| Basic Information | |
|---|---|
| Family ID | F010698 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 300 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MGIALLVWLVLLYFCSDKPGWFGCLLVLLVIAVLIAGCA |
| Number of Associated Samples | 196 |
| Number of Associated Scaffolds | 300 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 91.00 % |
| % of genes near scaffold ends (potentially truncated) | 13.00 % |
| % of genes from short scaffolds (< 2000 bps) | 92.67 % |
| Associated GOLD sequencing projects | 174 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (50.333 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (20.333 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.667 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (48.667 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 46.27% β-sheet: 0.00% Coil/Unstructured: 53.73% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 300 Family Scaffolds |
|---|---|---|
| PF02738 | MoCoBD_1 | 5.00 |
| PF00211 | Guanylate_cyc | 3.00 |
| PF13416 | SBP_bac_8 | 1.67 |
| PF00072 | Response_reg | 1.33 |
| PF00578 | AhpC-TSA | 1.00 |
| PF00486 | Trans_reg_C | 0.67 |
| PF13751 | DDE_Tnp_1_6 | 0.67 |
| PF13343 | SBP_bac_6 | 0.67 |
| PF12146 | Hydrolase_4 | 0.33 |
| PF13185 | GAF_2 | 0.33 |
| PF03404 | Mo-co_dimer | 0.33 |
| PF06568 | DUF1127 | 0.33 |
| PF06067 | DUF932 | 0.33 |
| PF04909 | Amidohydro_2 | 0.33 |
| PF12849 | PBP_like_2 | 0.33 |
| PF00916 | Sulfate_transp | 0.33 |
| PF13683 | rve_3 | 0.33 |
| PF12840 | HTH_20 | 0.33 |
| PF02518 | HATPase_c | 0.33 |
| PF12974 | Phosphonate-bd | 0.33 |
| PF12697 | Abhydrolase_6 | 0.33 |
| PF03466 | LysR_substrate | 0.33 |
| PF03176 | MMPL | 0.33 |
| PF03814 | KdpA | 0.33 |
| PF02371 | Transposase_20 | 0.33 |
| PF05050 | Methyltransf_21 | 0.33 |
| PF07978 | NIPSNAP | 0.33 |
| PF00135 | COesterase | 0.33 |
| PF12796 | Ank_2 | 0.33 |
| PF01546 | Peptidase_M20 | 0.33 |
| PF00903 | Glyoxalase | 0.33 |
| PF00873 | ACR_tran | 0.33 |
| PF04392 | ABC_sub_bind | 0.33 |
| PF05635 | 23S_rRNA_IVP | 0.33 |
| PF07568 | HisKA_2 | 0.33 |
| PF02627 | CMD | 0.33 |
| COG ID | Name | Functional Category | % Frequency in 300 Family Scaffolds |
|---|---|---|---|
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 3.00 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.33 |
| COG0659 | Sulfate permease or related transporter, MFS superfamily | Inorganic ion transport and metabolism [P] | 0.33 |
| COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 0.33 |
| COG2060 | K+-transporting ATPase, KdpA subunit | Inorganic ion transport and metabolism [P] | 0.33 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.33 |
| COG2233 | Xanthine/uracil permease | Nucleotide transport and metabolism [F] | 0.33 |
| COG2252 | Xanthine/guanine/uracil/vitamin C permease GhxP/GhxQ, nucleobase:cation symporter 2 ( NCS2) family | Nucleotide transport and metabolism [F] | 0.33 |
| COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 0.33 |
| COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 0.33 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.33 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.33 |
| COG3920 | Two-component sensor histidine kinase, HisKA and HATPase domains | Signal transduction mechanisms [T] | 0.33 |
| COG5457 | Uncharacterized conserved protein YjiS, DUF1127 family | Function unknown [S] | 0.33 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 50.33 % |
| All Organisms | root | All Organisms | 49.67 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_101189396 | Not Available | 651 | Open in IMG/M |
| 3300005166|Ga0066674_10356378 | Not Available | 686 | Open in IMG/M |
| 3300005167|Ga0066672_10361365 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 948 | Open in IMG/M |
| 3300005171|Ga0066677_10064660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1865 | Open in IMG/M |
| 3300005171|Ga0066677_10374804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 815 | Open in IMG/M |
| 3300005175|Ga0066673_10092060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1614 | Open in IMG/M |
| 3300005175|Ga0066673_10332758 | Not Available | 886 | Open in IMG/M |
| 3300005176|Ga0066679_10215345 | Not Available | 1228 | Open in IMG/M |
| 3300005178|Ga0066688_10404665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 885 | Open in IMG/M |
| 3300005179|Ga0066684_10065627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2132 | Open in IMG/M |
| 3300005179|Ga0066684_10361887 | Not Available | 971 | Open in IMG/M |
| 3300005179|Ga0066684_10460585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 855 | Open in IMG/M |
| 3300005179|Ga0066684_11037084 | Not Available | 528 | Open in IMG/M |
| 3300005179|Ga0066684_11089458 | Not Available | 511 | Open in IMG/M |
| 3300005184|Ga0066671_10419753 | Not Available | 857 | Open in IMG/M |
| 3300005184|Ga0066671_11023511 | Not Available | 519 | Open in IMG/M |
| 3300005187|Ga0066675_11207314 | Not Available | 561 | Open in IMG/M |
| 3300005329|Ga0070683_101132996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 752 | Open in IMG/M |
| 3300005330|Ga0070690_100917646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 686 | Open in IMG/M |
| 3300005331|Ga0070670_101647012 | Not Available | 590 | Open in IMG/M |
| 3300005336|Ga0070680_101737858 | Not Available | 541 | Open in IMG/M |
| 3300005343|Ga0070687_100381116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 919 | Open in IMG/M |
| 3300005345|Ga0070692_10808744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 641 | Open in IMG/M |
| 3300005435|Ga0070714_101508361 | Not Available | 657 | Open in IMG/M |
| 3300005436|Ga0070713_101199014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 735 | Open in IMG/M |
| 3300005436|Ga0070713_101948994 | Not Available | 570 | Open in IMG/M |
| 3300005445|Ga0070708_101460315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 637 | Open in IMG/M |
| 3300005450|Ga0066682_10377509 | Not Available | 911 | Open in IMG/M |
| 3300005451|Ga0066681_10280278 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300005451|Ga0066681_10382287 | Not Available | 865 | Open in IMG/M |
| 3300005451|Ga0066681_10689839 | Not Available | 622 | Open in IMG/M |
| 3300005454|Ga0066687_10190252 | Not Available | 1113 | Open in IMG/M |
| 3300005454|Ga0066687_10936283 | Not Available | 516 | Open in IMG/M |
| 3300005459|Ga0068867_101748966 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300005467|Ga0070706_100375365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1325 | Open in IMG/M |
| 3300005467|Ga0070706_100412276 | Not Available | 1258 | Open in IMG/M |
| 3300005468|Ga0070707_100430138 | All Organisms → cellular organisms → Bacteria | 1280 | Open in IMG/M |
| 3300005468|Ga0070707_101899161 | Not Available | 563 | Open in IMG/M |
| 3300005518|Ga0070699_100417331 | Not Available | 1214 | Open in IMG/M |
| 3300005536|Ga0070697_100198364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1705 | Open in IMG/M |
| 3300005547|Ga0070693_101151023 | Not Available | 594 | Open in IMG/M |
| 3300005549|Ga0070704_102231257 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300005554|Ga0066661_10656287 | Not Available | 618 | Open in IMG/M |
| 3300005555|Ga0066692_11017704 | Not Available | 507 | Open in IMG/M |
| 3300005560|Ga0066670_11017593 | Not Available | 507 | Open in IMG/M |
| 3300005561|Ga0066699_10929430 | Not Available | 605 | Open in IMG/M |
| 3300005566|Ga0066693_10059715 | Not Available | 1295 | Open in IMG/M |
| 3300005569|Ga0066705_10442153 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 814 | Open in IMG/M |
| 3300005569|Ga0066705_10551575 | Not Available | 714 | Open in IMG/M |
| 3300005569|Ga0066705_10601319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 674 | Open in IMG/M |
| 3300005575|Ga0066702_10771910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 572 | Open in IMG/M |
| 3300005576|Ga0066708_10099627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1724 | Open in IMG/M |
| 3300005576|Ga0066708_10160215 | Not Available | 1389 | Open in IMG/M |
| 3300005576|Ga0066708_10208863 | Not Available | 1227 | Open in IMG/M |
| 3300005576|Ga0066708_10313257 | Not Available | 1005 | Open in IMG/M |
| 3300005576|Ga0066708_10833205 | Not Available | 577 | Open in IMG/M |
| 3300005586|Ga0066691_10324136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 910 | Open in IMG/M |
| 3300005602|Ga0070762_11062108 | Not Available | 557 | Open in IMG/M |
| 3300005610|Ga0070763_10532353 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 675 | Open in IMG/M |
| 3300005614|Ga0068856_101664368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 651 | Open in IMG/M |
| 3300005618|Ga0068864_101258064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 740 | Open in IMG/M |
| 3300005841|Ga0068863_101980144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 593 | Open in IMG/M |
| 3300005843|Ga0068860_101264195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 759 | Open in IMG/M |
| 3300005844|Ga0068862_100756910 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300005921|Ga0070766_11233680 | Not Available | 518 | Open in IMG/M |
| 3300006028|Ga0070717_11141261 | Not Available | 709 | Open in IMG/M |
| 3300006028|Ga0070717_11982613 | Not Available | 525 | Open in IMG/M |
| 3300006031|Ga0066651_10275808 | Not Available | 894 | Open in IMG/M |
| 3300006031|Ga0066651_10442929 | Not Available | 690 | Open in IMG/M |
| 3300006031|Ga0066651_10810192 | Not Available | 508 | Open in IMG/M |
| 3300006032|Ga0066696_10724455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 638 | Open in IMG/M |
| 3300006034|Ga0066656_10396940 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300006034|Ga0066656_11128637 | Not Available | 504 | Open in IMG/M |
| 3300006046|Ga0066652_100349435 | Not Available | 1331 | Open in IMG/M |
| 3300006046|Ga0066652_100369206 | Not Available | 1298 | Open in IMG/M |
| 3300006046|Ga0066652_101608752 | Not Available | 597 | Open in IMG/M |
| 3300006176|Ga0070765_100318509 | All Organisms → cellular organisms → Bacteria | 1441 | Open in IMG/M |
| 3300006176|Ga0070765_101151041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 733 | Open in IMG/M |
| 3300006791|Ga0066653_10673670 | Not Available | 532 | Open in IMG/M |
| 3300006794|Ga0066658_10333514 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300006794|Ga0066658_10499302 | Not Available | 662 | Open in IMG/M |
| 3300006794|Ga0066658_10769650 | Not Available | 539 | Open in IMG/M |
| 3300006796|Ga0066665_11004681 | Not Available | 640 | Open in IMG/M |
| 3300006797|Ga0066659_10688352 | Not Available | 835 | Open in IMG/M |
| 3300006797|Ga0066659_10871959 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300006800|Ga0066660_10368792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1173 | Open in IMG/M |
| 3300006800|Ga0066660_10378048 | Not Available | 1161 | Open in IMG/M |
| 3300006800|Ga0066660_11595106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 517 | Open in IMG/M |
| 3300006854|Ga0075425_101267906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 836 | Open in IMG/M |
| 3300007258|Ga0099793_10575694 | Not Available | 563 | Open in IMG/M |
| 3300007265|Ga0099794_10749275 | Not Available | 521 | Open in IMG/M |
| 3300007788|Ga0099795_10162172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 923 | Open in IMG/M |
| 3300007788|Ga0099795_10337222 | Not Available | 671 | Open in IMG/M |
| 3300009012|Ga0066710_100534062 | All Organisms → cellular organisms → Bacteria | 1772 | Open in IMG/M |
| 3300009012|Ga0066710_102476270 | Not Available | 751 | Open in IMG/M |
| 3300009012|Ga0066710_104127316 | Not Available | 543 | Open in IMG/M |
| 3300009038|Ga0099829_11223790 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 622 | Open in IMG/M |
| 3300009089|Ga0099828_11926210 | Not Available | 518 | Open in IMG/M |
| 3300009094|Ga0111539_10247085 | Not Available | 2077 | Open in IMG/M |
| 3300009094|Ga0111539_11161814 | Not Available | 897 | Open in IMG/M |
| 3300009094|Ga0111539_11710033 | Not Available | 729 | Open in IMG/M |
| 3300009137|Ga0066709_100787079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1377 | Open in IMG/M |
| 3300009137|Ga0066709_101681350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 902 | Open in IMG/M |
| 3300009137|Ga0066709_103857673 | Not Available | 544 | Open in IMG/M |
| 3300009143|Ga0099792_10581450 | Not Available | 712 | Open in IMG/M |
| 3300009143|Ga0099792_10950669 | Not Available | 571 | Open in IMG/M |
| 3300009148|Ga0105243_12211483 | Not Available | 587 | Open in IMG/M |
| 3300009156|Ga0111538_11670408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 802 | Open in IMG/M |
| 3300009156|Ga0111538_12357749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 668 | Open in IMG/M |
| 3300009156|Ga0111538_13954836 | Not Available | 512 | Open in IMG/M |
| 3300009176|Ga0105242_11271173 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 758 | Open in IMG/M |
| 3300009176|Ga0105242_11735091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 661 | Open in IMG/M |
| 3300009177|Ga0105248_11302071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 822 | Open in IMG/M |
| 3300009553|Ga0105249_10493743 | Not Available | 1268 | Open in IMG/M |
| 3300010118|Ga0127465_1080029 | Not Available | 590 | Open in IMG/M |
| 3300010159|Ga0099796_10011097 | All Organisms → cellular organisms → Bacteria | 2501 | Open in IMG/M |
| 3300010166|Ga0126306_11168104 | Not Available | 632 | Open in IMG/M |
| 3300010303|Ga0134082_10261670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 719 | Open in IMG/M |
| 3300010320|Ga0134109_10156291 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 823 | Open in IMG/M |
| 3300010321|Ga0134067_10496336 | Not Available | 505 | Open in IMG/M |
| 3300010325|Ga0134064_10308573 | Not Available | 605 | Open in IMG/M |
| 3300010326|Ga0134065_10025229 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1706 | Open in IMG/M |
| 3300010326|Ga0134065_10320176 | Not Available | 600 | Open in IMG/M |
| 3300010333|Ga0134080_10622064 | Not Available | 528 | Open in IMG/M |
| 3300010335|Ga0134063_10453992 | Not Available | 635 | Open in IMG/M |
| 3300010337|Ga0134062_10390647 | Not Available | 679 | Open in IMG/M |
| 3300010337|Ga0134062_10530467 | Not Available | 596 | Open in IMG/M |
| 3300010364|Ga0134066_10093068 | Not Available | 862 | Open in IMG/M |
| 3300010373|Ga0134128_10426697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1480 | Open in IMG/M |
| 3300010373|Ga0134128_11250849 | Not Available | 818 | Open in IMG/M |
| 3300010373|Ga0134128_11317067 | Not Available | 796 | Open in IMG/M |
| 3300010375|Ga0105239_11799189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 710 | Open in IMG/M |
| 3300010397|Ga0134124_12691645 | Not Available | 541 | Open in IMG/M |
| 3300010397|Ga0134124_13150540 | Not Available | 505 | Open in IMG/M |
| 3300010399|Ga0134127_12889590 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300010400|Ga0134122_10280194 | Not Available | 1422 | Open in IMG/M |
| 3300010401|Ga0134121_12448732 | Not Available | 563 | Open in IMG/M |
| 3300010403|Ga0134123_12519876 | Not Available | 581 | Open in IMG/M |
| 3300011271|Ga0137393_11064366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 688 | Open in IMG/M |
| 3300012096|Ga0137389_10780252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 821 | Open in IMG/M |
| 3300012177|Ga0153943_1149974 | Not Available | 511 | Open in IMG/M |
| 3300012189|Ga0137388_10837260 | Not Available | 852 | Open in IMG/M |
| 3300012199|Ga0137383_10504105 | Not Available | 886 | Open in IMG/M |
| 3300012200|Ga0137382_10081800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2095 | Open in IMG/M |
| 3300012200|Ga0137382_10447025 | Not Available | 914 | Open in IMG/M |
| 3300012202|Ga0137363_10113228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2081 | Open in IMG/M |
| 3300012203|Ga0137399_11150206 | Not Available | 653 | Open in IMG/M |
| 3300012205|Ga0137362_10715020 | Not Available | 860 | Open in IMG/M |
| 3300012208|Ga0137376_10017545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga massiliensis | 5388 | Open in IMG/M |
| 3300012208|Ga0137376_10460924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1103 | Open in IMG/M |
| 3300012208|Ga0137376_10558711 | Not Available | 991 | Open in IMG/M |
| 3300012208|Ga0137376_10743632 | Not Available | 845 | Open in IMG/M |
| 3300012210|Ga0137378_10353278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1365 | Open in IMG/M |
| 3300012211|Ga0137377_10022798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga massiliensis | 5565 | Open in IMG/M |
| 3300012211|Ga0137377_11507497 | Not Available | 598 | Open in IMG/M |
| 3300012211|Ga0137377_11543077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 589 | Open in IMG/M |
| 3300012211|Ga0137377_11878352 | Not Available | 517 | Open in IMG/M |
| 3300012212|Ga0150985_122017830 | Not Available | 567 | Open in IMG/M |
| 3300012285|Ga0137370_10145874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1366 | Open in IMG/M |
| 3300012285|Ga0137370_10256877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1036 | Open in IMG/M |
| 3300012285|Ga0137370_10439384 | Not Available | 794 | Open in IMG/M |
| 3300012285|Ga0137370_10731904 | Not Available | 614 | Open in IMG/M |
| 3300012353|Ga0137367_10171739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1577 | Open in IMG/M |
| 3300012354|Ga0137366_10338867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1102 | Open in IMG/M |
| 3300012357|Ga0137384_10989660 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300012469|Ga0150984_101904117 | Not Available | 525 | Open in IMG/M |
| 3300012469|Ga0150984_104188830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 521 | Open in IMG/M |
| 3300012532|Ga0137373_10168675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1831 | Open in IMG/M |
| 3300012582|Ga0137358_10487868 | Not Available | 830 | Open in IMG/M |
| 3300012582|Ga0137358_10757230 | Not Available | 648 | Open in IMG/M |
| 3300012683|Ga0137398_10017237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3837 | Open in IMG/M |
| 3300012683|Ga0137398_10271541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1134 | Open in IMG/M |
| 3300012683|Ga0137398_11263542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha10_Bin2 | 502 | Open in IMG/M |
| 3300012911|Ga0157301_10320766 | Not Available | 573 | Open in IMG/M |
| 3300012917|Ga0137395_10685911 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 741 | Open in IMG/M |
| 3300012923|Ga0137359_10954841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 737 | Open in IMG/M |
| 3300012924|Ga0137413_10524594 | Not Available | 875 | Open in IMG/M |
| 3300012924|Ga0137413_11538354 | Not Available | 542 | Open in IMG/M |
| 3300012925|Ga0137419_10367981 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1116 | Open in IMG/M |
| 3300012925|Ga0137419_10824715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 760 | Open in IMG/M |
| 3300012925|Ga0137419_10998937 | Not Available | 693 | Open in IMG/M |
| 3300012927|Ga0137416_10703645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 888 | Open in IMG/M |
| 3300012927|Ga0137416_11125502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 705 | Open in IMG/M |
| 3300012927|Ga0137416_11839174 | Not Available | 554 | Open in IMG/M |
| 3300012929|Ga0137404_11285545 | Not Available | 674 | Open in IMG/M |
| 3300012977|Ga0134087_10800556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 510 | Open in IMG/M |
| 3300012984|Ga0164309_11786965 | Not Available | 527 | Open in IMG/M |
| 3300012987|Ga0164307_10461323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 951 | Open in IMG/M |
| 3300012989|Ga0164305_10882565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. 28-YEA-48 | 750 | Open in IMG/M |
| 3300013296|Ga0157374_11903047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 621 | Open in IMG/M |
| 3300013306|Ga0163162_11658272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 730 | Open in IMG/M |
| 3300013307|Ga0157372_13323375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 512 | Open in IMG/M |
| 3300014166|Ga0134079_10311942 | Not Available | 703 | Open in IMG/M |
| 3300014166|Ga0134079_10662644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 527 | Open in IMG/M |
| 3300014166|Ga0134079_10703693 | Not Available | 516 | Open in IMG/M |
| 3300014325|Ga0163163_12737912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 550 | Open in IMG/M |
| 3300014326|Ga0157380_10262706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1569 | Open in IMG/M |
| 3300014745|Ga0157377_10152379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1430 | Open in IMG/M |
| 3300014969|Ga0157376_11540645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. 28-YEA-48 | 698 | Open in IMG/M |
| 3300015200|Ga0173480_10429829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 774 | Open in IMG/M |
| 3300015241|Ga0137418_10026014 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5405 | Open in IMG/M |
| 3300015262|Ga0182007_10194910 | Not Available | 706 | Open in IMG/M |
| 3300015372|Ga0132256_102091180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 672 | Open in IMG/M |
| 3300015373|Ga0132257_102859963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 629 | Open in IMG/M |
| 3300015374|Ga0132255_105069705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 558 | Open in IMG/M |
| 3300017654|Ga0134069_1158308 | Not Available | 759 | Open in IMG/M |
| 3300017792|Ga0163161_10217404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1479 | Open in IMG/M |
| 3300017792|Ga0163161_11635160 | Not Available | 569 | Open in IMG/M |
| 3300018061|Ga0184619_10028988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2321 | Open in IMG/M |
| 3300018431|Ga0066655_10460157 | Not Available | 840 | Open in IMG/M |
| 3300018431|Ga0066655_10778491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 650 | Open in IMG/M |
| 3300018431|Ga0066655_11307763 | Not Available | 521 | Open in IMG/M |
| 3300018433|Ga0066667_10252835 | All Organisms → cellular organisms → Bacteria | 1337 | Open in IMG/M |
| 3300018433|Ga0066667_10691642 | Not Available | 855 | Open in IMG/M |
| 3300018433|Ga0066667_10930682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 748 | Open in IMG/M |
| 3300018433|Ga0066667_11147676 | Not Available | 674 | Open in IMG/M |
| 3300018468|Ga0066662_10920175 | Not Available | 860 | Open in IMG/M |
| 3300018482|Ga0066669_10162995 | All Organisms → cellular organisms → Bacteria | 1657 | Open in IMG/M |
| 3300018482|Ga0066669_10189099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1563 | Open in IMG/M |
| 3300018482|Ga0066669_10315406 | Not Available | 1278 | Open in IMG/M |
| 3300018482|Ga0066669_10388979 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
| 3300018482|Ga0066669_10497141 | Not Available | 1055 | Open in IMG/M |
| 3300018482|Ga0066669_10994578 | Not Available | 756 | Open in IMG/M |
| 3300018482|Ga0066669_11473675 | Not Available | 618 | Open in IMG/M |
| 3300018482|Ga0066669_11549067 | Not Available | 603 | Open in IMG/M |
| 3300019362|Ga0173479_10634096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 565 | Open in IMG/M |
| 3300020583|Ga0210401_10447657 | Not Available | 1154 | Open in IMG/M |
| 3300020583|Ga0210401_10765084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 826 | Open in IMG/M |
| 3300020583|Ga0210401_10978851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 705 | Open in IMG/M |
| 3300021170|Ga0210400_10052613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3171 | Open in IMG/M |
| 3300021170|Ga0210400_10078040 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2600 | Open in IMG/M |
| 3300021170|Ga0210400_10758351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 796 | Open in IMG/M |
| 3300021170|Ga0210400_11220944 | Not Available | 605 | Open in IMG/M |
| 3300021358|Ga0213873_10174627 | Not Available | 657 | Open in IMG/M |
| 3300021420|Ga0210394_11218739 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 646 | Open in IMG/M |
| 3300022557|Ga0212123_10050289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus | 3831 | Open in IMG/M |
| 3300025899|Ga0207642_10738543 | Not Available | 622 | Open in IMG/M |
| 3300025901|Ga0207688_10434133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 817 | Open in IMG/M |
| 3300025908|Ga0207643_10129261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae | 1502 | Open in IMG/M |
| 3300025910|Ga0207684_10106853 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2395 | Open in IMG/M |
| 3300025910|Ga0207684_10175192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1849 | Open in IMG/M |
| 3300025910|Ga0207684_10307932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1365 | Open in IMG/M |
| 3300025910|Ga0207684_10389905 | Not Available | 1197 | Open in IMG/M |
| 3300025910|Ga0207684_10435431 | Not Available | 1126 | Open in IMG/M |
| 3300025910|Ga0207684_10678115 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300025910|Ga0207684_11162281 | Not Available | 640 | Open in IMG/M |
| 3300025910|Ga0207684_11630241 | Not Available | 522 | Open in IMG/M |
| 3300025918|Ga0207662_10160559 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1435 | Open in IMG/M |
| 3300025922|Ga0207646_10008001 | All Organisms → cellular organisms → Bacteria | 10659 | Open in IMG/M |
| 3300025922|Ga0207646_10015145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7294 | Open in IMG/M |
| 3300025922|Ga0207646_10018440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6509 | Open in IMG/M |
| 3300025922|Ga0207646_10019946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6220 | Open in IMG/M |
| 3300025922|Ga0207646_10080220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2918 | Open in IMG/M |
| 3300025922|Ga0207646_11258530 | Not Available | 647 | Open in IMG/M |
| 3300025922|Ga0207646_11670651 | Not Available | 548 | Open in IMG/M |
| 3300025926|Ga0207659_11585355 | Not Available | 559 | Open in IMG/M |
| 3300025926|Ga0207659_11869258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 509 | Open in IMG/M |
| 3300025927|Ga0207687_10361414 | Not Available | 1185 | Open in IMG/M |
| 3300025929|Ga0207664_10692312 | Not Available | 916 | Open in IMG/M |
| 3300025930|Ga0207701_10542836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 993 | Open in IMG/M |
| 3300025932|Ga0207690_11556396 | Not Available | 553 | Open in IMG/M |
| 3300025934|Ga0207686_11802544 | Not Available | 506 | Open in IMG/M |
| 3300025936|Ga0207670_10888601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 746 | Open in IMG/M |
| 3300025942|Ga0207689_11502685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 563 | Open in IMG/M |
| 3300026023|Ga0207677_10605169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 962 | Open in IMG/M |
| 3300026078|Ga0207702_10972224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 842 | Open in IMG/M |
| 3300026088|Ga0207641_11509538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 674 | Open in IMG/M |
| 3300026116|Ga0207674_10578906 | Not Available | 1084 | Open in IMG/M |
| 3300026309|Ga0209055_1214710 | Not Available | 589 | Open in IMG/M |
| 3300026312|Ga0209153_1116290 | Not Available | 1012 | Open in IMG/M |
| 3300026316|Ga0209155_1062848 | Not Available | 1418 | Open in IMG/M |
| 3300026317|Ga0209154_1207409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 747 | Open in IMG/M |
| 3300026323|Ga0209472_1219675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 622 | Open in IMG/M |
| 3300026330|Ga0209473_1274073 | Not Available | 569 | Open in IMG/M |
| 3300026330|Ga0209473_1277272 | Not Available | 565 | Open in IMG/M |
| 3300026530|Ga0209807_1181585 | Not Available | 767 | Open in IMG/M |
| 3300026548|Ga0209161_10117854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1575 | Open in IMG/M |
| 3300026550|Ga0209474_10155839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1484 | Open in IMG/M |
| 3300026557|Ga0179587_10279500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1073 | Open in IMG/M |
| 3300027512|Ga0209179_1147753 | Not Available | 525 | Open in IMG/M |
| 3300027546|Ga0208984_1048757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 902 | Open in IMG/M |
| 3300027565|Ga0209219_1095442 | Not Available | 734 | Open in IMG/M |
| 3300027663|Ga0208990_1000722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 8808 | Open in IMG/M |
| 3300027669|Ga0208981_1036361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1257 | Open in IMG/M |
| 3300027681|Ga0208991_1026193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1762 | Open in IMG/M |
| 3300027738|Ga0208989_10001160 | All Organisms → cellular organisms → Bacteria | 8362 | Open in IMG/M |
| 3300027903|Ga0209488_10341723 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1114 | Open in IMG/M |
| 3300027907|Ga0207428_10366989 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1058 | Open in IMG/M |
| 3300028047|Ga0209526_10850739 | Not Available | 560 | Open in IMG/M |
| 3300028047|Ga0209526_10957658 | Not Available | 515 | Open in IMG/M |
| 3300028380|Ga0268265_11644540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 648 | Open in IMG/M |
| 3300028536|Ga0137415_10153723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2137 | Open in IMG/M |
| 3300028536|Ga0137415_10925596 | Not Available | 682 | Open in IMG/M |
| 3300028906|Ga0308309_11686666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 538 | Open in IMG/M |
| 3300029636|Ga0222749_10399798 | Not Available | 728 | Open in IMG/M |
| 3300031720|Ga0307469_11833366 | Not Available | 587 | Open in IMG/M |
| 3300031820|Ga0307473_10881691 | Not Available | 645 | Open in IMG/M |
| 3300031854|Ga0310904_11138035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 561 | Open in IMG/M |
| 3300031962|Ga0307479_10258096 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1722 | Open in IMG/M |
| 3300031962|Ga0307479_12005407 | Not Available | 528 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 20.33% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 19.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.67% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 7.33% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.67% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.67% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.33% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.33% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.67% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.67% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.67% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.67% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.33% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.33% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.33% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.33% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.33% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.33% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.33% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.33% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.33% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.33% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.33% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.33% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.33% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.33% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.33% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.33% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010118 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012177 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ027 MetaG | Host-Associated | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Host-Associated | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027669 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1011893962 | 3300002245 | Forest Soil | MGIVFLAGLVLLYLFSSKPGWFGCLLVLLVVSILIAGCG* |
| Ga0066674_103563781 | 3300005166 | Soil | MAIALLVWLLLLYFCSNKPGPFGCLLVLLVIAVLIAGCA* |
| Ga0066672_103613651 | 3300005167 | Soil | MGFAFLAWLVLLYLFSGKPGVFACLLALLIIGILVAACG* |
| Ga0066677_100646602 | 3300005171 | Soil | MGLAILAWLVLLYLFSGKPGWFACLLVLLAIGILIAGCG* |
| Ga0066677_103748042 | 3300005171 | Soil | MLIALLVWFMLLYFCSSKPGWFGCLLVLLVIAVLIAGCA* |
| Ga0066673_100920602 | 3300005175 | Soil | MGIALLVWLVLIYFCSGKPGWFGCLVVLLVIAVLIAGCA* |
| Ga0066673_103327581 | 3300005175 | Soil | MAIALLVWLLLLYFCSNKPGPFGCLLVLLVIAILITGCA* |
| Ga0066679_102153453 | 3300005176 | Soil | MGVALLVWLVLLYLCSGKPGWFGCLLALLVIAVLITGCA* |
| Ga0066688_104046651 | 3300005178 | Soil | MAIALLVWLVLLYFCSDKPGWFGCLLILLVIAVLIAGCA* |
| Ga0066684_100656272 | 3300005179 | Soil | MAIALLVWLVLIYFCSGKPGWFGCLVVLLVIAVLIAGCA* |
| Ga0066684_103618872 | 3300005179 | Soil | MAIALLVWLVLLYFCSDKPGWFGCLRVLLVIAVLITGCA* |
| Ga0066684_104605852 | 3300005179 | Soil | MGIAFLVWLVLVYLCSSKPGWFGCLLALLVIAVLIAGCA* |
| Ga0066684_110370841 | 3300005179 | Soil | EGDPEMGFAILAWLVLLYLFSSKPGWFACLLVILVIGVLIAGC* |
| Ga0066684_110894581 | 3300005179 | Soil | MAIALLVWLVLLYFCSDKPGWFGCLLVLLVIAVLIAGCA* |
| Ga0066671_104197531 | 3300005184 | Soil | MAIALLVWLVLLYFWSDKPGWFGCLLVLLVIAVLITGCA* |
| Ga0066671_110235111 | 3300005184 | Soil | MLCIAFLGWLVLLYFCSSKPGWFGCLLALLLVGIILAGCG* |
| Ga0066675_112073142 | 3300005187 | Soil | MAIALLVWLVLLYFCSDKPGWLGCLLVLLVIAVLIAGCA* |
| Ga0070683_1011329962 | 3300005329 | Corn Rhizosphere | MCTFLLVRLVLAYFVSSRPGWFGALLVLLAMVILVAGCA* |
| Ga0070690_1009176462 | 3300005330 | Switchgrass Rhizosphere | MCTFLLVWLVLAYFVSSRPGWFGALLVLLVIAILVAGCA* |
| Ga0070670_1016470121 | 3300005331 | Switchgrass Rhizosphere | MCTFLLVWLVLAYFASTRPGWFGCLLVLLVIVTLIVGGA* |
| Ga0070680_1017378582 | 3300005336 | Corn Rhizosphere | MCTFLLVWLVLAYFVSSRPGWFGCFLVLLVIAVLIAGCA* |
| Ga0070687_1003811162 | 3300005343 | Switchgrass Rhizosphere | MCTFLLVWLVLAYFVSSKPGWFGALLVLLVIAILVAGCA* |
| Ga0070692_108087441 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MCTFLLVWLVLAYFVSSRPGWFGALLVFLVIAVLIAGGA* |
| Ga0070714_1015083611 | 3300005435 | Agricultural Soil | MAFALLAWITLLYFCSDKPGPFGCLLVLLVIAVLIAGCA* |
| Ga0070713_1011990142 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MAIALLVWVVLLYFCSHKPGPFGCLLVLLVIAVLIAGCVG* |
| Ga0070713_1019489942 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MAIELLVWLVLLYFCSNKPGPFGCLLVLLVIAVLIAGCA* |
| Ga0070708_1014603152 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MSIAILAWLVLLYLFGSKPGWFGCLLVLLLVGILIAGCG* |
| Ga0066682_103775091 | 3300005450 | Soil | MGVALLVWLVLVYLCSGKPGWFGCLLALLVIAVLITGCA* |
| Ga0066681_102802782 | 3300005451 | Soil | MAIALLVWLVLLYFWSDKPGWFGCLLVLLVIAVLITGGA* |
| Ga0066681_103822872 | 3300005451 | Soil | MAIALLVWMALLYLCSGRPGWFGCLFILLVAGIALKGCAG* |
| Ga0066681_106898392 | 3300005451 | Soil | MGIALLVWLVLLYFCSNKPGPFGCLLVLLVIAVLIAGCA* |
| Ga0066687_101902521 | 3300005454 | Soil | MAIALLVWLVLLYFCSDKPGWFGCLLVLLVIAVLITGCA* |
| Ga0066687_109362831 | 3300005454 | Soil | MAIALLVWLVLLYFCSNKPGPFGCLLVLLVIAVLITGCA* |
| Ga0068867_1017489662 | 3300005459 | Miscanthus Rhizosphere | MCTFLLVWLVLAYFLVWLVLAYFVSSRPGWFGALLVLLVIAI |
| Ga0070706_1003753652 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MGFAILAWLMLLYLLSSRPGWFGCLLVLLVIGILVAGRG* |
| Ga0070706_1004122763 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | RRPRMGFVFLAGLVLLYLFSGKPGWFGCLIVLLIGILVAGR* |
| Ga0070707_1004301382 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MVVALLAWLVLLYLCSSKSGWFGCLFVLLLVGILVAGCG* |
| Ga0070707_1018991611 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MGVALLAWLVLLYLFSGKPGWFACLLVLLLVGILLAGCG* |
| Ga0070699_1004173311 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MGFVVLAGLVLLYLFSSKPGPFGCLLVLLITGILVAGCA* |
| Ga0070697_1001983642 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MAIALLVWLVLLYFCSNKPGPFGCLLVLLITGILVAGCA* |
| Ga0070693_1011510232 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MCTFLLVWLVLAYFVSSRPGWFGALLVILVIAILVAGCA* |
| Ga0070704_1022312572 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | RRPRMVVALLAWLVLLYLCSSKSGWFGCLFVLLLVGILVAGCG* |
| Ga0066661_106562872 | 3300005554 | Soil | MSFALLAWLVLLYLFSSKPGWFACLLVLLVVGILIAGR* |
| Ga0066692_110177041 | 3300005555 | Soil | GIGFLVWLVLLYLCSGKPGWFGCLLVLLVIVVLIAGCA* |
| Ga0066670_110175931 | 3300005560 | Soil | MGIALLVWLVLLYFCSDKPGWFGWLLALLVIAVLITGCA* |
| Ga0066699_109294301 | 3300005561 | Soil | MGVALLVWLVLLYLFSTKPGWFGCLLVLLLVGILLAGCG* |
| Ga0066693_100597151 | 3300005566 | Soil | MGIALLVWLVLLYLCSGKPGWFGCLLALLVIAVLITGCA* |
| Ga0066705_104421531 | 3300005569 | Soil | MAIALLVWLLLLYFCGNAPRRFGCLLALLFIAVLIAGCA* |
| Ga0066705_105515752 | 3300005569 | Soil | MGIALLVWLVLLYLCSGKPGWFGCLLILLVIAVLIAGCA* |
| Ga0066705_106013191 | 3300005569 | Soil | RRSGMAIALLVWLVLLYFCSNKPGWFGCLLVLLVIAVLIAGCA* |
| Ga0066702_107719102 | 3300005575 | Soil | MGLAILAWLVLLCLFSSKPGVFACLLVLLVVGILVAGCG* |
| Ga0066708_100996272 | 3300005576 | Soil | MAIALLVWLVLLYFWSDKPGWFGCLLILLVIAVLITGCA* |
| Ga0066708_101602153 | 3300005576 | Soil | MGVALLVWLVLIYLLSSKPGWFGCLLVLLLVGTLIAGC* |
| Ga0066708_102088631 | 3300005576 | Soil | MAIALLVWLVLIYFCSGKPGWFGCLLVLLVIAILITGCA* |
| Ga0066708_103132571 | 3300005576 | Soil | MAIALLVWLVLLYFWSDKPGWFGCLLVLLVIAVLIAVCA* |
| Ga0066708_108332052 | 3300005576 | Soil | MGIALLVWLVLLYFWSGKPGWFACVLVLLVVGILIAGC* |
| Ga0066691_103241362 | 3300005586 | Soil | MAIAFLVWLVLLYSYSDKPGWFGYLLVLLVIAVLITGC* |
| Ga0070762_110621081 | 3300005602 | Soil | MGIALLVWLLLLYFGSGKPGLFWCLLSLLVIGILIAGCG* |
| Ga0070763_105323531 | 3300005610 | Soil | MGIALLVWLLLLYFGSGKSGLFWCLLVLLVVGILIAGCG* |
| Ga0068856_1016643682 | 3300005614 | Corn Rhizosphere | MCTFILVWLVLAYFVSSKPSWFGCLFVLLVIAVLIAE* |
| Ga0068864_1012580641 | 3300005618 | Switchgrass Rhizosphere | MCTFLLVWLVLAYFASTRPGWFGCLLVLLVIVTLVVGGA* |
| Ga0068863_1019801441 | 3300005841 | Switchgrass Rhizosphere | MCTFLLVWLVLAYFVSSKPGWFGALLVFLAIVILV |
| Ga0068860_1012641951 | 3300005843 | Switchgrass Rhizosphere | MCTFLLVWLVLAYFVSSRPGWFGCFLVLLVIAVLIAGCS* |
| Ga0068862_1007569102 | 3300005844 | Switchgrass Rhizosphere | MCAFLLVWLVLAYFVNNKPGWFGALLVILVIAVLVAGCA* |
| Ga0070766_112336802 | 3300005921 | Soil | LLVWLLLLYFGSGKPGLFWCLLSLLVIGILVAGC* |
| Ga0070717_111412612 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MAIALLVWLVLLYFCSKKPGWFGCLLVLLVIAVLIAGCA* |
| Ga0070717_119826132 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MAIALLVWLVLLYFCSNKPGCFGCLLVLLLVGVLIIGC* |
| Ga0066651_102758083 | 3300006031 | Soil | MGIAFLVWLVLVYLCSSKPGWFGCLLALLVIAVLITGCA* |
| Ga0066651_104429292 | 3300006031 | Soil | MAIALLVWLLLLYFCGNTPRRFGCLLALLFIAVLIAGCA* |
| Ga0066651_108101921 | 3300006031 | Soil | MAIALLVWLVLLYFCSDKPGWFGCLFILLVAGIALKGCAG* |
| Ga0066696_107244551 | 3300006032 | Soil | IALLVWLVLLYFCSNKPGPFGCLLVLLVIAVLIAGCA* |
| Ga0066656_103969402 | 3300006034 | Soil | MGIALLVWLVLLYLCSGKPGWFGCLLVLLVIGMLIVGCG* |
| Ga0066656_111286372 | 3300006034 | Soil | MGIALLVWLVLLYLCSNRPGWFGCLLVLLLVGILIAGCG* |
| Ga0066652_1003494352 | 3300006046 | Soil | MAIALLVWLVLLYFCSDKPGWFGCLLVLLVIAVLITGGA* |
| Ga0066652_1003692061 | 3300006046 | Soil | MLCIAFLGWLVLLYFCSSKPGWFGCLLALLLVGIIL |
| Ga0066652_1016087522 | 3300006046 | Soil | LVWLVLLYFCSDKPGWFGCLLILLVAGIALKGCAG* |
| Ga0070765_1003185092 | 3300006176 | Soil | MGFAILAWLVLLYFFSSKPGVFACLLVLLVIGILIGGCG* |
| Ga0070765_1011510412 | 3300006176 | Soil | MGFAILAWLILLYFFSSKPGVFACLLVLLFVGILLVGCG* |
| Ga0066653_106736701 | 3300006791 | Soil | RRCGMAIALLVWLVLLYFCSDKPGWFGYLLILLVIAVLITGGA* |
| Ga0066658_103335141 | 3300006794 | Soil | MAIALLVWLVLLYFCSDKPAWFGGLLVLLVIAVLITGCA* |
| Ga0066658_104993022 | 3300006794 | Soil | MGIALLVWLVLLYLCSGKPGWLGCLLVLLVIAVLIAGCA* |
| Ga0066658_107696501 | 3300006794 | Soil | MGLALLAWLVLLYLFNSKPGWFACLHVLLAIGVLVAGCG* |
| Ga0066665_110046812 | 3300006796 | Soil | MGVALLVWLVLLYFCSDKPGWFGCLLVLLVIAVLIAGCA* |
| Ga0066659_106883521 | 3300006797 | Soil | MAIALLVWLVLLYFWSDKPGWFGCLLVLLVIAVLIAGGA* |
| Ga0066659_108719592 | 3300006797 | Soil | LVWLVLLYFCSDKPGWFGCLLVLLVIAVLITGCA* |
| Ga0066660_103687921 | 3300006800 | Soil | MGFAILAWLVLLYFFSSKPGWFACLLVLLVVGILVAGCG* |
| Ga0066660_103780481 | 3300006800 | Soil | AIALLVWLVLLYFCSDKPGWFGCLLVLLVIGIFVAGC* |
| Ga0066660_115951062 | 3300006800 | Soil | MAIALLVWLVLLYFCSDKPGWFGCLLILLVIAVLITGCA* |
| Ga0075425_1012679062 | 3300006854 | Populus Rhizosphere | MAIALLVWLVLLYFCSDKPGWFGCRLVLLVIAVLVVGC* |
| Ga0099793_105756942 | 3300007258 | Vadose Zone Soil | MGFALLAWLARLYLFSSKPGWFACLLVLLLVCILVAGCG* |
| Ga0099794_107492751 | 3300007265 | Vadose Zone Soil | MGLAILAWLVLLYLFSGKPGWFACLLVLLLVGILIAGCG* |
| Ga0099795_101621722 | 3300007788 | Vadose Zone Soil | MGVALLVWLVLLYLFSSKPGWFACLLVLLLVGILVAGC* |
| Ga0099795_103372221 | 3300007788 | Vadose Zone Soil | MCLAILAWVVLLCLFISKHGWFGCLLVLLVIAVLITGCA* |
| Ga0066710_1005340621 | 3300009012 | Grasslands Soil | MGVAILAWLVLLYLVSGKPGWFACLLVVLAIRILVAGCG |
| Ga0066710_1024762701 | 3300009012 | Grasslands Soil | MAIAFLVWLVLLYSCSDKPGWFGCLLVLLVIAVLITGCA |
| Ga0066710_1041273161 | 3300009012 | Grasslands Soil | MAIALLVWLVLLYFWSDKPGWFGCLLVLLVIAVLIAVCA |
| Ga0099829_112237902 | 3300009038 | Vadose Zone Soil | MGFALLAWLVLLYLFSSKPGWFACLLVLLVVGILVAGCG* |
| Ga0099828_119262102 | 3300009089 | Vadose Zone Soil | MGFALLAWLVLLYLFSGKPGWFACLLVLLVVGILVAGCG* |
| Ga0111539_102470855 | 3300009094 | Populus Rhizosphere | MCTFLLVWLVLAYFVNNKLGWFGALVVLLVVAVLIAGCA* |
| Ga0111539_111618142 | 3300009094 | Populus Rhizosphere | MCTFLLVWLVLAYFVSSRPGWFGALLVLLVVAVLIAGGA* |
| Ga0111539_117100331 | 3300009094 | Populus Rhizosphere | MCTFLLVWLVLAYFVSSKAGWFGCLLVFLVIVTLVAGGA* |
| Ga0066709_1007870792 | 3300009137 | Grasslands Soil | MAIALLVWLVLLYFCSNKSGWFGGLLVLLVIAVLIAGCA* |
| Ga0066709_1016813502 | 3300009137 | Grasslands Soil | MGFAILAWLLLLYLFSSKPGVFACLLVLLVVGILVAGCG* |
| Ga0066709_1038576732 | 3300009137 | Grasslands Soil | MGIGLLVWLVLLYLCSDKPAWFGCLLVLLVIGVLIAGC* |
| Ga0099792_105814502 | 3300009143 | Vadose Zone Soil | MAIALLVWLVLLYFCSNKPGLFGCLLVLLVIAVLIAGCA* |
| Ga0099792_109506691 | 3300009143 | Vadose Zone Soil | MGFAILAWLVLLYLFSSKPGWFACLLVLLVVGILVGGCG* |
| Ga0105243_122114832 | 3300009148 | Miscanthus Rhizosphere | MCTFLLVWLVLAYFVSTKPGWFGALLVLLVIAVLIAGCA* |
| Ga0111538_116704081 | 3300009156 | Populus Rhizosphere | MCTFLLVWLVLAYFVSSRPGWFGALLVLLVIAVLIAG |
| Ga0111538_123577492 | 3300009156 | Populus Rhizosphere | MCTFLLVWLLLAYFVSSRPGWFGALLVLLVIAILVAGCT* |
| Ga0111538_139548361 | 3300009156 | Populus Rhizosphere | MCTFLLVWLVLAYFVSSRPGWFGALLVLLVIAILVAGGA* |
| Ga0105242_112711732 | 3300009176 | Miscanthus Rhizosphere | MCTFLLVWLVLVYFVSSKPGWFGALLVFLAIAILVAGCA* |
| Ga0105242_117350911 | 3300009176 | Miscanthus Rhizosphere | MCTFLLVWLVLAYFVNNKPGWFGALLVLLVVAVLIAGGA* |
| Ga0105248_113020711 | 3300009177 | Switchgrass Rhizosphere | MCAFLLVWLVLAYFVSSKPGWFGALLVLLVIVALIVGGA* |
| Ga0105249_104937433 | 3300009553 | Switchgrass Rhizosphere | MCTFLLVWLVLAYFVNNKLGWFGALLVILVIAVLVAGCA* |
| Ga0127465_10800292 | 3300010118 | Grasslands Soil | MGFAILAWLVLLYLFSSKPGWFACLLVILVIGVLIAGC* |
| Ga0099796_100110973 | 3300010159 | Vadose Zone Soil | MGFALLVWLVLLYLFSSKPGWFGCLLVLLLVGILLAGCG* |
| Ga0126306_111681041 | 3300010166 | Serpentine Soil | MCIAILVWLLLAYVLSSKLGWFACLLVLLVVSILLAGCG* |
| Ga0134082_102616701 | 3300010303 | Grasslands Soil | MAIALLVWLVLLYFCSDKPGWFGCLLVLLVIAILITGCA* |
| Ga0134109_101562911 | 3300010320 | Grasslands Soil | MAIALLVWLVLLYFCSNKPGPFGCLLVLLVIAVLIAGCA* |
| Ga0134067_104963362 | 3300010321 | Grasslands Soil | MGIALLVWLVLVYFCSSKPGWFGCLLVLLVIAVLIAGCA* |
| Ga0134064_103085732 | 3300010325 | Grasslands Soil | MAIALLVWLMLLYFCSDKPGWFGCLLVLLVIAILITGCA* |
| Ga0134065_100252291 | 3300010326 | Grasslands Soil | MGIALLVWLVLLYSCSDKPGWFGCLLVLLVIAVLIAVCA* |
| Ga0134065_103201762 | 3300010326 | Grasslands Soil | MAVALLVWLVLLYFCSDKPGWFGCLLVLLVIAVLIAGCA* |
| Ga0134080_106220642 | 3300010333 | Grasslands Soil | MGIAFLVWLVLVYLCSGKPGWFGCLLVLLVIAVLIAGCA* |
| Ga0134063_104539921 | 3300010335 | Grasslands Soil | MGFVFLTGLVLLYLCSSKPGGFACLFVLLVGILVAGCG* |
| Ga0134062_103906472 | 3300010337 | Grasslands Soil | MGVALLVWLVLLYFCSDKPGWFGCLLVLLVIAVLITGCA* |
| Ga0134062_105304671 | 3300010337 | Grasslands Soil | MGIALLVWLVLLYFCSNKPGWFGCLLGLLVIAVLITGCA* |
| Ga0134066_100930682 | 3300010364 | Grasslands Soil | MAVALLVWLVLLYFWSGKPGWFACVLVLLVVGILIAGC* |
| Ga0134128_104266972 | 3300010373 | Terrestrial Soil | MCTFLLVWLVLAYFVSAKPGWLGCLLVLLVVAILIAGCA* |
| Ga0134128_112508492 | 3300010373 | Terrestrial Soil | MAIAFLAWLVLLYFYSDKPGPFGCLLVLLVIAVLIAGCA* |
| Ga0134128_113170672 | 3300010373 | Terrestrial Soil | MCTFLLVWLVLAYFVSSRQGQFGALLVLLVIAILIAGYA* |
| Ga0105239_117991891 | 3300010375 | Corn Rhizosphere | VTCTFLLVWLVLAYFASSRPSWFGALLVILVIAVL |
| Ga0134124_126916451 | 3300010397 | Terrestrial Soil | MCTFLLVWLVLAYVVSSKPGWFGCLLVILAIAVLIAGCA* |
| Ga0134124_131505401 | 3300010397 | Terrestrial Soil | MCTFLPVWLVLAYFVSSRPGWFGCLLVLLVIAVLIAGGA* |
| Ga0134127_128895901 | 3300010399 | Terrestrial Soil | MCTFLLVWLLLAYFVSSKPGWFGALLVLLAIVILVAGCA* |
| Ga0134122_102801942 | 3300010400 | Terrestrial Soil | MCTFLLVWLVLAYFVSSRPGWFGALLVLLVIAILGAGWA* |
| Ga0134121_124487322 | 3300010401 | Terrestrial Soil | MCTFLLVWLVLAYFVSSRPGWFGALLVLLVIAVLIAGCV* |
| Ga0134123_125198762 | 3300010403 | Terrestrial Soil | MCTFLLVWLVLAYFLVWLVLAYFVSSKPGWFGALLVLLVVAILILGGA* |
| Ga0137393_110643662 | 3300011271 | Vadose Zone Soil | MGFAIVAWLVLLYLFSSKPGWFACLLVLLLVGILVAGCG* |
| Ga0137389_107802522 | 3300012096 | Vadose Zone Soil | MGLALLAWLVLLYLCSSKPGWFACLLVLLVVGILVAGCG* |
| Ga0153943_11499742 | 3300012177 | Attine Ant Fungus Gardens | MWTALLCWLALLYLLRSKPGWFGCLLVLLAVCVLIAGCG* |
| Ga0137388_108372601 | 3300012189 | Vadose Zone Soil | MGFAILAWLVLLYLFSGKPGWFACLLVLLVIGILIAGCG* |
| Ga0137383_105041052 | 3300012199 | Vadose Zone Soil | MAIALLVWLVLIYFCSGKPGWFGCLLVLLVIVVLIAGCA* |
| Ga0137382_100818002 | 3300012200 | Vadose Zone Soil | MAIALLVWLVLLYFCSDKHGWFGCLLVLLVIAVLIAVCA* |
| Ga0137382_104470251 | 3300012200 | Vadose Zone Soil | MAIAFLVWLVLLYFCSDKPGWFGCLLILLVIAVLITGCA* |
| Ga0137363_101132283 | 3300012202 | Vadose Zone Soil | MGIALLVWLVLLYLCSSKPGSFGCLLVLLVIAVLITGCA* |
| Ga0137399_111502062 | 3300012203 | Vadose Zone Soil | MAIALLVWLVLLYFCSNKPGWFGCLLVLLVIAVLITGCA* |
| Ga0137362_107150201 | 3300012205 | Vadose Zone Soil | ALLVWLVLIYFCSSKPGWFGCLVVLLVIAVLIAGCA* |
| Ga0137376_100175457 | 3300012208 | Vadose Zone Soil | MAIALLVWLVLLYFCSDKHGWFGCILVLLVIAVLITGCA* |
| Ga0137376_104609242 | 3300012208 | Vadose Zone Soil | MAIALLVWLVLLYFCSNKPSWFGCLLVLLFLAVLIAGCA* |
| Ga0137376_105587112 | 3300012208 | Vadose Zone Soil | MAIALLVWLVLVYLCSSKPGWVGCLLALLVIAVLITGCA* |
| Ga0137376_107436322 | 3300012208 | Vadose Zone Soil | MGVAIIAWLVLLYLFSSKPGWFACLLVLLLVGILVAGCG* |
| Ga0137378_103532781 | 3300012210 | Vadose Zone Soil | MAIALLVWLVLLYFCSNKPGWFGCLLVLLVIAVLIAGCA* |
| Ga0137377_100227986 | 3300012211 | Vadose Zone Soil | MGVALLVWLVLLYFCSDKPGWFGCLLILLVIAILITGCA* |
| Ga0137377_115074972 | 3300012211 | Vadose Zone Soil | MAIAFLVWLVLLYFCSDKPGWFGCLLILLVIAVLIAGCA* |
| Ga0137377_115430772 | 3300012211 | Vadose Zone Soil | MGIALLVWLLLLYFGSGKPGLFWCLLSLLLVGILVAGCG* |
| Ga0137377_118783522 | 3300012211 | Vadose Zone Soil | MGFAILAWLVLLYLFSSKPGWFGCLLVLLLVGILVAGCG* |
| Ga0150985_1220178301 | 3300012212 | Avena Fatua Rhizosphere | MCTILLVWLVLAYIVSSKPGWFGCLLVLLAIAVLIAGCA* |
| Ga0137370_101458741 | 3300012285 | Vadose Zone Soil | LLVWLVLLYFCSDKPGWFGCLLTLLVIAVLITGCA* |
| Ga0137370_102568772 | 3300012285 | Vadose Zone Soil | MAIALLVWLVLLYFWSDKPGWFGCLLVLLVIAVLIAGCA* |
| Ga0137370_104393841 | 3300012285 | Vadose Zone Soil | MHIAFLVWLVLVYLCSSKPGWFGCLLVLLVIAVLITGCA* |
| Ga0137370_107319041 | 3300012285 | Vadose Zone Soil | MAIAVLVWLVLLYVCCDKLAWFGCLLVLLVISALFTGC |
| Ga0137367_101717392 | 3300012353 | Vadose Zone Soil | MGLAILAWLVLLYLFSSKPGWFACLLVLLLVGILVAGCG* |
| Ga0137366_103388672 | 3300012354 | Vadose Zone Soil | MGLAILAWLVLLYPFSSKPGWFACLLVLLLVGILVAGCG* |
| Ga0137384_109896602 | 3300012357 | Vadose Zone Soil | MDVAILAWLVLLYLFSSKPGWFACLLVLLLVVGILIAGCG* |
| Ga0150984_1019041171 | 3300012469 | Avena Fatua Rhizosphere | MCTFVLVWMVLAWFVSSKPGWFGCLLVLLAIAILVAGGA* |
| Ga0150984_1041888301 | 3300012469 | Avena Fatua Rhizosphere | PAMCTFLLVWLVLAYFVSSKPGWFGCLLVLLVIAVLIAGCA* |
| Ga0137373_101686751 | 3300012532 | Vadose Zone Soil | MGLALLAWLVLLYLFSSKPGWFACLLVLLVVGILIAGCG* |
| Ga0137358_104878681 | 3300012582 | Vadose Zone Soil | MGFAILVWLVLLYLSSSKPGWFGCLLVLLLVAILVAGCG* |
| Ga0137358_107572301 | 3300012582 | Vadose Zone Soil | AILAWLVLLYLFRGKPGVFACLLVVLVIGTLVAGCG* |
| Ga0137398_100172372 | 3300012683 | Vadose Zone Soil | MGFVILAWLVLLYLFSSKPGWFACLLVLLLVSILVAGCG* |
| Ga0137398_102715412 | 3300012683 | Vadose Zone Soil | MGIALLVWLVLLYFCSDKPGWFGCLLVLLVIAVLIAGCA* |
| Ga0137398_112635422 | 3300012683 | Vadose Zone Soil | MGFALLVWLVLLYLFSSKPGWFACLLVLLVVGILLAGCG* |
| Ga0157301_103207662 | 3300012911 | Soil | MCTFLLVWLVLAYFVSSRPGWFGCLLVLLVIVTLVVGGA* |
| Ga0137395_106859112 | 3300012917 | Vadose Zone Soil | MGLAILAWLVLLYLFSSKPGWFACLFVLLVVGILVAGCG* |
| Ga0137359_109548412 | 3300012923 | Vadose Zone Soil | MGVALLAWLMLLYLFSSKPGWFACLLVLLVVGILVAGCG* |
| Ga0137413_105245942 | 3300012924 | Vadose Zone Soil | MGFALLVWLVLLYLFSSKPGWFGCLLVVLLLVGILLAGCG* |
| Ga0137413_115383541 | 3300012924 | Vadose Zone Soil | MAIALLVWLVLLYFCSDKPGWFGCLLTLLVIAVLITGCA* |
| Ga0137419_103679811 | 3300012925 | Vadose Zone Soil | RRSRMGFALLAWLVLLYLFSSKPGWFACLLVLLLVGILVAGC* |
| Ga0137419_108247152 | 3300012925 | Vadose Zone Soil | MGFALLAWLILLYFFNSKPGVFACLLVLLVVGILVAG* |
| Ga0137419_109989373 | 3300012925 | Vadose Zone Soil | MGFALLVWLVLLYLFSSKPGWFGCLLVLLLVGILIAGCG* |
| Ga0137416_107036452 | 3300012927 | Vadose Zone Soil | MGFAILAWLALLYLFSSKPGWFACLLVLLVVGILIAGC* |
| Ga0137416_111255021 | 3300012927 | Vadose Zone Soil | GVAFLAWLMLLYFCSSKPGWFGCLLVLLVIGILVAGCA* |
| Ga0137416_118391741 | 3300012927 | Vadose Zone Soil | MGLAILAWLVLLYLFSSKPGWFGCLVVLLLVGILVAGCG* |
| Ga0137404_112855452 | 3300012929 | Vadose Zone Soil | MGLALLVWLVLLYLFSSKPGWFACLLVLLVIGILVAGCG* |
| Ga0134087_108005562 | 3300012977 | Grasslands Soil | GMAIALLVWLVLLYFWSNKPGWFGCLLILLVIAVLITGCA* |
| Ga0164309_117869652 | 3300012984 | Soil | MCTFLRVWLVLAYVVSSKPGWFEALLVLLVIAVLVVGCA* |
| Ga0164307_104613233 | 3300012987 | Soil | MCTFLLVWLVLAYFVSSRPGWFGALLVFLVIVTLIVGGA* |
| Ga0164305_108825652 | 3300012989 | Soil | MCTFLLVWLVLAYFVSSKPGWFGCLLVLLVIAILVAGCA* |
| Ga0157374_119030472 | 3300013296 | Miscanthus Rhizosphere | MCTSVLVWLVLAYFVSSRPGWFGALLVLLAMVILVAGCA* |
| Ga0163162_116582722 | 3300013306 | Switchgrass Rhizosphere | MCTFLLVWLVLAYFVSSRQGRFGALLVLLVIAILIAGCA* |
| Ga0157372_133233751 | 3300013307 | Corn Rhizosphere | MCTFLLVWLVLAYFVSSKPGWFGCLLVLLVVAVLVAGCA* |
| Ga0134079_103119421 | 3300014166 | Grasslands Soil | MAIALLVWLVLLYFCSDKPGWFECLLVLLVIAVLITGCA* |
| Ga0134079_106626441 | 3300014166 | Grasslands Soil | MGVTLLVWLVLLYLLGGKPGWFGCLVVLLVIAVPFAGCA* |
| Ga0134079_107036932 | 3300014166 | Grasslands Soil | MAIALLVWLVLLYFCSDKPGWFGCLLVLLVVSILITGC* |
| Ga0163163_127379121 | 3300014325 | Switchgrass Rhizosphere | MCTFLLVWLVLAYVVSSKPGWFGALLVLLAIAILIAGCA* |
| Ga0157380_102627063 | 3300014326 | Switchgrass Rhizosphere | MCTFLLVWLVLAYFVSSKPGSFGAFLVLLVIAVLIAGGA* |
| Ga0157377_101523792 | 3300014745 | Miscanthus Rhizosphere | MCTFLLVWLVLAYFVSSKPGWFGALLVLLVIVTLVAGGA* |
| Ga0157376_115406451 | 3300014969 | Miscanthus Rhizosphere | MCTFLLVWLVLAYFVSSRPGWFGCLLVPLVIVTLVAGGA* |
| Ga0173480_104298292 | 3300015200 | Soil | MCTFLLVWLVLAYFVSSKPGWFGALLVLLVIAVLIAGCA* |
| Ga0137418_100260143 | 3300015241 | Vadose Zone Soil | MCFAILAWLMLLYLFSSKPGWFACLLVLLVVGILVAGC* |
| Ga0182007_101949101 | 3300015262 | Rhizosphere | MCTFLLVWLVLVYFVSAKPGWLGCLLVLLVVAILIAGCA* |
| Ga0132256_1020911801 | 3300015372 | Arabidopsis Rhizosphere | MCTFLLVWLVLAYFVSSRPGWFGALLVLLVVALLIAGGA* |
| Ga0132257_1028599631 | 3300015373 | Arabidopsis Rhizosphere | MCTFLLVWLVLAYFVSSRPGWFGALLVLLVVAVLIAGCA* |
| Ga0132255_1050697052 | 3300015374 | Arabidopsis Rhizosphere | MCTFLLVWLVLAYFASSRPSWFGCLLVLLIIVTLVVGGA* |
| Ga0134069_11583081 | 3300017654 | Grasslands Soil | MGFVFLAGFVLLYLFSSKPGWFGCLLVILVVGILIT |
| Ga0163161_102174043 | 3300017792 | Switchgrass Rhizosphere | MSAFLLVWLVLAYFVSNRPGWFGCLLVLLVIVTLVAGGA |
| Ga0163161_116351602 | 3300017792 | Switchgrass Rhizosphere | MCTFLLVWLVLAYFVSSRPGWFGALLVLLVIAVLIAGCA |
| Ga0184619_100289884 | 3300018061 | Groundwater Sediment | MGVAIIAWLVLLYLFSSKPGWFACLLVLLVVGILVAGCG |
| Ga0066655_104601572 | 3300018431 | Grasslands Soil | MGIAFLVWLVLVYLCSSKPGWFGCLLALLVIAVLITGCA |
| Ga0066655_107784911 | 3300018431 | Grasslands Soil | MGFAILAWLVLLYLFSSKPGVFACLLVVLVVGILIAGCG |
| Ga0066655_113077631 | 3300018431 | Grasslands Soil | MAIALLVWLVLLYFCSDKPGWFGCLLILLVIAVLITGGA |
| Ga0066667_102528352 | 3300018433 | Grasslands Soil | MAIALLVWLMLLYFCSDKPGWFGCLLVLLVIAVLIAGCA |
| Ga0066667_106916422 | 3300018433 | Grasslands Soil | MGFAILAWLVLLYLFSSKPGWFACLLVILVIGVLIAGC |
| Ga0066667_109306822 | 3300018433 | Grasslands Soil | MGFAILAWLLLLYLFSSKPGVFACLLVLLVVGILVAGCG |
| Ga0066667_111476761 | 3300018433 | Grasslands Soil | MGVALLVWLVLVYLCSGKPGWFGCLLALLVIAVLITGCA |
| Ga0066662_109201752 | 3300018468 | Grasslands Soil | MGIAFLVWLVLVYLCSSKPGWFGCLLALLVIAVLITGSA |
| Ga0066669_101629953 | 3300018482 | Grasslands Soil | MGIAFLVWLVLVYLCSSKPGWFGCLLALLVIVLITGCA |
| Ga0066669_101890992 | 3300018482 | Grasslands Soil | MAIALLVWLLLLYFCGNTPRRFGCLLALLFIAVLIAGCA |
| Ga0066669_103154062 | 3300018482 | Grasslands Soil | MGVALLVWLVLIYLLSSKPGWFGCLLVLLLVGTLIAGC |
| Ga0066669_103889792 | 3300018482 | Grasslands Soil | MAIALLVWMALLYLYSGRPGWFGCLFILLVAGIALKGCAG |
| Ga0066669_104971412 | 3300018482 | Grasslands Soil | MGIALLVWLVLIYFCSGKPGWFGCLVVLLVIAVLIAGCA |
| Ga0066669_109945782 | 3300018482 | Grasslands Soil | MAIALLVWLVLLYFCSNKPGPFGCLLVLLVIAVLIAGCA |
| Ga0066669_114736752 | 3300018482 | Grasslands Soil | MAIALLVWLVLLYFWSDKPGWFGCLLVLLVIAVLITGGA |
| Ga0066669_115490671 | 3300018482 | Grasslands Soil | MAIAFLVWLVLLYSCSDKPGWFGCLLVLLVIAVLITGC |
| Ga0173479_106340962 | 3300019362 | Soil | MCTFLLVWLVLAYVVSTKPGWFGALLVLLVFAVLIAGCA |
| Ga0210401_104476573 | 3300020583 | Soil | MGIALLVWLLLLYFGSGKSGLFWCLLVLLVVGILIAGCG |
| Ga0210401_107650841 | 3300020583 | Soil | VAVLAWLVLPYLFSSKPGWFACLLVLLLIGILVAGCG |
| Ga0210401_109788512 | 3300020583 | Soil | MGFALLAGLALLYFFSSKPSVFACLLVLLFVGILVAGC |
| Ga0210400_100526132 | 3300021170 | Soil | MGAALLVWLVLLYLFSSKPGWFGCLLLLVGTLIAGCAPSV |
| Ga0210400_100780403 | 3300021170 | Soil | MGFAILVWLVLLYLCSSKPGWFGCLLVVLLVGILIAGCG |
| Ga0210400_107583512 | 3300021170 | Soil | MGVALLVWLVLLYLCSSKPGWFGCLLVLLLVGILIAGCG |
| Ga0210400_112209441 | 3300021170 | Soil | MGIVFLAGLVLLYLFSSKPGWFGCLLVLLVVSILIAGCG |
| Ga0213873_101746271 | 3300021358 | Rhizosphere | MAIALLVWLVLLYFCSNKPGWFGCLLVLLVIGVLVAGC |
| Ga0210394_112187391 | 3300021420 | Soil | MGFAILAWLVLLYFFSSKPGWFACLLVLLVVGILIAGCG |
| Ga0212123_100502893 | 3300022557 | Iron-Sulfur Acid Spring | RPRMGIALLVWLMLLYLCSGKPGWFGCLLVLLIVGILIAECG |
| Ga0207642_107385432 | 3300025899 | Miscanthus Rhizosphere | MCTFLLVWLVLAYFASGRPGWFGCLLVLLVIAVLVVGGA |
| Ga0207688_104341331 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MCTFLPVWLVLAYFVSSRPGWFGCLLVLLVIAVLIAGGA |
| Ga0207643_101292612 | 3300025908 | Miscanthus Rhizosphere | MCTFLLVWLVLAYFVSSRPGWFGCLLVLLAMAILIAGGA |
| Ga0207684_101068532 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MGFVVLAGLVLLYLFSAKPGWFACLLVLLLVGILVAGC |
| Ga0207684_101751922 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | RSWMGFVFIAGLVLLYLFSSKPGWFGCLLVLLVVGILVAGC |
| Ga0207684_103079323 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MGFVFLAGLVLLYLFSSKPAWFVSLIVLLVVGILVAGC |
| Ga0207684_103899052 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MGIALLVWLVLLYLFSSKPGWFGCLLVLLVVSLLIAGC |
| Ga0207684_104354312 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MGFVFLAGLVLLYLFSSKPGWFGCLLVLLLVGILVAGCG |
| Ga0207684_106781151 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MGFVFLAGLALLYLFSSKPGWFGCLVVLLIGILVAGC |
| Ga0207684_111622812 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MAFALLAWLVLLYLLSSKPGWFACLLVLLLVGVLIAGC |
| Ga0207684_116302411 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MAIALLVWLVLLYFCSNKPGCFGCLLVLLLVGVLIIGC |
| Ga0207662_101605592 | 3300025918 | Switchgrass Rhizosphere | MCTFLLVWLVLAYFVSSRPGWFGALLVLLVIVTLVVGGA |
| Ga0207646_100080013 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MGFVVLAGLVLLYLFSGKPGSFGCLLVLLITGILVAGCV |
| Ga0207646_100151459 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MAFALLAWLVLLYLLSSKPGWFASLLILLVGILVAGC |
| Ga0207646_100184403 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MGFVFLAGLVLLYLFSSKPGWFACLIVLLVGILVAGY |
| Ga0207646_100199463 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MGFVFLAGLALLYLVNSKPGWFGCLLVLLVVGILVAGC |
| Ga0207646_100802202 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MGFVFLAGLVLLYLFSSKPGWFGCLLVLLVVGILVAGC |
| Ga0207646_112585301 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MGFVFLAGLVLLYLFSGKPGWFGCLIVLLIGILVAGR |
| Ga0207646_116706512 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MGVALLAWLVLLYLFSGKPGWFACLLVLLLVGILLAGCG |
| Ga0207659_115853551 | 3300025926 | Miscanthus Rhizosphere | LLVWLVLAYIVSSRPGWFGALLVLLVIVALVAGGA |
| Ga0207659_118692581 | 3300025926 | Miscanthus Rhizosphere | MCTFLLVWLVLAYIVSSRPGWFGALLVLLVIVALVAGGA |
| Ga0207687_103614141 | 3300025927 | Miscanthus Rhizosphere | MSAFLLVWLVLAYFVSNRPGWFGCLLVLLVIVTLVVGGA |
| Ga0207664_106923122 | 3300025929 | Agricultural Soil | MAIFLLAWLMLLYFCSNKPGPFGCLLVLLVIAVLVVGC |
| Ga0207701_105428361 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MCTFLLVWLVLAYFVSSRPGWFGALLVLLVTAVLIAGCA |
| Ga0207690_115563962 | 3300025932 | Corn Rhizosphere | MCTFLLVWLVRAYFVSSRPSWFGCLLVLLAIAILVAGCA |
| Ga0207686_118025442 | 3300025934 | Miscanthus Rhizosphere | MCTFLLVWLVLVYFVSSKPGWFGALLVFLAIAILVAGCA |
| Ga0207670_108886012 | 3300025936 | Switchgrass Rhizosphere | MCTFLLVWLVLAYFVSNRPGWFGCLLVLLVIAVLIAGGA |
| Ga0207689_115026851 | 3300025942 | Miscanthus Rhizosphere | MCTFLLVWLVLAYFVSSKPGWFGALLVFLAIVILVAGCA |
| Ga0207677_106051693 | 3300026023 | Miscanthus Rhizosphere | MCTFLLVWLVLAYFVSSRRGWFGCLLVLLVIVTLVAGGA |
| Ga0207702_109722242 | 3300026078 | Corn Rhizosphere | MCTFLLVWLVLAYIVSSRPGWFGALLVILVVAILIAGCA |
| Ga0207641_115095381 | 3300026088 | Switchgrass Rhizosphere | MCTFLLVWLVLAYFVSSRPGWFGALLVILVIAVLVAGCA |
| Ga0207674_105789062 | 3300026116 | Corn Rhizosphere | MCTFLLVWLVLAYFVSSKPSWFGALLVLLAIAILIAGCA |
| Ga0209055_12147102 | 3300026309 | Soil | MTIALLVWLVLLYFCSDKPGWFGCLLVLLVIAVLITGCA |
| Ga0209153_11162902 | 3300026312 | Soil | MSVALLVWLVLLLSSKPGWFGCLLVLLLVGTLIAGC |
| Ga0209155_10628483 | 3300026316 | Soil | MLCIAFLGWLVLLYFCSSKPGWFGCLLALLLVGIILAGCG |
| Ga0209154_12074091 | 3300026317 | Soil | MAIALLVWLVLLYFCSDKPGWFGCLLVLLVIAVLI |
| Ga0209472_12196752 | 3300026323 | Soil | MGIAFLVWLVLVYLCSSKPGWFGCLLVLLVIAVLIAGCA |
| Ga0209473_12740732 | 3300026330 | Soil | MAIALLVWLLLLYFCSNKPGPFGCLLVLLVIAILITGCA |
| Ga0209473_12772722 | 3300026330 | Soil | MAIALLVWLVLIYFCSGKPGWFGCLVVLLVIAVLIAGCA |
| Ga0209807_11815853 | 3300026530 | Soil | MGVALLVWLVLLYLCSGKPGWFGCLLILLVIAVLIAGCA |
| Ga0209161_101178542 | 3300026548 | Soil | MAIALLVWLVLLYFWSDKPGWFGCLLILLVIAVLITGCA |
| Ga0209474_101558392 | 3300026550 | Soil | MAIALLVWLVLLYFWSGKPGWFACVLVLLVVGILIAGC |
| Ga0179587_102795002 | 3300026557 | Vadose Zone Soil | MGFALLVWLVLLYLFSSKPGWFACLLVLLVVGILVAGCG |
| Ga0209179_11477531 | 3300027512 | Vadose Zone Soil | MGVALLVWLVLLYLFSSKPGWFGCLLVLLVIAVLIAGCA |
| Ga0208984_10487572 | 3300027546 | Forest Soil | MGIALLVWLVLLYLCSSKPGSFGCLLVLLLIGIIVAGCG |
| Ga0209219_10954422 | 3300027565 | Forest Soil | MGFVTLACLLLLYISSGKPGLFWCLLSLLVISILVAGCG |
| Ga0208990_100072211 | 3300027663 | Forest Soil | MGVALLVWLVLLYLFSSKPGWFACLLVLLVVGILVGGCG |
| Ga0208981_10363612 | 3300027669 | Forest Soil | MGFALLVWLVLLHLFSSKPGWFGCLLVLLVIGILVAGCA |
| Ga0208991_10261932 | 3300027681 | Forest Soil | MGFAILGWLVLLYLFSSKPGWFACLLVLLLVGILIAGCV |
| Ga0208989_100011608 | 3300027738 | Forest Soil | MGFALLVWLVLLYLFSSKPGWFGCLLVLLVIGILVAGCA |
| Ga0209488_103417232 | 3300027903 | Vadose Zone Soil | MGVALLVWLVLLYLCSGKPGWFGCLLALLVIAVLITGCA |
| Ga0207428_103669892 | 3300027907 | Populus Rhizosphere | MCTFLLVWLVLAYFVSSKAGWFGCLLVFLVIVTLVAGGA |
| Ga0209526_108507392 | 3300028047 | Forest Soil | MCFAILAWLVLLYLFASKPGWFACLLVLLVVGILVAGC |
| Ga0209526_109576582 | 3300028047 | Forest Soil | MGVALLAWLLLLCLFSSKPGWFACLLVLLVVGILVAGCG |
| Ga0268265_116445402 | 3300028380 | Switchgrass Rhizosphere | MCTFLLVWLVLAYFVSSKPGWFGCLLVILVVAVLIVGGA |
| Ga0137415_101537231 | 3300028536 | Vadose Zone Soil | MGFAILAWLALLYLFSSKPGWFACLLVLLLVCILVAGCG |
| Ga0137415_109255961 | 3300028536 | Vadose Zone Soil | MGFAILAWLVLLYLFSSKPGWFGCLVVLLLVGILVAGCG |
| Ga0308309_116866662 | 3300028906 | Soil | MGFAILAWLILLYFFSSKPGVFACLLVLLFVGILLVGCG |
| Ga0222749_103997981 | 3300029636 | Soil | MGIALLVWLLLLYFGSGKPGLFWCLLSLLVIGILIAGCG |
| Ga0307469_118333662 | 3300031720 | Hardwood Forest Soil | MGFVFLAGLVLLYLLSSKPGWFGCLLVILVVGILVAGC |
| Ga0307473_108816912 | 3300031820 | Hardwood Forest Soil | ETSMSIAILASLVLLYLFSSKPGWFGCLLVILVVGILVAGCG |
| Ga0310904_111380352 | 3300031854 | Soil | MCTFLLVWLVLAYFVSSRQGRFGALLVLLVIAILIAGCA |
| Ga0307479_102580961 | 3300031962 | Hardwood Forest Soil | MGIALLAWLVLLYLFSGNPGWFACLLVLLLIGILVAGCR |
| Ga0307479_120054072 | 3300031962 | Hardwood Forest Soil | MGFAILAWLVLLYLFSSKPGWFACLLVLLVVGILIAGCG |
| ⦗Top⦘ |