300021560|Ga0126371_12302468 | Not Available | 651 | Open in IMG/M |
| 3300021560|Ga0126371_12347484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 645 | Open in IMG/M |
| 3300025576|Ga0208820_1039042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1396 | Open in IMG/M |
| 3300025588|Ga0208586_1099930 | Not Available | 627 | Open in IMG/M |
| 3300025588|Ga0208586_1115630 | Not Available | 573 | Open in IMG/M |
| 3300025625|Ga0208219_1000694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 11985 | Open in IMG/M |
| 3300025922|Ga0207646_10389077 | Not Available | 1260 | Open in IMG/M |
| 3300025922|Ga0207646_10700453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 906 | Open in IMG/M |
| 3300025929|Ga0207664_10859615 | Not Available | 815 | Open in IMG/M |
| 3300026116|Ga0207674_11959759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 551 | Open in IMG/M |
| 3300026217|Ga0209871_1075470 | Not Available | 650 | Open in IMG/M |
| 3300027072|Ga0208238_1013289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus africanus | 702 | Open in IMG/M |
| 3300027172|Ga0208098_1029223 | Not Available | 565 | Open in IMG/M |
| 3300027646|Ga0209466_1095305 | Not Available | 602 | Open in IMG/M |
| 3300027676|Ga0209333_1145156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 639 | Open in IMG/M |
| 3300027783|Ga0209448_10133797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidiferrimicrobium → unclassified Acidiferrimicrobium → Acidiferrimicrobium sp. IK | 829 | Open in IMG/M |
| 3300027854|Ga0209517_10023355 | All Organisms → cellular organisms → Bacteria | 5565 | Open in IMG/M |
| 3300027889|Ga0209380_10251792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1037 | Open in IMG/M |
| 3300027895|Ga0209624_10180121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1402 | Open in IMG/M |
| 3300027895|Ga0209624_11045293 | Not Available | 528 | Open in IMG/M |
| 3300027903|Ga0209488_10306266 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1186 | Open in IMG/M |
| 3300028768|Ga0307280_10260849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 625 | Open in IMG/M |
| 3300028789|Ga0302232_10433143 | Not Available | 646 | Open in IMG/M |
| 3300028801|Ga0302226_10114195 | Not Available | 1194 | Open in IMG/M |
| 3300028813|Ga0302157_10098700 | All Organisms → cellular organisms → Bacteria | 1840 | Open in IMG/M |
| 3300028879|Ga0302229_10078712 | All Organisms → cellular organisms → Bacteria | 1585 | Open in IMG/M |
| 3300028906|Ga0308309_10043925 | All Organisms → cellular organisms → Bacteria | 3174 | Open in IMG/M |
| 3300028906|Ga0308309_10271359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1426 | Open in IMG/M |
| 3300029882|Ga0311368_10701286 | Not Available | 700 | Open in IMG/M |
| 3300029917|Ga0311326_10217721 | Not Available | 995 | Open in IMG/M |
| 3300029943|Ga0311340_10541892 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
| 3300029952|Ga0311346_10138877 | All Organisms → cellular organisms → Bacteria | 2930 | Open in IMG/M |
| 3300029999|Ga0311339_11679402 | Not Available | 557 | Open in IMG/M |
| 3300030013|Ga0302178_10130106 | All Organisms → cellular organisms → Bacteria | 1266 | Open in IMG/M |
| 3300030053|Ga0302177_10023641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3906 | Open in IMG/M |
| 3300030053|Ga0302177_10656136 | Not Available | 533 | Open in IMG/M |
| 3300030054|Ga0302182_10180656 | Not Available | 907 | Open in IMG/M |
| 3300030520|Ga0311372_10008362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 23118 | Open in IMG/M |
| 3300030646|Ga0302316_10358628 | Not Available | 587 | Open in IMG/M |
| 3300030688|Ga0311345_10551341 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300031233|Ga0302307_10644324 | Not Available | 533 | Open in IMG/M |
| 3300031236|Ga0302324_100482730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1816 | Open in IMG/M |
| 3300031543|Ga0318516_10391584 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300031544|Ga0318534_10193383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Phycicoccus → unclassified Phycicoccus → Phycicoccus sp. Soil748 | 1175 | Open in IMG/M |
| 3300031544|Ga0318534_10733979 | Not Available | 557 | Open in IMG/M |
| 3300031544|Ga0318534_10773829 | Not Available | 540 | Open in IMG/M |
| 3300031546|Ga0318538_10254447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 943 | Open in IMG/M |
| 3300031546|Ga0318538_10769418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 522 | Open in IMG/M |
| 3300031549|Ga0318571_10068996 | Not Available | 1096 | Open in IMG/M |
| 3300031561|Ga0318528_10155855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1217 | Open in IMG/M |
| 3300031561|Ga0318528_10205489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1054 | Open in IMG/M |
| 3300031564|Ga0318573_10663347 | Not Available | 561 | Open in IMG/M |
| 3300031572|Ga0318515_10047192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2156 | Open in IMG/M |
| 3300031572|Ga0318515_10082856 | All Organisms → cellular organisms → Bacteria | 1664 | Open in IMG/M |
| 3300031573|Ga0310915_10173108 | Not Available | 1501 | Open in IMG/M |
| 3300031573|Ga0310915_10817033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 655 | Open in IMG/M |
| 3300031671|Ga0307372_10335270 | Not Available | 821 | Open in IMG/M |
| 3300031679|Ga0318561_10819871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 511 | Open in IMG/M |
| 3300031680|Ga0318574_10064167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1967 | Open in IMG/M |
| 3300031680|Ga0318574_10204703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1134 | Open in IMG/M |
| 3300031681|Ga0318572_10323619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 913 | Open in IMG/M |
| 3300031681|Ga0318572_10846710 | Not Available | 543 | Open in IMG/M |
| 3300031682|Ga0318560_10040865 | All Organisms → cellular organisms → Bacteria | 2246 | Open in IMG/M |
| 3300031682|Ga0318560_10214228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1031 | Open in IMG/M |
| 3300031682|Ga0318560_10383608 | Not Available | 760 | Open in IMG/M |
| 3300031708|Ga0310686_105081000 | Not Available | 570 | Open in IMG/M |
| 3300031708|Ga0310686_106238335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 584 | Open in IMG/M |
| 3300031708|Ga0310686_106291417 | Not Available | 508 | Open in IMG/M |
| 3300031713|Ga0318496_10850739 | Not Available | 503 | Open in IMG/M |
| 3300031715|Ga0307476_10194754 | All Organisms → cellular organisms → Bacteria | 1470 | Open in IMG/M |
| 3300031715|Ga0307476_10313261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1152 | Open in IMG/M |
| 3300031719|Ga0306917_10114716 | All Organisms → cellular organisms → Bacteria | 1954 | Open in IMG/M |
| 3300031719|Ga0306917_10186166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1564 | Open in IMG/M |
| 3300031723|Ga0318493_10710981 | Not Available | 563 | Open in IMG/M |
| 3300031724|Ga0318500_10061216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1629 | Open in IMG/M |
| 3300031744|Ga0306918_10167484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1636 | Open in IMG/M |
| 3300031748|Ga0318492_10231664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 951 | Open in IMG/M |
| 3300031748|Ga0318492_10819143 | Not Available | 501 | Open in IMG/M |
| 3300031751|Ga0318494_10407499 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300031751|Ga0318494_10805459 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300031764|Ga0318535_10091212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1326 | Open in IMG/M |
| 3300031764|Ga0318535_10312581 | Not Available | 703 | Open in IMG/M |
| 3300031765|Ga0318554_10085213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1766 | Open in IMG/M |
| 3300031768|Ga0318509_10006375 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4789 | Open in IMG/M |
| 3300031768|Ga0318509_10323049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella | 864 | Open in IMG/M |
| 3300031769|Ga0318526_10045711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1655 | Open in IMG/M |
| 3300031770|Ga0318521_10516847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 718 | Open in IMG/M |
| 3300031770|Ga0318521_10950059 | Not Available | 526 | Open in IMG/M |
| 3300031771|Ga0318546_10069213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2248 | Open in IMG/M |
| 3300031771|Ga0318546_10484004 | Not Available | 868 | Open in IMG/M |
| 3300031771|Ga0318546_10842828 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300031771|Ga0318546_10930173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Phycicoccus → unclassified Phycicoccus → Phycicoccus sp. Soil748 | 612 | Open in IMG/M |
| 3300031777|Ga0318543_10057944 | Not Available | 1596 | Open in IMG/M |
| 3300031778|Ga0318498_10079754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1476 | Open in IMG/M |
| 3300031778|Ga0318498_10159789 | Not Available | 1025 | Open in IMG/M |
| 3300031780|Ga0318508_1053804 | Not Available | 1069 | Open in IMG/M |
| 3300031781|Ga0318547_10506693 | Not Available | 745 | Open in IMG/M |
| 3300031793|Ga0318548_10005824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4524 | Open in IMG/M |
| 3300031794|Ga0318503_10011752 | Not Available | 2321 | Open in IMG/M |
| 3300031794|Ga0318503_10155212 | Not Available | 738 | Open in IMG/M |
| 3300031795|Ga0318557_10357604 | Not Available | 671 | Open in IMG/M |
| 3300031796|Ga0318576_10105583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1289 | Open in IMG/M |
| 3300031796|Ga0318576_10342376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 707 | Open in IMG/M |
| 3300031796|Ga0318576_10439656 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300031797|Ga0318550_10033798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2218 | Open in IMG/M |
| 3300031797|Ga0318550_10099781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1368 | Open in IMG/M |
| 3300031797|Ga0318550_10419739 | Not Available | 647 | Open in IMG/M |
| 3300031797|Ga0318550_10618016 | Not Available | 520 | Open in IMG/M |
| 3300031798|Ga0318523_10153116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1146 | Open in IMG/M |
| 3300031798|Ga0318523_10230504 | Not Available | 926 | Open in IMG/M |
| 3300031799|Ga0318565_10446393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 626 | Open in IMG/M |
| 3300031805|Ga0318497_10007121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4976 | Open in IMG/M |
| 3300031805|Ga0318497_10055304 | Not Available | 2054 | Open in IMG/M |
| 3300031819|Ga0318568_10563902 | Not Available | 710 | Open in IMG/M |
| 3300031819|Ga0318568_11004259 | Not Available | 515 | Open in IMG/M |
| 3300031821|Ga0318567_10762308 | Not Available | 548 | Open in IMG/M |
| 3300031832|Ga0318499_10168685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 854 | Open in IMG/M |
| 3300031833|Ga0310917_10379808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 960 | Open in IMG/M |
| 3300031835|Ga0318517_10214935 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300031835|Ga0318517_10566899 | Not Available | 510 | Open in IMG/M |
| 3300031859|Ga0318527_10215934 | Not Available | 813 | Open in IMG/M |
| 3300031859|Ga0318527_10373071 | Not Available | 608 | Open in IMG/M |
| 3300031860|Ga0318495_10333700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 672 | Open in IMG/M |
| 3300031879|Ga0306919_10133426 | All Organisms → cellular organisms → Bacteria | 1792 | Open in IMG/M |
| 3300031879|Ga0306919_10204707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1468 | Open in IMG/M |
| 3300031879|Ga0306919_11033005 | Not Available | 628 | Open in IMG/M |
| 3300031879|Ga0306919_11321929 | Not Available | 545 | Open in IMG/M |
| 3300031890|Ga0306925_10993107 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300031893|Ga0318536_10098048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 1467 | Open in IMG/M |
| 3300031893|Ga0318536_10172756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1099 | Open in IMG/M |
| 3300031894|Ga0318522_10108967 | Not Available | 1029 | Open in IMG/M |
| 3300031894|Ga0318522_10373223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 540 | Open in IMG/M |
| 3300031897|Ga0318520_11050307 | Not Available | 515 | Open in IMG/M |
| 3300031910|Ga0306923_10674732 | Not Available | 1153 | Open in IMG/M |
| 3300031941|Ga0310912_10351430 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1145 | Open in IMG/M |
| 3300031945|Ga0310913_11050336 | Not Available | 570 | Open in IMG/M |
| 3300031946|Ga0310910_10129701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1908 | Open in IMG/M |
| 3300031947|Ga0310909_10502217 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
| 3300032009|Ga0318563_10108988 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1468 | Open in IMG/M |
| 3300032009|Ga0318563_10196475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1087 | Open in IMG/M |
| 3300032009|Ga0318563_10782857 | Not Available | 511 | Open in IMG/M |
| 3300032039|Ga0318559_10052614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 1709 | Open in IMG/M |
| 3300032039|Ga0318559_10079405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1426 | Open in IMG/M |
| 3300032039|Ga0318559_10587504 | Not Available | 519 | Open in IMG/M |
| 3300032041|Ga0318549_10074875 | Not Available | 1442 | Open in IMG/M |
| 3300032043|Ga0318556_10097003 | Not Available | 1489 | Open in IMG/M |
| 3300032043|Ga0318556_10147688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1212 | Open in IMG/M |
| 3300032055|Ga0318575_10285869 | Not Available | 834 | Open in IMG/M |
| 3300032059|Ga0318533_10478661 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300032059|Ga0318533_10772771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 705 | Open in IMG/M |
| 3300032066|Ga0318514_10479283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 662 | Open in IMG/M |
| 3300032067|Ga0318524_10142365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1209 | Open in IMG/M |
| 3300032067|Ga0318524_10294849 | Not Available | 838 | Open in IMG/M |
| 3300032068|Ga0318553_10053891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1986 | Open in IMG/M |
| 3300032068|Ga0318553_10327006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Dermatophilaceae → Piscicoccus → Piscicoccus intestinalis | 802 | Open in IMG/M |
| 3300032089|Ga0318525_10577071 | Not Available | 574 | Open in IMG/M |
| 3300032090|Ga0318518_10314742 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300032091|Ga0318577_10311017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 754 | Open in IMG/M |
| 3300032091|Ga0318577_10567634 | Not Available | 540 | Open in IMG/M |
| 3300032094|Ga0318540_10388821 | Not Available | 674 | Open in IMG/M |
| 3300032205|Ga0307472_100904766 | Not Available | 817 | Open in IMG/M |
| 3300032261|Ga0306920_100441580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1933 | Open in IMG/M |
| 3300032261|Ga0306920_100930968 | Not Available | 1269 | Open in IMG/M |
| 3300032770|Ga0335085_11418059 | Not Available | 727 | Open in IMG/M |
| 3300032895|Ga0335074_10787082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 892 | Open in IMG/M |
| 3300033134|Ga0335073_11944171 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300033158|Ga0335077_10803335 | Not Available | 958 | Open in IMG/M |
| 3300033158|Ga0335077_11376496 | Not Available | 681 | Open in IMG/M |
| 3300033289|Ga0310914_11565386 | Not Available | 563 | Open in IMG/M |
| 3300033290|Ga0318519_10066836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → unclassified Micromonospora → Micromonospora sp. Llam0 | 1852 | Open in IMG/M |
| 3300033290|Ga0318519_11030452 | Not Available | 512 | Open in IMG/M |
| 3300033805|Ga0314864_0141178 | Not Available | 609 | Open in IMG/M |
| 3300034818|Ga0373950_0006982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus | 1740 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 38.13% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.35% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.68% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.68% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.01% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.01% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.68% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.68% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.01% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.01% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.01% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.67% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.67% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.34% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.34% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.00% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.00% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.00% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.67% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.67% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.67% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.67% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.33% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.33% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.33% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.33% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.33% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.33% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.33% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.33% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.33% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.33% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.33% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.33% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.33% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.33% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.33% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.33% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006572 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300010867 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
| 3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025576 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025588 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025625 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026217 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes) | Environmental | Open in IMG/M |
| 3300027072 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027172 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF038 (SPAdes) | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028801 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300028813 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_3 | Environmental | Open in IMG/M |
| 3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029917 | I_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029952 | II_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030646 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030688 | II_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031671 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-1 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033805 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10 | Environmental | Open in IMG/M |
| 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1161164891 | 3300000956 | Soil | MTGWYAQRTPDRSAKAMIAVTLLAMLLVAAVPVALLAAVVM |
| JGI12635J15846_103375501 | 3300001593 | Forest Soil | MTGWYAERTPDRSAKAVIAVTMLALLLVAAVPVALLAGVVMMMLG |
| Ga0062389_1046505861 | 3300004092 | Bog Forest Soil | MTGWYAERTPDRSAKAMIAVTLLALLLVAAVPVALLAAVVMMMLG |
| Ga0066398_100440591 | 3300004268 | Tropical Forest Soil | VVTGWYVERTPDRSAKAVIAVTLLALLLVAVVPVALLAGVV |
| Ga0070690_1017432531 | 3300005330 | Switchgrass Rhizosphere | MTGWYAERTPDVPAKAMIAVTLLALLLVTAVPVALLAAVIMMM |
| Ga0066388_1000584341 | 3300005332 | Tropical Forest Soil | MTGWFAERAPGRSATAMIAVMLLALLLVAAVPVALLAAVV |
| Ga0066388_1049897991 | 3300005332 | Tropical Forest Soil | MTGWYAEPTLDKPAKAVMAVMVLALLLVAAVPVALLAAVV |
| Ga0066388_1076517672 | 3300005332 | Tropical Forest Soil | MTGWYAERTADRPAKAMIAVTLLALLLVAAVPVALLAAVIM |
| Ga0008090_152960632 | 3300005363 | Tropical Rainforest Soil | MTGWYAEPSLDRPAKAMIAVMLLALVLVAAVPVALLAAVVMM |
| Ga0070709_106756511 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MTGWYAQRRPDGSAKTVIAMALLALLLVAAVPVALLAGVVMV |
| Ga0070709_114825402 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MTGWYAERTPDRSAKAMIAVTLLALLLVAAVPVALLAAVVMM |
| Ga0070713_1002120973 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MTGWYAQRRPDGSAKTVIAMALLALLLVAAVPVALLAGVVMVL |
| Ga0070698_1012826101 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MTGWYAQQMPGRSAKAVIAVTLLALLLVAAVPVALLAGVVMM |
| Ga0070733_102017291 | 3300005541 | Surface Soil | MTGWYAESRPDRSGKFMVAVTVLALALVGLLPLALL |
| Ga0070665_1002824934 | 3300005548 | Switchgrass Rhizosphere | MTGWYAERAPGRSALAMIAVMLLALLLVAAVPVALLA |
| Ga0070761_111051142 | 3300005591 | Soil | MTGWYAERTPDRSGKAVIAVTLLALLLVAAVPVGLLAAVVMMMLGHVVGG |
| Ga0070762_106932902 | 3300005602 | Soil | MTGWYAERTPARSAKAVIGVTMLALVLVAAVPVALLAAV |
| Ga0070763_108673872 | 3300005610 | Soil | MMTIGNAEPMPDRSAKAVITLTLLALLLVAAVPVALLAGVVVML |
| Ga0068859_1006022911 | 3300005617 | Switchgrass Rhizosphere | MTGWYAERTPDVPAKAMIAVTLLALLLVTAVPVALLAAVIMIML |
| Ga0066903_1058018412 | 3300005764 | Tropical Forest Soil | MTVWYAERMPDRSAKVMIAVTLLALLLVAAVPVALLAGVIIMMLG |
| Ga0070766_102856452 | 3300005921 | Soil | MTGWYAERGPGRSARAMIAVMLLALLLVAAVPVALLA |
| Ga0070717_104807962 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MTGWYAERTPDRSAKAMIAVTLLALLLVAAVPVALLAAVVMMILGYV |
| Ga0070717_108916011 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MTGWYAQRRPDWSGRAVIAMTLLALLLVAAVPVALLAGVVMVL |
| Ga0075023_1006234072 | 3300006041 | Watersheds | MTDWYAERTPDRSAKAVIAVSLLALLLVAAVPVALLAGVVMMMLG |
| Ga0075017_1000365968 | 3300006059 | Watersheds | MTDWHAERTPARSGKAMIAVTLLALGLVAAVPVALLA |
| Ga0075017_1008455451 | 3300006059 | Watersheds | MTDWYAERTPDRSAKAVIAVSLLALLLVAAVPVALLAGVVMMMLGHV |
| Ga0070716_1004715961 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MTGWYAERAPGRSALAMIAVMLLALLLVAAVPVAL |
| Ga0075014_1009758221 | 3300006174 | Watersheds | MTDWYAERTPDRSAKAVIAVSLLALLLVAAVPVALLAGVVMM |
| Ga0070765_1000426576 | 3300006176 | Soil | MTGWHAEQTPGRSAKAVIIVTLLALLLLTAVPVALLAA |
| Ga0074051_100084303 | 3300006572 | Soil | MTGWYAERTPDRPAKAMIAVTLLALLLVAAVPVALLA |
| Ga0079222_106346423 | 3300006755 | Agricultural Soil | MTRWYTERMPNRSAKAVIAVTLLALLLVAAVPLALLAG |
| Ga0075426_101311901 | 3300006903 | Populus Rhizosphere | MMTSWHAERSPDGSARAVIAMTLLALLLVAAVPVALLAAVVMMAIG |
| Ga0075424_1021225903 | 3300006904 | Populus Rhizosphere | MTKWYTERMPNRSAKAVIAVTLLALLLVAAVPVALLAGVVMM |
| Ga0075436_1015444641 | 3300006914 | Populus Rhizosphere | MTGWYAERTPDRPAKVMIAVTLLALLLVAAVPVSL |
| Ga0079219_115994753 | 3300006954 | Agricultural Soil | MTGWYAARTPDRSAKAMIAVTLLALLLVAAVPVALLA |
| Ga0079219_116750382 | 3300006954 | Agricultural Soil | MTGWYAERTPDGPAKAMIAVTLLALLLVAAVPVALLA |
| Ga0099829_102338502 | 3300009038 | Vadose Zone Soil | MTGWYAERTPDRPAKAMIAVTLVALLLVAAVPVALLAAAVMMMLG |
| Ga0099830_113102251 | 3300009088 | Vadose Zone Soil | MTGWYAERTPDRSAKAMIAVTLLALLLVAAVPAALLAAVVMMILGYVVG |
| Ga0066709_1012990111 | 3300009137 | Grasslands Soil | MTGWYAERSPGRPARAVIAVTLLALPLVAAVPVVLL |
| Ga0116218_12340272 | 3300009522 | Peatlands Soil | MTGWYAEQTPDRSAKAVIAVTLLALLLVAAVPVALL |
| Ga0105238_128767812 | 3300009551 | Corn Rhizosphere | MTRWYTERMPNRSAKAVIAVTLLALLLVAAVPVALLA |
| Ga0116105_11804291 | 3300009624 | Peatland | MTGWYGQRTPDRSAKAVIAVTLLALLLVAAVPLALLTGVVMMMLGHVVGGL |
| Ga0116216_103710681 | 3300009698 | Peatlands Soil | MTDWHEERTPRRSAKAVIAVTLLALLLLTAVPVAL |
| Ga0116217_104202781 | 3300009700 | Peatlands Soil | MTGWYAERTPDRSARAVIAVTLLALLLVAAVPVALL |
| Ga0116134_10730751 | 3300009764 | Peatland | MTGWYAERMPDRPARAVIAVTLLALLLVAAVPVALLAAVVMMM |
| Ga0126374_102157692 | 3300009792 | Tropical Forest Soil | MMTGWHAERTPDRPAKAMIAVTLLALLLVAAVPVALLAAVVMM |
| Ga0126380_100115591 | 3300010043 | Tropical Forest Soil | MTAWYAQRAPDRPTKAMIAVTLLALLLVAAVPVAL |
| Ga0126380_107381211 | 3300010043 | Tropical Forest Soil | MTSWYAERAPDRPAKAMVALTLLALLLVAAVPVALLAAVVMM |
| Ga0126384_118623001 | 3300010046 | Tropical Forest Soil | MTGWYAERTPGRPAKAAIAMTLLALLLVAAVPVALLAAVVMMMLGYVVGG |
| Ga0126373_100701705 | 3300010048 | Tropical Forest Soil | MMTGWYAERTPGRSAKAMIAVMLLALLLVAAVPLALLAAV |
| Ga0126373_102768113 | 3300010048 | Tropical Forest Soil | MTGWYAERTPDRSAKTMIAVTLLALLLVAAVPVALLAA |
| Ga0126373_104554071 | 3300010048 | Tropical Forest Soil | MTGWYAERMPDRSAKAMIGVTLLALLLVAAVPVALLAGVVIMM |
| Ga0126373_117759252 | 3300010048 | Tropical Forest Soil | MTGWYAERTPDRSARVVIAVTLLALLLVAAVPVALLAGVV |
| Ga0126373_119027322 | 3300010048 | Tropical Forest Soil | MTGWYAERRPDRSARAMIAVTLLALLLVAAVPVALLA |
| Ga0126373_121446931 | 3300010048 | Tropical Forest Soil | MTGWYAERTDGRSGKAVIAVTLLALLLVAAVPVALLA |
| Ga0126370_122974971 | 3300010358 | Tropical Forest Soil | MTGWYAQRTPDRSAKAVIAVTLLALLLVAAVPVALLAGV |
| Ga0126376_111405961 | 3300010359 | Tropical Forest Soil | MTGWYAERAPDRRAKAMIAMTLLALLLVAAVPVALLAA |
| Ga0126372_106848793 | 3300010360 | Tropical Forest Soil | MTGWYAERTTDRSAKAMFAVTLLALLLVAAVPVALLAAVVMMLLGYVA |
| Ga0126372_113550913 | 3300010360 | Tropical Forest Soil | MMTGWYAERTPNRSAKAVSAVTLLALLLVATVPVALL |
| Ga0126372_123217221 | 3300010360 | Tropical Forest Soil | MTGWYAERTPDRSTKVVIAVTLLALLLVAAVPVALLA |
| Ga0126378_104718591 | 3300010361 | Tropical Forest Soil | MTGWYAKRTPDRSAKTVIAVTLLALLLVAAVPVALLA |
| Ga0126378_113895152 | 3300010361 | Tropical Forest Soil | VSVMAVWHAERTPDRSARAVIAVTLLALLLVAAVPVALLAGVVMMMLGHV |
| Ga0126379_135886751 | 3300010366 | Tropical Forest Soil | MTGWYAEQTTDRSAKAMIAVTLLALLLVAAVPVAL |
| Ga0126381_1008499471 | 3300010376 | Tropical Forest Soil | MTGWYVERTPDRSAKAVIAVTLLALLLVAVVPVALLAGVVL |
| Ga0126381_1017188972 | 3300010376 | Tropical Forest Soil | MTGWYAERMPDRSTKAMIAVTLLALLLVAAVPVALL |
| Ga0126381_1024966471 | 3300010376 | Tropical Forest Soil | VSVVTGWYVERMPDRSAKAVIAVTLLALLLVAVVPVALLAGMVLMMLGHVAG |
| Ga0136449_1026595531 | 3300010379 | Peatlands Soil | MTGWYAERTPDRSAKAVIAVTLLALLLVAAVPVALLAGVVM |
| Ga0134123_122025152 | 3300010403 | Terrestrial Soil | MTGWYAERTPDVPAKAMIAVTLLALLLVTAVPVALLAAVIMMMLGYV |
| Ga0126347_14888432 | 3300010867 | Boreal Forest Soil | MTGWYAERMPGRSAKAMIAVTLLALLLVAAVPVALLA |
| Ga0126350_122202721 | 3300010880 | Boreal Forest Soil | LRGERDAGWYAERTPGRPAKAVIAVTLLALLLVAAVPVALLAAVV |
| Ga0137388_105485601 | 3300012189 | Vadose Zone Soil | MTGWYAKRTPDRSAKAVIDVTQLELQLVAAVPVALLPGSIMMLLGH |
| Ga0137364_104497061 | 3300012198 | Vadose Zone Soil | MTSWYAERTPDRPAKAMIAVTLLALLLVAAVPVALLAA |
| Ga0137381_108650241 | 3300012207 | Vadose Zone Soil | MTGWHAERTPDRPARAMIAVTLVALLLVAAVPVALL |
| Ga0137378_106938942 | 3300012210 | Vadose Zone Soil | MTGWYAERTPDRSAKAMIAVTLLALLLVAAVPVALLAAVVLMMLG |
| Ga0137378_118137371 | 3300012210 | Vadose Zone Soil | MTGWYAERIPDRPAKAVIAVTLLALLLVAAVPVVLLAGVVMM |
| Ga0137377_111526331 | 3300012211 | Vadose Zone Soil | MTGWYAGRMPGRSAKAVIAVILLALLLVAAVPVAL |
| Ga0137372_107474932 | 3300012350 | Vadose Zone Soil | MTGWYAERTPDRPAKAMIAVTLVALLLVAAVPVALLAAVVMM |
| Ga0137385_107828561 | 3300012359 | Vadose Zone Soil | MMTGWYAERTPDRSAKAVIAVTLLALLLVAAVPVAL |
| Ga0137361_107642941 | 3300012362 | Vadose Zone Soil | MMTGWYAERTPDRSAKAMIAVTLLALLLVAAVPVA |
| Ga0137390_102780111 | 3300012363 | Vadose Zone Soil | MTGWYAERTPDRPAKAMIAVTLVALLLVAAVPVALLAAV |
| Ga0137407_100316331 | 3300012930 | Vadose Zone Soil | MTGWYAERTPDRPAKVMIAVTLVALLLVADVPVAL |
| Ga0164307_114861583 | 3300012987 | Soil | MTGWYAERASGRSAKAMIVVMLLALLLVAAVPVALLAAVVM |
| Ga0181524_101194341 | 3300014155 | Bog | MTGWYAERMPDRPARAVIAVTLLALLLVSAVPVALLAAV |
| Ga0181522_100613151 | 3300014657 | Bog | MTRWYAERVPNRSARGVIAVTLLALLLVAAVPLALLAG |
| Ga0132258_112240531 | 3300015371 | Arabidopsis Rhizosphere | MTGWYAERTPDGPAKAMIAVTLLALLLVAAVPVALLAAVVMMMLGYV |
| Ga0132256_1012128631 | 3300015372 | Arabidopsis Rhizosphere | MTSWYAERTPDRSAKVMIAVTLLALLLVAAVPVSLLAAVVMMM |
| Ga0182041_123363321 | 3300016294 | Soil | MTGWYVERTPNWSGKAVTAVTLLALLLVAAVPVALLAAV |
| Ga0182032_109717431 | 3300016357 | Soil | MTGWYVERTPDRSAKVVIATTLLALLLVAAVPVALLAGVVIMMLGHV |
| Ga0182040_101000363 | 3300016387 | Soil | MTGWYVERMPDRSAKVVIATTLLALLLVAAVPVALLAGVVIMMLGH |
| Ga0182039_103508043 | 3300016422 | Soil | MTGWYVERTPDRSAKAVMAATLLALLLVAVVPVALLAGVVMMVLG |
| Ga0182038_108803682 | 3300016445 | Soil | MTGWYAERTPDRTAWAVIAVTLVALLLVAAVPVALLAG |
| Ga0187806_10293972 | 3300017928 | Freshwater Sediment | MTDWYAGRTPDRSTKAVIAVTLLALLLVAAVPVALLA |
| Ga0187814_101740081 | 3300017932 | Freshwater Sediment | MTGWHAERTPGRSAKAVIAVTLLALLLLTAVPVALLAAVIMM |
| Ga0187814_104349741 | 3300017932 | Freshwater Sediment | MTGWYADRTPDRSAKAVIAATLLALLLVASLPVALLAGVVMMMLGHVVGGL |
| Ga0187821_104282981 | 3300017936 | Freshwater Sediment | VSVMTGWYAERMPNRSAKAVIVVTLLALLLVAAVPVA |
| Ga0187809_104003621 | 3300017937 | Freshwater Sediment | MMTVWYAERTPDRSAKAMIAVTLLALVLVAVVPVALLAGVVM |
| Ga0187854_100620263 | 3300017938 | Peatland | MTGWYAERMPDRPARAVIAVTLLALLLVAAVPVALLA |
| Ga0187879_101786672 | 3300017946 | Peatland | VSVTTGWYAERTPGRSATAVIAMTLLALLLVATVHS |
| Ga0187779_108064821 | 3300017959 | Tropical Peatland | MTGWYAERTPDRSGRAVIAVALLAMLLVAAVPAALLAAV |
| Ga0187782_113133571 | 3300017975 | Tropical Peatland | MTVWYAERTPDRSARGVIAVTLLALLLVAAVPVALLAGVVMMMLGHV |
| Ga0187782_115342632 | 3300017975 | Tropical Peatland | MTGWYTERTPDRSAKAVIAVTLLALLLVAAMPVAL |
| Ga0187816_102521281 | 3300017995 | Freshwater Sediment | MTGWYAERTPDGSAKAVIAVTLLALLLLAAMPVALLAGVVMM |
| Ga0187805_103972741 | 3300018007 | Freshwater Sediment | MTGWHAERTPDRSARAVIALTLLALLLVAAVPVALLAAV |
| Ga0187880_14421851 | 3300018016 | Peatland | MTGWYAERTPDRSAKAMIAVTLLALMLVAAVPVALLAAVVMMMLGYV |
| Ga0187787_104628671 | 3300018029 | Tropical Peatland | VSVMTGWYAERTPDRPAKVMIAVMLLALLLVAAVPVALLAAVV |
| Ga0187867_103480461 | 3300018033 | Peatland | MTGWYAERTLDRSARAMIAVTLLALLLVAAVPVALLAAVVMMMLGY |
| Ga0187863_101769803 | 3300018034 | Peatland | MTGWYAERTPDRQAKAVIAVTLLALLLVAAVPVALLAGVVMMMLG |
| Ga0187883_105227501 | 3300018037 | Peatland | MTGWYAERTPDRSAKAVVAVTLLALLLVAAVPVAL |
| Ga0187883_105301071 | 3300018037 | Peatland | MNGWYAERAPGRPARAVIAVTLLALLLVAAVPVALL |
| Ga0187890_107512692 | 3300018044 | Peatland | MTGWNPERTPGRSAKALIALTLLALLLVAAVPVALL |
| Ga0187766_106336181 | 3300018058 | Tropical Peatland | MTGWYAERTPDRSARAVTAVTLLALLLVAAVPVALLAAVVMMTL |
| Ga0187766_109662311 | 3300018058 | Tropical Peatland | MTGWHAERTPGRSAKAVIAVTLLALLLLTAMPVALLAAAIMMILGHVVG |
| Ga0187784_113109541 | 3300018062 | Tropical Peatland | MTGWYAERTPDRSAKTVIVLTLLALLLVAAVPVAL |
| Ga0187772_100730864 | 3300018085 | Tropical Peatland | MTGWYAERTPDRSARAVIAMTLLALLLVAAVPVALLAAVV |
| Ga0187772_114749022 | 3300018085 | Tropical Peatland | MTGWYAERTSDRSAKAVIAVTLLALLLVAAVPVALLAGVVMMMLG |
| Ga0193751_11586253 | 3300019888 | Soil | MTGWYAERTPDRPAKAMIAVTLVALLLVAAVPVAL |
| Ga0210382_104064262 | 3300021080 | Groundwater Sediment | MTGWYAERTPDRPAKAMIAVTLVALLLVAAVPVACWPQWS |
| Ga0210404_105980141 | 3300021088 | Soil | MTGWYAERTPDRSAKAVIAVTLLALLLVAAVPVALLAGVVLI |
| Ga0210388_109359921 | 3300021181 | Soil | MTGWHEEGMPGRSARAVIVVTLLALLLVAAVPVALLAAVI |
| Ga0210389_104589981 | 3300021404 | Soil | MMTNWYTERMPGRSGKAVIAVTLLALLLVAAVPLALLA |
| Ga0210389_107849841 | 3300021404 | Soil | MTGWRADRTAGRSAKAVIVLTLLALLLLTAVPVALLAAV |
| Ga0210389_114766302 | 3300021404 | Soil | MTRWYAERMPDRSARAVIAVALLALLLVAAVPVALLAGLILMV |
| Ga0210386_117421831 | 3300021406 | Soil | MTCWYAERTPGRSAKAMIALTLLALLLVAAVPIALLAAVVMM |
| Ga0210383_103401663 | 3300021407 | Soil | MTGWYTERTSDRSAKAVVAVTLLALLLVAAVPVALLAGAL |
| Ga0210392_107093462 | 3300021475 | Soil | MMTNWYTERMPGRSGKAVIAVTLLALLLVAVVPLALLAGLFLM |
| Ga0126371_123024682 | 3300021560 | Tropical Forest Soil | MTVWYAERMPDRSAKVMIAVTLLALLLVAAVPVALLAGVIIMMLGN |
| Ga0126371_123474842 | 3300021560 | Tropical Forest Soil | MMTGWYAERTPDRPAKAMIAVTLLALLLVATVPVALLAAVIM |
| Ga0208820_10390423 | 3300025576 | Peatland | MTGWYAERMPDRPARAVIAVTLLALLLVAAVPVALLAAVVM |
| Ga0208586_10999301 | 3300025588 | Arctic Peat Soil | MMTGWYAERMPGRSAKAMIAVTLLALLLVAAVPVALLAAVV |
| Ga0208586_11156301 | 3300025588 | Arctic Peat Soil | MTGWYAGRTPGRSAKAMIAVTLLALLLVAAVPVALLA |
| Ga0208219_10006949 | 3300025625 | Arctic Peat Soil | MTGWYAERTPDRSAKAMIAVTLLALLLVAAVPVALLAAVVMMMLGYVAGG |
| Ga0207646_103890772 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MMTDWYAERTPGRPAKAMIAVTLLALLLVAAVPVALLA |
| Ga0207646_107004531 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MTGWYVERAPDRPAKAVIAVTLLALLLVAAVPMAL |
| Ga0207664_108596152 | 3300025929 | Agricultural Soil | MTGWYVERTPNRSAKAVTAVTLLALLLVAVVPVALLAAVAMMMLG |
| Ga0207674_119597592 | 3300026116 | Corn Rhizosphere | MTGWYAERTPDRSAKAMIAVTLLALLLVAAVPVALLA |
| Ga0209871_10754702 | 3300026217 | Permafrost Soil | MTSWYGEQAAGRPAKAMIAVTLLALLLVAAVPVALLAAVVMM |
| Ga0208238_10132891 | 3300027072 | Forest Soil | MTSWYAERTPDRSAKAMIAVMFLALLLVAAVPVALLAAVVM |
| Ga0208098_10292231 | 3300027172 | Forest Soil | MTGWYAERRPDRSAKAVIAVTLLALLLVAALPVALLAAV |
| Ga0209466_10953052 | 3300027646 | Tropical Forest Soil | MTGWYAQRAPDRPTKAMIAVTLLALLLVAAVPVALLAA |
| Ga0209333_11451562 | 3300027676 | Forest Soil | MTDWYVERTPDRSGKAVIAVTIFALLLVAAVPVALLA |
| Ga0209448_101337973 | 3300027783 | Bog Forest Soil | MTGWYAERTPDRSAKAVIAVTLLALLLVAAVPVALMAGVVMM |
| Ga0209517_100233551 | 3300027854 | Peatlands Soil | MTGWYAERTPDRSARAVIAVTLLALLLLLVAAVPVALLAGVVMM |
| Ga0209167_107270962 | 3300027867 | Surface Soil | MTGWYAESRPDRSGKFMVAVTVLALALVGLLPLALLAGVIV |
| Ga0209380_102517921 | 3300027889 | Soil | MTRWYADRTPERSARSVIAVALLALLLVAAMPVALLAAVIM |
| Ga0209624_101801212 | 3300027895 | Forest Soil | MMTNWYTERMPGRSGKAVIAVTLLALLLVAAVPLALLAGLFL |
| Ga0209624_110452932 | 3300027895 | Forest Soil | VTDLRAERTSDRSAKAVITVTLLALVLVAAVPVAA |
| Ga0209488_103062663 | 3300027903 | Vadose Zone Soil | MTGWHAERMPGRSAKAVIAVTLLALLLVAAVPVALLAA |
| Ga0307280_102608492 | 3300028768 | Soil | MTSWYAERPDRPAKAMIAVMLLALLLVAAVPVALLA |
| Ga0302232_104331432 | 3300028789 | Palsa | MTGWYAERTPGRSARAVIAVTLLALLLVAAVPVALLA |
| Ga0302226_101141952 | 3300028801 | Palsa | VSVMTGWYVERTPDRSARAVIAVTVLALLLVAAVPV |
| Ga0302157_100987001 | 3300028813 | Bog | MTGWYVERTPDRSAKAVIAVTLLALLLVAAVPLALL |
| Ga0302229_100787121 | 3300028879 | Palsa | MTGWYAERTPDRPAKAVIAVTLLALLLVAAVPVALLAAVV |
| Ga0308309_100439251 | 3300028906 | Soil | MTGWHEEGMPGRSARAVIVVTLLALLLVAAVPVALLA |
| Ga0308309_102713591 | 3300028906 | Soil | MTGWHAEQTPGRSAKAVIIVTLLALLLLTAVPVALLA |
| Ga0311368_107012861 | 3300029882 | Palsa | MTGWYAERTPGRSAKAVIGVTLLALLLVAAVPLALLAGMVL |
| Ga0311326_102177212 | 3300029917 | Bog | MTGRYAERTLDRSAKAVIAVTLLALLLVAAVPVALLAGVVMMMLG |
| Ga0311340_105418921 | 3300029943 | Palsa | MTDWYVERTPDRSGKAVIAVTLLAVLLVAAVPVALLA |
| Ga0311346_101388771 | 3300029952 | Bog | MTGWYVERTPDRSAKAVIAVTLLALLLVAAVPLALLAGVVIM |
| Ga0311339_116794021 | 3300029999 | Palsa | MNGWYAERRPDRSAKAVIAVTLLALLLVAAVPVALLAGVV |
| Ga0302178_101301061 | 3300030013 | Palsa | MTDWYTERSSTRSAKAVIAVSLLALLLVAAVPVALLA |
| Ga0302177_100236418 | 3300030053 | Palsa | MMGWYGERTPDRSAKAVIAVTLLALLLVAAVPAALLAGVVMMMLGHVVGGLAL |
| Ga0302177_106561361 | 3300030053 | Palsa | MNGWYAERRPDRSAKAVIAVTLLALLLVAAVPVALLAGVVIMALGHV |
| Ga0302182_101806562 | 3300030054 | Palsa | MTGWHAERTPGRPARAMIAVTLLALLLVAAVPVALLAAVVMMMLGYV |
| Ga0311372_1000836224 | 3300030520 | Palsa | MMTGWYAERTPGRSAKALIAVTLLALLLVAAVPVA |
| Ga0302316_103586281 | 3300030646 | Palsa | MTGRYAERTLDRSAKAVIAVTLLALLLVAAVPVALLAGVVMMILGHVA |
| Ga0311345_105513412 | 3300030688 | Bog | MTGRYAERTLDRSAKAVIAVTLLALLLVAAVPVALLAGVVMMILG |
| Ga0302307_106443242 | 3300031233 | Palsa | MMGWYGERTPDRSAKAVIAVTLLALLLVAAVPAALLAGV |
| Ga0302324_1004827303 | 3300031236 | Palsa | MMTGWYAERTPGRSAKALIAVTLLALLLVAAVPVALLAGVVMMLLGHV |
| Ga0318516_103915842 | 3300031543 | Soil | MTVWYADRTAGRPARAMIGVTLLALLLVAAVPVALLAAVVMMMLGYVVGGLAV |
| Ga0318534_101933831 | 3300031544 | Soil | MTVWYAERMPDRPAKTMIAVTLLALLLVAAVPVALLAA |
| Ga0318534_107339791 | 3300031544 | Soil | MTGWYAERMPDRPAKAMIAVTLLALLLVAAVPVALLAAVVIMML |
| Ga0318534_107738291 | 3300031544 | Soil | VSVMTGWYAERTPDRSAKALIAVTLIALLLVAAVPVALQA |
| Ga0318538_102544471 | 3300031546 | Soil | VVTSWYVERTPDRWAKAVIAVTLLALLLVAAVPVALLAGVVMMML |
| Ga0318538_107694182 | 3300031546 | Soil | MTVWYAERTPGRPARAMIAVTLLALLLVAAVPVALLAAVVMMMLGY |
| Ga0318571_100689962 | 3300031549 | Soil | MTGWYLERTPGRPATAVIAATLLALVLVALVPVALLAAVAMM |
| Ga0318528_101558552 | 3300031561 | Soil | VVTSWYVERTPDRWAKAVIAVTLLALLLVAAVPVALLAGVVM |
| Ga0318528_102054891 | 3300031561 | Soil | MTSWYVERTPDRSAKAVIVATLLALLLVAVVPVALLAGVVM |
| Ga0318573_106633471 | 3300031564 | Soil | MTGWYVEQTPNRPAKAVVAATLLALLLVAVVPVALLAGVVMMMLGHVIG |
| Ga0318515_100471921 | 3300031572 | Soil | MTGWYAERTPDRSAKAVIAVTLLALLLVAAVPVALLAGVVMML |
| Ga0318515_100828563 | 3300031572 | Soil | MTGWYVERMPDRSAKVVIATTLLALLLVAAVPVALLA |
| Ga0310915_101731082 | 3300031573 | Soil | MTGWYAERTPDRSARIMTALALLALVLVAAVPVALLAAVVM |
| Ga0310915_108170331 | 3300031573 | Soil | VSVVTGWYVERTPDRWAKAMIAVTLFALLLVAAVPVALL |
| Ga0307372_103352702 | 3300031671 | Soil | MTGWHAERTPGRSAKAVIAVTLLALLLVTAVPVAL |
| Ga0318561_108198712 | 3300031679 | Soil | MTGWYAERTPDRTAWAVIAVTLVALLLVAAVPVALLAGVVM |
| Ga0318574_100641674 | 3300031680 | Soil | MTGWHAERAPDRPATAVIAVTLLALLLVAAVPVALLAGMVLV |
| Ga0318574_102047031 | 3300031680 | Soil | MTGWYAERTPDRSAKAVIAVTLLALLLVAAVPVALLAGVV |
| Ga0318572_103236192 | 3300031681 | Soil | VSVVTSWYVERTPDRWAKAVIAVTLLALLLVAAVPVALLAGVVMMMLG |
| Ga0318572_108467101 | 3300031681 | Soil | VSVMTGWYAERMPDRPARAVTAVTLLALLLVAAVPVALLAA |
| Ga0318560_100408653 | 3300031682 | Soil | MTGWYMERTPNRSAQAVIAVTLLALLLVAVVPVALLAGVVMM |
| Ga0318560_102142281 | 3300031682 | Soil | MTGWYVEQTPNRPAKAVVAATLLALLLVAVVPVALLAGVV |
| Ga0318560_103836081 | 3300031682 | Soil | MTGWYVERMPDRSAKVVIATTLLALLLVAAVPVALLAG |
| Ga0310686_1050810001 | 3300031708 | Soil | MTGWYAERTPDRSAKAVIAVTLLALLLVAAVPVALLAGVVIMMLG |
| Ga0310686_1062383351 | 3300031708 | Soil | MTGWYAERTPDRSAKAVIAVTLLALLLVAAVPVALLA |
| Ga0310686_1062914171 | 3300031708 | Soil | MTGWYAERTPGRSAKAVIAVMLLALLLVAAVPVAL |
| Ga0318496_108507391 | 3300031713 | Soil | MTGWYAEQTSDRSAKAVIAVTLLALLLVAIVPLALLAGVVMMILG |
| Ga0307476_101947544 | 3300031715 | Hardwood Forest Soil | MTGWYAQRTPDRSARAVIVVTLLALLLVAAVPVAL |
| Ga0307476_103132611 | 3300031715 | Hardwood Forest Soil | MMTGWYAKRAPDRSGKAVIAVTLLALLLVAAVPVALLAGLV |
| Ga0306917_101147164 | 3300031719 | Soil | MTVWYADRTAGRPARAMIGVTLLALLLVAAVPVALLAAVVMMMLGYV |
| Ga0306917_101861663 | 3300031719 | Soil | MTGWYLERTPGRPATAVIAATLLALVLVALVPVALLAAVAMMVLG |
| Ga0318493_107109811 | 3300031723 | Soil | MTGWYVERTPGRPAIAVIAATLLALLLVAVVPVALLAGVV |
| Ga0318500_100612161 | 3300031724 | Soil | MTSWYVERTPDRSAKAVIVATLLALLLVAVVPVAL |
| Ga0306918_101674841 | 3300031744 | Soil | MTGWYVERTPDRSAKVVIATTLLALLLVAAVPVALLAGVVIMMLG |
| Ga0318492_102316642 | 3300031748 | Soil | VVTSWYVERTPDRWAKAVIAVTLLALLLVAAVPVALLAGVVMMMLG |
| Ga0318492_108191431 | 3300031748 | Soil | MMTGWYAERTPDRSAKAVIAMTLLALLLVAAVPLALLAAVIIM |
| Ga0318494_104074991 | 3300031751 | Soil | MTGWYAELMPDRPAKAVIAVTLLALLLVAAVPVALLAAVII |
| Ga0318494_108054591 | 3300031751 | Soil | MTGWYAEQTSDRSAKAVIAVTLLALLLVAIVPLAL |
| Ga0318535_100912121 | 3300031764 | Soil | VVTSWYVERTPDRWAKAVIAVTLLALLLVAAVPVALLAGVVMMM |
| Ga0318535_103125811 | 3300031764 | Soil | MTGWYAERTPDRSAKAVIAVTLLALLLVAAVPVAL |
| Ga0318554_100852134 | 3300031765 | Soil | MTGWYAERTPDRSAKAVIAVTLLALLLVAAVPVALLAGVVMMLLG |
| Ga0318509_100063755 | 3300031768 | Soil | MTGWYLERTPGRPATAVIAATLLALVLVALVPVAL |
| Ga0318509_103230491 | 3300031768 | Soil | MTSWYAERTPDRSAKAMIAVTLLALLLVAAVPVAL |
| Ga0318526_100457113 | 3300031769 | Soil | MTGWYVERTPDRSAKAVMAATLLALLLVAVVPVALLAGVVMMVLGHV |
| Ga0318521_105168471 | 3300031770 | Soil | MTGWHAERAPDRPTTAVIAVTLLALLLVAAVPVALLA |
| Ga0318521_109500591 | 3300031770 | Soil | MTGWYVERMPNRSAKAVIAATLLALLLVAVVPVALVAG |
| Ga0318546_100692133 | 3300031771 | Soil | MTGWYVERMPDRSAKVVIATTLLALLLVAAVPVALLAGVVI |
| Ga0318546_104840042 | 3300031771 | Soil | MTGWYMEQTPDRSARAVIAVTLLALLLVAAVPVALLAGVI |
| Ga0318546_108428282 | 3300031771 | Soil | MTGWYMERTPNRSAQAVIAVTLLALLLVAVVPVAL |
| Ga0318546_109301732 | 3300031771 | Soil | MTVWYAERMPDRPAKTMIAVTLLALLLVAAVPVALLAAVVIMMLG |
| Ga0318543_100579442 | 3300031777 | Soil | MTGWYAERTPDRSARIMTALALLALVLVAAVPVALLAAVVMM |
| Ga0318498_100797542 | 3300031778 | Soil | MTGWYAERTSDRSARAVIAVTLLALLLVAAVPVALLAAVVMMM |
| Ga0318498_101597892 | 3300031778 | Soil | MTGWYAERTPDRSARIMTALALLALVLVAAVPVALLAAVVMMMLG |
| Ga0318508_10538042 | 3300031780 | Soil | MTGWYAERTPDRSARIMTALALLALVLVAAVPVALL |
| Ga0318547_105066931 | 3300031781 | Soil | VSVMTGWYAERMPDRPARAVTAVTLLALLLVAAVPVALLAAVVMMLLGHVVG |
| Ga0318548_100058243 | 3300031793 | Soil | MTGWYAERMPDRPARAVTAVTLLALLLVAAVPVALLAAVVMML |
| Ga0318503_100117521 | 3300031794 | Soil | MTGWYAERTPDRSARIMTALALLALVLVAAVPVALLAAV |
| Ga0318503_101552122 | 3300031794 | Soil | MTGWYVERTPGRPAIAVIAATLLALLLVAVVPVALLAGVVM |
| Ga0318557_103576042 | 3300031795 | Soil | VSVMTGWYAERMPDRPARAVTAVTLLALLLVAAVPVALLAAVVMMLLG |
| Ga0318576_101055831 | 3300031796 | Soil | MTGWYVERTPGRPAMAVIAATLLALLLVAVVPVALLAG |
| Ga0318576_103423762 | 3300031796 | Soil | MTGWYLERTPGRPATAVIAATLLALVLVALVPVALLAAVAM |
| Ga0318576_104396562 | 3300031796 | Soil | MTVWYADRTAGRPARAMIGVTLLALLLVAAVPVALLAAVVMMMLG |
| Ga0318550_100337984 | 3300031797 | Soil | MTGWYVERTPDKSAKAVVAVTLLALLLVAVVPVAL |
| Ga0318550_100997812 | 3300031797 | Soil | MTGWYVERTPDRSAKVVIATTLLALLLVAAVPVALL |
| Ga0318550_104197391 | 3300031797 | Soil | MTGWYLERTPGRPATAVIAATLLALVLVALVPVALLAAVAMMV |
| Ga0318550_106180161 | 3300031797 | Soil | MTGWYAEQTSDRSAKAVIAVTLLALLLVAIVPLALLAGVVMMILGH |
| Ga0318523_101531162 | 3300031798 | Soil | VVTSWYVERTPDRWAKAVIAVTLLALLLVAAVPVALLAGVVMMMLGHVVG |
| Ga0318523_102305042 | 3300031798 | Soil | MTSWYAERTPDRSAKAMIAVTLLALLLVAAVPVALLAGVVM |
| Ga0318565_104463931 | 3300031799 | Soil | MTVWYAERMPVRSAKAVIAVTLLALLLVAVVPLALVAAV |
| Ga0318497_100071211 | 3300031805 | Soil | MTVWYAERAPDRPAKAMIAVTLLALVLVAAVPVALLAAVVMMM |
| Ga0318497_100553042 | 3300031805 | Soil | MTGWYAERTPDRSARIMTALALLALVLVAAVPVALLAAVVMMM |
| Ga0318568_105639021 | 3300031819 | Soil | MTGWYAERTPDRSAKAVIAVTLLALLLVAAVPVALLAGVVMM |
| Ga0318568_110042591 | 3300031819 | Soil | MTSWYVERAPNRPAMAVIAATLFALLLVAAVPVALLAAVVM |
| Ga0318567_107623081 | 3300031821 | Soil | MTGWYAERTPDRSAKAVIAVTLLALLLVAAVPVALLAG |
| Ga0318499_101686852 | 3300031832 | Soil | VSVVTSWYVERTPDRWAKAVIAVTLLALLLVAAVPVALLAGVVMMML |
| Ga0310917_103798081 | 3300031833 | Soil | MTSWYVERTPDRSAKAVIVATLLALLLVAVVPVALLAGVV |
| Ga0318517_102149352 | 3300031835 | Soil | MTVWYADRTAGRPARAMIGVTLLALLLVAAVPVALLAAVVM |
| Ga0318517_105668992 | 3300031835 | Soil | MTGWYAERTPDRSAKAVIAVTLLALLLVAAVPVALLAGVVMMLL |
| Ga0318527_102159341 | 3300031859 | Soil | MTSWYVERTPNWSAKAVTAMSLLALLLVAAVPVALLAAVAMMMLGHVVG |
| Ga0318527_103730712 | 3300031859 | Soil | MTGWYMEQTPDRSARAVIAVTLLALLLVAAVPVALLAGVIL |
| Ga0318495_103337001 | 3300031860 | Soil | VSVVTSWYVERTPDRWAKAVIAVTLLALLLVAAVPVALLAGVVMMMLGHVV |
| Ga0306919_101334261 | 3300031879 | Soil | MTGWYAERTPDRPARAVIAVTLVALLLVAAVPVALLAGVVM |
| Ga0306919_102047071 | 3300031879 | Soil | MTGWYVERTPGRPAIAVIAATLLALLLVAVVPVALLAG |
| Ga0306919_110330051 | 3300031879 | Soil | MTGWYVERTPGRPAMAVIAATLLALLLVAVVPVALLAGVVMMMLGH |
| Ga0306919_113219291 | 3300031879 | Soil | MTSWYVERTPDRSAKVVIAMTLLALLLVAAVPVALLAGVVMMMLG |
| Ga0306925_109931072 | 3300031890 | Soil | MTVWYAERAPDRPAKAMIAVTVLALVLVAAVPVALLA |
| Ga0318536_100980481 | 3300031893 | Soil | MTGWYAELMPDRPAKAVIAVTLLALLLVAAVPVALLAGVIIMM |
| Ga0318536_101727561 | 3300031893 | Soil | MTVWYAERAPDRPAKAMIAVTLLALVLVAAVPVALLAAVVM |
| Ga0318522_101089672 | 3300031894 | Soil | MTGWYAERTPDRSARIMTALALLALVLVAAVPVALLAAVVMMMLGY |
| Ga0318522_103732232 | 3300031894 | Soil | MTGWYAERMPDRSAKAVIAVTLLALLLVAAVPVALLAGVV |
| Ga0318520_110503071 | 3300031897 | Soil | MTGWYAEQTPDRPARAMTAMALLALLLVAAVPVALLAAVVMMMLGYVVGGLAL |
| Ga0306923_106747321 | 3300031910 | Soil | MTGWYVERMPNRSAKAVIAATLLALLLVAVVPVALVA |
| Ga0310912_103514303 | 3300031941 | Soil | MTGWHAERAPDRPTTAVIAVTLLALLLVAAVPVALLAGMV |
| Ga0310913_110503361 | 3300031945 | Soil | MTGWYAEQTSDRSAKAVIAVTLLALLLVAIVPLALLAGVV |
| Ga0310910_101297013 | 3300031946 | Soil | MTGWYVERTPGRPAIAVIAATLLALLLVAVVPVALLAGV |
| Ga0310909_105022172 | 3300031947 | Soil | MTVWYADGTAGRPARAMIGVTLLALLLLVAAVPVAL |
| Ga0318563_101089881 | 3300032009 | Soil | VVTSWYVERTPDRWAKAVIAVTLLALLLVAAVPVALLAGVVMM |
| Ga0318563_101964751 | 3300032009 | Soil | MTGWYVERTPGRPAIAVIAATLLALLLVAVVPVALLAGVVMMM |
| Ga0318563_107828571 | 3300032009 | Soil | MTSWYVERTPNWSAKAVTAMSLLALLLVAAVPVALLAAVAMMM |
| Ga0318559_100526141 | 3300032039 | Soil | MTGWYAERTPDRTAWAVIAVTLVALLLVAAVPVALLAGVVMMM |
| Ga0318559_100794053 | 3300032039 | Soil | MTGWYVERTPDRSAKAVMAATLLALLLVAVVPVALLA |
| Ga0318559_105875042 | 3300032039 | Soil | MTGWYVERTPDRSAKAVIALTLLALLLVAAMPVALVAGVVMM |
| Ga0318549_100748751 | 3300032041 | Soil | MTGWYLERTPGRPATAVIAATLLALVLVALVPVALLAAVAMMVLGH |
| Ga0318556_100970031 | 3300032043 | Soil | MTGWYVERMPNRSAKAVIAATLLALLLVAVVPVALVAGVVMM |
| Ga0318556_101476882 | 3300032043 | Soil | MTGWYAELMPDRPAKAVIAVTLLALLLVAAVPVALLAAVIIM |
| Ga0318575_102858691 | 3300032055 | Soil | MTGWYAERTLGRSAMGVIAVTLLALLLVAAVPVALLAGV |
| Ga0318533_104786613 | 3300032059 | Soil | MTVWYAERAPDRPAKAMIAVTMLALVLVAAVPVSLLAAV |
| Ga0318533_107727712 | 3300032059 | Soil | MTGWYVEQTANRSAKAVVAVTLLALLLVAVVPVALLAGVVM |
| Ga0318514_104792832 | 3300032066 | Soil | MTGWYVERTPNRSATAVTAVTLLALLLVAAVPVALLAAVAMMMLGHVV |
| Ga0318524_101423652 | 3300032067 | Soil | MTSWYVERTPDRSAKAVIVATLLALLLVAVVPVALLAG |
| Ga0318524_102948491 | 3300032067 | Soil | VSVMTGWYAERMPDRPARAVTAVTLLALLLVAAVPVAL |
| Ga0318553_100538914 | 3300032068 | Soil | MTGWYAERTPDRSAKAVIAVTLLALLLVAAVPVALL |
| Ga0318553_103270063 | 3300032068 | Soil | MTGWYAERTPDRSAKAVVAVTLLALLLVAAVPVALLAGV |
| Ga0318525_105770711 | 3300032089 | Soil | MTGWYVERTPNRSATAVTAVTLLALLLVAAVPVALLAAVAM |
| Ga0318518_103147421 | 3300032090 | Soil | MTVWYAERAPDRPAKAMIAVTLLALVLVAAVPVAL |
| Ga0318577_103110172 | 3300032091 | Soil | MTGWYAERTPDRSAKAVIAVTLLALLLVAAVPVALLAGV |
| Ga0318577_105676341 | 3300032091 | Soil | VSVMTGWYAERTPDRSAKAVIAVTLLALLLVAAVPVALLAG |
| Ga0318540_103888212 | 3300032094 | Soil | MTVWYAERTPGRSAKTVIAVTLLALLLVAAVPVALLAGVVM |
| Ga0307472_1009047662 | 3300032205 | Hardwood Forest Soil | MTGWYAERAPGRSALAMIAVMLLALLLVAAVPVALLAAV |
| Ga0306920_1004415803 | 3300032261 | Soil | MTGWYMERTPNRSAQAVIAVTLLALLLVSVVPVALL |
| Ga0306920_1009309682 | 3300032261 | Soil | MTGWYAERTPDRSAKAVIAVTLLALLLVAAVPVALLAGVVIM |
| Ga0335085_114180592 | 3300032770 | Soil | MMTGWYAERTPDRSGRAVIAVTLLALLLVAAVPVALLA |
| Ga0335074_107870823 | 3300032895 | Soil | MIGSHEQRTPARSASAMIAMTLLALLLLAAVPAALLAA |
| Ga0335073_119441711 | 3300033134 | Soil | MTGWYEERTPDRSGKAMIALTLLALLLVAAVPVALLAGVIMM |
| Ga0335077_108033351 | 3300033158 | Soil | MTGWRTEPTPDRSAKAVIAVTLLALLLVAAVPVALLAGLIMMLLGH |
| Ga0335077_113764961 | 3300033158 | Soil | MSGWYAEPTPDRSARAVIAVTLLALLLVAAVPVALLAA |
| Ga0310914_115653862 | 3300033289 | Soil | MTEPYAERTPDRSARAVIAVTLLGIVLVCSVEVGVV |
| Ga0318519_100668362 | 3300033290 | Soil | MTGWYAERMPDRPARAVTAVTLLALLLVAAVPVALLAAVVMMLLG |
| Ga0318519_110304522 | 3300033290 | Soil | MMTGWYAERTPDRSAMAVIAATLLALLLVAAVPVALLV |
| Ga0314864_0141178_480_608 | 3300033805 | Peatland | MTGWYAERTPDRPARAMIAVTLLALLLVAAVPVALLAAVVMMM |
| Ga0373950_0006982_1605_1739 | 3300034818 | Rhizosphere Soil | MTGRYAERTPDGPAKAMIAVTLLALLLVAAVPVALLAAVVMMMLG |
| ⦗Top⦘ |