 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F010691 |
| Family Type | Metagenome |
| Number of Sequences | 300 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MKFIWEKLKAYKEYILVTVFNRYQGLILFLMLLVIYLK |
| Number of Associated Samples | 141 |
| Number of Associated Scaffolds | 300 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 85.91 % |
| % of genes near scaffold ends (potentially truncated) | 24.33 % |
| % of genes from short scaffolds (< 2000 bps) | 79.00 % |
| Associated GOLD sequencing projects | 117 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (69.333 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (50.667 % of family members) |
| Environment Ontology (ENVO) | Unclassified (92.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (88.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.03% β-sheet: 0.00% Coil/Unstructured: 46.97% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 300 Family Scaffolds |
|---|---|---|
| PF08291 | Peptidase_M15_3 | 56.33 |
| PF00011 | HSP20 | 23.00 |
| PF00271 | Helicase_C | 10.67 |
| PF13640 | 2OG-FeII_Oxy_3 | 2.33 |
| PF13245 | AAA_19 | 0.67 |
| PF13759 | 2OG-FeII_Oxy_5 | 0.67 |
| PF13361 | UvrD_C | 0.67 |
| PF01612 | DNA_pol_A_exo1 | 0.33 |
| PF13392 | HNH_3 | 0.33 |
| PF00176 | SNF2-rel_dom | 0.33 |
| PF00037 | Fer4 | 0.33 |
| COG ID | Name | Functional Category | % Frequency in 300 Family Scaffolds |
|---|---|---|---|
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 23.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 69.33 % |
| All Organisms | root | All Organisms | 30.67 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 50.67% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 15.00% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 11.33% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 4.67% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 2.00% |
| Hydrothermal Vent Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids | 1.67% |
| Marine Oceanic | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic | 1.33% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.33% |
| Filtered Seawater | Environmental → Aquatic → Marine → Unclassified → Unclassified → Filtered Seawater | 1.33% |
| Black Smokers Hydrothermal Plume | Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smokers Hydrothermal Plume | 1.33% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 1.33% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.00% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.00% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.00% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 1.00% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.67% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Abyssal Plane → Marine | 0.67% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.67% |
| Diffuse Hydrothermal Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Fluids | 0.67% |
| Hydrothermal Vent Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Fluids | 0.67% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.67% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001524 | Abe Hydrothermal Plume | Environmental | Open in IMG/M |
| 3300001679 | Black smokers hydrothermal plume microbial communities from Tahi Moana, Lau Basin, Pacific Ocean | Environmental | Open in IMG/M |
| 3300001717 | Marine viral communities from the Pacific Ocean - LP-47 | Environmental | Open in IMG/M |
| 3300001721 | Marine viral communities from the Pacific Ocean - LP-54 | Environmental | Open in IMG/M |
| 3300001723 | Marine viral communities from the Deep Pacific Ocean - MSP-144 | Environmental | Open in IMG/M |
| 3300001726 | Marine viral communities from the Deep Pacific Ocean - MSP-103 | Environmental | Open in IMG/M |
| 3300001727 | Marine viral communities from the Pacific Ocean - LP-55 | Environmental | Open in IMG/M |
| 3300001728 | Marine viral communities from the Pacific Ocean - LP-46 | Environmental | Open in IMG/M |
| 3300001731 | Marine viral communities from the Pacific Ocean - LP-37 | Environmental | Open in IMG/M |
| 3300001743 | Marine viral communities from the Pacific Ocean - LP-38 | Environmental | Open in IMG/M |
| 3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
| 3300002242 | Marine sediment microbial communities from Kolumbo Volcano mats, Greece - white/grey mat | Environmental | Open in IMG/M |
| 3300002511 | Marine viral communities from the Pacific Ocean - ETNP_2_1000 | Environmental | Open in IMG/M |
| 3300002514 | Marine viral communities from the Pacific Ocean - ETNP_6_85 | Environmental | Open in IMG/M |
| 3300002760 | Marine viral communities from the Pacific Ocean - ETNP_6_1000 | Environmental | Open in IMG/M |
| 3300003147 | Planktonic microbial communities from North Pacific Subtropical Gyre | Environmental | Open in IMG/M |
| 3300005400 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV261 | Environmental | Open in IMG/M |
| 3300005514 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV263 | Environmental | Open in IMG/M |
| 3300005521 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV255 | Environmental | Open in IMG/M |
| 3300005522 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV257 | Environmental | Open in IMG/M |
| 3300005594 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV82 | Environmental | Open in IMG/M |
| 3300005953 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_Bottom_ad_3770_LV_A | Environmental | Open in IMG/M |
| 3300005969 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_Bottom_ad_4513_LV_A | Environmental | Open in IMG/M |
| 3300006002 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_NADW_ad_2505m_LV_A | Environmental | Open in IMG/M |
| 3300006012 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_AAIW_ad_750m_LV_A | Environmental | Open in IMG/M |
| 3300006013 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_NADW_ad_2500m_LV_B | Environmental | Open in IMG/M |
| 3300006076 | Microbial communities in diffuse hydrothermal fluids of Manus Basin, Bismarck Sea ? fluid A | Environmental | Open in IMG/M |
| 3300006304 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_1000m | Environmental | Open in IMG/M |
| 3300006308 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0500m | Environmental | Open in IMG/M |
| 3300006310 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_3_0500m | Environmental | Open in IMG/M |
| 3300006313 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0770m | Environmental | Open in IMG/M |
| 3300006315 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT233_1_0770m | Environmental | Open in IMG/M |
| 3300006316 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_1_1000m | Environmental | Open in IMG/M |
| 3300006324 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_1_0500m | Environmental | Open in IMG/M |
| 3300006325 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_0500m | Environmental | Open in IMG/M |
| 3300006326 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_1_0770m | Environmental | Open in IMG/M |
| 3300006332 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_0200m | Environmental | Open in IMG/M |
| 3300006336 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0500m | Environmental | Open in IMG/M |
| 3300006338 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_1_0770m | Environmental | Open in IMG/M |
| 3300006339 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_3_0500m | Environmental | Open in IMG/M |
| 3300006340 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0770m | Environmental | Open in IMG/M |
| 3300006341 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT236_2_0770m | Environmental | Open in IMG/M |
| 3300006347 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_1000m | Environmental | Open in IMG/M |
| 3300006567 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0770m | Environmental | Open in IMG/M |
| 3300006654 | Combined Assembly of Gp0125100, Gp0113270, Gp0125099 | Environmental | Open in IMG/M |
| 3300006726 | Marine viral communities from Cariaco Basin, Caribbean Sea - 28_WHOI_OMZ | Environmental | Open in IMG/M |
| 3300006736 | Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG | Environmental | Open in IMG/M |
| 3300006738 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG | Environmental | Open in IMG/M |
| 3300006751 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG | Environmental | Open in IMG/M |
| 3300006753 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006768 | Marine viral communities from Cariaco Basin, Caribbean Sea - 29_WHOI_OMZ | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006900 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_Bottom_ad_5009_LV_A | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300006923 | Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
| 3300007514 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 2.7-0.2um, replicate a | Environmental | Open in IMG/M |
| 3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
| 3300008216 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar | Environmental | Open in IMG/M |
| 3300008217 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215 | Environmental | Open in IMG/M |
| 3300008218 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s6 | Environmental | Open in IMG/M |
| 3300008220 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 | Environmental | Open in IMG/M |
| 3300008949 | Marine viral communities from Cariaco Basin, Caribbean Sea - 30_WHOI_OMZ | Environmental | Open in IMG/M |
| 3300009030 | Deep subsurface microbial communities from Kermadec Trench to uncover new lineages of life (NeLLi) - N075 metaG | Environmental | Open in IMG/M |
| 3300009370 | Combined Assembly of Gp0127930, Gp0127931 | Environmental | Open in IMG/M |
| 3300009413 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12 | Environmental | Open in IMG/M |
| 3300009418 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 | Environmental | Open in IMG/M |
| 3300009595 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3635_2500 | Environmental | Open in IMG/M |
| 3300009602 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_231 | Environmental | Open in IMG/M |
| 3300009603 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904 | Environmental | Open in IMG/M |
| 3300009612 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3651_4511 | Environmental | Open in IMG/M |
| 3300009619 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3827_250 | Environmental | Open in IMG/M |
| 3300009622 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3321_4155 | Environmental | Open in IMG/M |
| 3300009786 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 | Environmental | Open in IMG/M |
| 3300010151 | Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300011013 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaG | Environmental | Open in IMG/M |
| 3300017705 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_08 viral metaG | Environmental | Open in IMG/M |
| 3300017718 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_11 viral metaG | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300017775 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17 | Environmental | Open in IMG/M |
| 3300020272 | Marine microbial communities from Tara Oceans - TARA_B100001971 (ERX556120-ERR599127) | Environmental | Open in IMG/M |
| 3300020399 | Marine microbial communities from Tara Oceans - TARA_B100000470 (ERX555969-ERR598947) | Environmental | Open in IMG/M |
| 3300021791 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Daikoku_FS921 150_kmer | Environmental | Open in IMG/M |
| 3300021973 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Alice_FS923 _150kmer | Environmental | Open in IMG/M |
| 3300021978 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Perseverance_CTD_V16A_01_btl17 _150kmer | Environmental | Open in IMG/M |
| 3300024344 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024431 | Deep subsurface microbial communities from Kermadec Trench to uncover new lineages of life (NeLLi) - N075 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024517 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_3 | Environmental | Open in IMG/M |
| 3300024518 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2 | Environmental | Open in IMG/M |
| 3300024520 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_1 | Environmental | Open in IMG/M |
| 3300025042 | Marine viral communities from the Pacific Ocean - LP-47 (SPAdes) | Environmental | Open in IMG/M |
| 3300025044 | Marine viral communities from the Pacific Ocean - LP-50 (SPAdes) | Environmental | Open in IMG/M |
| 3300025045 | Marine viral communities from the Pacific Ocean - LP-46 (SPAdes) | Environmental | Open in IMG/M |
| 3300025046 | Marine viral communities from the Pacific Ocean - LP-45 (SPAdes) | Environmental | Open in IMG/M |
| 3300025049 | Marine viral communities from the Pacific Ocean - LP-55 (SPAdes) | Environmental | Open in IMG/M |
| 3300025050 | Marine viral communities from the Pacific Ocean - LP-54 (SPAdes) | Environmental | Open in IMG/M |
| 3300025069 | Marine viral communities from the Pacific Ocean - LP-38 (SPAdes) | Environmental | Open in IMG/M |
| 3300025082 | Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025096 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025109 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025110 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025112 | Marine viral communities from the Pacific Ocean - ETNP_2_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300025114 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025122 | Marine viral communities from the Pacific Ocean - ETNP_2_300 (SPAdes) | Environmental | Open in IMG/M |
| 3300025125 | Marine viral communities from the Pacific Ocean - ETNP_2_1000 (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025131 | Marine viral communities from the Pacific Ocean - ETNP_6_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025133 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025141 | Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes) | Environmental | Open in IMG/M |
| 3300025247 | Marine viral communities from the Deep Pacific Ocean - MSP-91 (SPAdes) | Environmental | Open in IMG/M |
| 3300025259 | Marine viral communities from the Deep Pacific Ocean - MSP-146 (SPAdes) | Environmental | Open in IMG/M |
| 3300025264 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025267 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar (SPAdes) | Environmental | Open in IMG/M |
| 3300025268 | Marine viral communities from the Deep Pacific Ocean - MSP-114 (SPAdes) | Environmental | Open in IMG/M |
| 3300025270 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904 (SPAdes) | Environmental | Open in IMG/M |
| 3300025277 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 (SPAdes) | Environmental | Open in IMG/M |
| 3300025281 | Marine viral communities from the Deep Pacific Ocean - MSP-97 (SPAdes) | Environmental | Open in IMG/M |
| 3300025282 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 (SPAdes) | Environmental | Open in IMG/M |
| 3300025296 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_231 (SPAdes) | Environmental | Open in IMG/M |
| 3300025300 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s6 (SPAdes) | Environmental | Open in IMG/M |
| 3300025301 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 (SPAdes) | Environmental | Open in IMG/M |
| 3300025873 | Marine viral communities from the Pacific Ocean - ETNP_6_1000 (SPAdes) | Environmental | Open in IMG/M |
| 3300026087 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_NADW_ad_2505m_LV_A (SPAdes) | Environmental | Open in IMG/M |
| 3300026263 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV255 (SPAdes) | Environmental | Open in IMG/M |
| 3300027847 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300027868 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_22 | Environmental | Open in IMG/M |
| 3300028022 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750m | Environmental | Open in IMG/M |
| 3300028448 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 300m | Environmental | Open in IMG/M |
| 3300031801 | Marine microbial communities from Western Arctic Ocean, Canada - CB27_Tmax_986 | Environmental | Open in IMG/M |
| 3300031802 | Marine microbial communities from Western Arctic Ocean, Canada - CB6_AW_1057 | Environmental | Open in IMG/M |
| 3300032006 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-200_MG | Environmental | Open in IMG/M |
| 3300032278 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MG | Environmental | Open in IMG/M |
| 3300032820 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MG | Environmental | Open in IMG/M |
| 3300034628 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 543_2961 | Environmental | Open in IMG/M |
| 3300034654 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 487_2244 | Environmental | Open in IMG/M |
| 3300034656 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 502_2477 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Abe_10735702 | 3300001524 | Black Smokers Hydrothermal Plume | MKFLWEKFKAYKEWVLVTVPNRYMGLVLLFMLLVIYFK* |
| TahiMoana_10116402 | 3300001679 | Black Smokers Hydrothermal Plume | MKNIWEKIKAHKENLLVTIPNRYMGLILFLMLLAIYYK* |
| TahiMoana_10188712 | 3300001679 | Black Smokers Hydrothermal Plume | MKYVWEKFKAHKENLLVTLPTRYMGLILFLMLLVIYFK* |
| TahiMoana_10399362 | 3300001679 | Black Smokers Hydrothermal Plume | MKFLWEKCKAYKETLLVTTFNRYQGLILFLMLLAIWYK* |
| JGI24522J20083_10059482 | 3300001717 | Marine | MKFLWEKFKAYKEFVLITVPNRYMGLVLLLMLLAIWYK* |
| JGI24522J20083_10115492 | 3300001717 | Marine | MKFLWEKIKAYKETIFITVPNRYMGMVLFLMLLAIILK* |
| JGI24528J20060_10081782 | 3300001721 | Marine | MKFIWEKLKSYKEWILVTVPNRYMGLVLFLMLLVIYLK* |
| JGI24661J20069_10202302 | 3300001723 | Deep Ocean | MKFLWEKFKAYKEWVLVTIPNRYIGLVLLLMLLAIWYK* |
| JGI24661J20069_10285442 | 3300001723 | Deep Ocean | MKFLWEKCKAAVTFVLVTLPNRYMGLVLLFMLLAIWYK |
| JGI24653J20064_10054363 | 3300001726 | Deep Ocean | MXFLWEKCKAYKEWVLVTIPNRYMGLVLLLILLAIYYK* |
| JGI24529J20061_1039092 | 3300001727 | Marine | MKFLWEKFKAYKEWVLVTIPNRYIGLVLLFMLLVIYFK* |
| JGI24521J20086_10091112 | 3300001728 | Marine | MNFIKFIWEKLKAYREWTLVTVPNRYMGLVLFLMLLVIYLK* |
| JGI24514J20073_10071382 | 3300001731 | Marine | MKFLWEKLKAIKETLLVTAFNRYQGLILFVMLLVIYLK* |
| JGI24514J20073_10074484 | 3300001731 | Marine | MLSRIWQLFNVNKERVLVTFFNKYQGLILFTMLLVIYLK* |
| JGI24514J20073_10116723 | 3300001731 | Marine | MKFLWEKLKAYKEILFVTTFNRYQGLILFIMLVVIYLK* |
| JGI24515J20084_10048262 | 3300001743 | Marine | MKFLWEKCKGAYKWILVTIPNRYMGLVLFVMLLAIILK* |
| JGI24515J20084_10112172 | 3300001743 | Marine | MNFLWEKLKAFKETLFVTTFNRYQGLILFIMLVVIYLK* |
| JGI24515J20084_10152412 | 3300001743 | Marine | MKFLWEKFKAYKEWILVTVPNRYMGLVLFLMLLVIYLK* |
| JGI24515J20084_10191672 | 3300001743 | Marine | MNFIKFIWEKCKAYKEWILVTLPNRYMGVVLILMLLVIYFK* |
| JGI24515J20084_10245881 | 3300001743 | Marine | MKFIWEKLKSYKETLFITIPNRYMGIVLFLMLLAIILK* |
| KVRMV2_1000099933 | 3300002231 | Marine Sediment | MKFIWEKLKAYHEKVFVTLFNKYQGLVLFLMLLAIYFK* |
| KVRMV2_1012450193 | 3300002231 | Marine Sediment | MIHLAWEKLKAMHEMIFITTFNRYQGLVLFLMLLAIYFK* |
| KVWGV2_103649924 | 3300002242 | Marine Sediment | MKIIWEKLKAYHEKVFVTLFNKYQGLVLFLMLLAIYFK* |
| KVWGV2_105711721 | 3300002242 | Marine Sediment | MKFIWEKLKAGHELIFVTTFNRYQGLVLFLMLLAIYFK* |
| JGI25131J35506_10258801 | 3300002511 | Marine | MNFIKFIWEKCKAYKEWMLVTIPNRYMGLVLFLMLLVIYLK* |
| JGI25131J35506_10535041 | 3300002511 | Marine | MNFIKFIWEKLKAYKEILFVTIPNKYMGMVLFLMLLVIYFK* |
| JGI25131J35506_10579591 | 3300002511 | Marine | MLTRIWQWFNINKERVLVTFFNKYQGLILFSMLLVIYLK* |
| JGI25133J35611_101212001 | 3300002514 | Marine | MIHFAWEKLKSIHEIIFVTTFNKYQGLVLFLMLLAIYFK* |
| JGI25136J39404_10360082 | 3300002760 | Marine | MNFIKFIWEKLKAYKETLLVTIPNKYMGMVLVLMLLVIYFK* |
| JGI25136J39404_10662542 | 3300002760 | Marine | MNFIKFIWEKCKAYKEWMLVTVPNRYMGLVLFLMLLVIYLK* |
| Ga0052235_10426373 | 3300003147 | Marine | MNFIKFIWEKFKACVTFILVTVPNRYMGLVLLLMLLVIYLK* |
| Ga0066867_102306041 | 3300005400 | Marine | IMKFVWEKLKAGHESLFVTAFNRYQGLVLFLMLVAIILK* |
| Ga0066866_101091043 | 3300005514 | Marine | MKFLWEKVKAYKQTILVTIPNRYRGIVLLLILLAIWYK* |
| Ga0066862_101377832 | 3300005521 | Marine | MKYLWEKLKAHKELILVTLPNKYMGLVLFLMLLAIWYK* |
| Ga0066861_101401413 | 3300005522 | Marine | MKFAWEKLKSYHETVFVTLFNKYQGLVLFLMLLAIYFK* |
| Ga0066839_101611211 | 3300005594 | Marine | MKYLWEKLKAHKELILVTLPNKYMGLVLFLMLLAIWYR* |
| Ga0066383_101450172 | 3300005953 | Marine | QTNYRRRLMRFLWEKLKACVTFILVTVPNRYMGLVLLLMLLAIWYK* |
| Ga0066369_100952633 | 3300005969 | Marine | MKFLWEKLKAYKEILLVTIPNKYMGMVLVFMLLVIYFK* |
| Ga0066369_101811482 | 3300005969 | Marine | MKFLWEKLMAYKRWVLVIIPNRYMGLVLLFMLLVIYFK* |
| Ga0066369_102890831 | 3300005969 | Marine | MIARIWQWLNINKERVLVTFFNKYQGLILFSMLLVIYLK* |
| Ga0066368_101200102 | 3300006002 | Marine | MNFIKFLWEKFKAYKEWVLVTIPTRYMGLVLLFMLLVIYFK* |
| Ga0066374_102207391 | 3300006012 | Marine | TYTRRRLMKFIWEKLKAIKETILVTAFNRYQGLILFLMLLVIYLK* |
| Ga0066382_101807992 | 3300006013 | Marine | MNFIKFIWEKFKACKEWMLVTVPNRYMGLVLLFMLLVIYFK* |
| Ga0081592_10797883 | 3300006076 | Diffuse Hydrothermal Fluids | MKNIWEKFKAHKETLLVTIPNRYMGLILFLMLLAIYYK* |
| Ga0081592_11300461 | 3300006076 | Diffuse Hydrothermal Fluids | MKFIWEKLKAFKKWVLVTVPNRYMGLVLLLMLLVIYLK* |
| Ga0068504_10605602 | 3300006304 | Marine | MNFIKFIWEKCKAYKEWILVTVPNRYMGLVLFAMLLVIYLK* |
| Ga0068504_10605612 | 3300006304 | Marine | MKFIWEKLKAFKKYTLVTVPNRYMGLVLFAMLLVIYLK* |
| Ga0068470_14966641 | 3300006308 | Marine | MKFLWEKLKAYKEGMLVTVPNRYMGLVLFLMLLVIYLK |
| Ga0068471_11204794 | 3300006310 | Marine | MKFLWEKLKAIKENLLVTAFNRYQGLILFVMLLVIYLK* |
| Ga0068471_11367893 | 3300006310 | Marine | MKFLWEKLKAYREYVLVTAFNRYQGLILFVMLLVIYLK* |
| Ga0068471_12701882 | 3300006310 | Marine | MKFVWEKLKAYKEYVLVTAFNKYQGLILFVMLLVIYLK* |
| Ga0068471_13407283 | 3300006310 | Marine | MKFIWEKLKAIKETLLVTAFNRYQGLILFVMLLVIYLK* |
| Ga0068471_13579362 | 3300006310 | Marine | MKFIWEKLKAYKEYVLVTTFNKYQGLILFVMLLVIYLK* |
| Ga0068471_15558004 | 3300006310 | Marine | MKLLWEKLKAIKEYVLVTAFNRYQGLILFVMLLVIYLK* |
| Ga0068471_16410514 | 3300006310 | Marine | MKFIWEKFKAYKEFIVVQTFNRYQGLILFIMLVVIYLK* |
| Ga0068471_16462071 | 3300006310 | Marine | MNYIWEKFKAFKKYTLITVPNRYMGLVLFAMLLVIYLK* |
| Ga0068472_102564601 | 3300006313 | Marine | RCLMKFIWEKLKAYKEYVLVTTFNKYQGLILFVMLLVIYLK* |
| Ga0068472_102794752 | 3300006313 | Marine | MKFIWEKLKAFKETLLVTAFNRYQGLILFFMLLVIYLK* |
| Ga0068472_106178831 | 3300006313 | Marine | WEKCKAYKETLLVTTFNRYQGLILFLMLLAIWYK* |
| Ga0068487_13241603 | 3300006315 | Marine | TLSTYIGVHMIHLAWEKLKAIHEMIFITTFNRYQGLVLFLMLLAIYLK* |
| Ga0068473_12934211 | 3300006316 | Marine | VTLNRRSYMRYVWEKLKAFKKYTLVTVPNRYMGLVLFVMLLVIYLK* |
| Ga0068476_13395121 | 3300006324 | Marine | CIMKFIWEKLKAIKETLLVTAFNRYQGLILFLMLLVIYLK* |
| Ga0068476_13431982 | 3300006324 | Marine | MKFLWEKLKAIKEMLLVTAFNRYQGLILFVMLLVIYLK* |
| Ga0068501_11315571 | 3300006325 | Marine | MKYVWERFKALKENLLVTIFNRYQGLILFLMLVVIYFK* |
| Ga0068477_12698211 | 3300006326 | Marine | RYVWEKLKAFKKYILVTVPNRYMGLVLFAMLLVIYLK* |
| Ga0068477_14617542 | 3300006326 | Marine | MKFIWEKLKAYKEWVLVTLPNRYMGLVLLLMLVVIYLK* |
| Ga0068500_11571193 | 3300006332 | Marine | MKFIWEKCKAYHQAIFITTFNKYQGLVLFLMLLAIYFK* |
| Ga0068500_13178502 | 3300006332 | Marine | MIHLAWEKLKSIHEMIFITTFNRYQGLVLFLMLLAIYFK* |
| Ga0068500_17849882 | 3300006332 | Marine | MKFVWEKFKSYHEAIFVTLFNKYQGLVLFLMLLAIYFK* |
| Ga0068502_11209446 | 3300006336 | Marine | MNFIWEKLKAYKETLFVTTFNRYQGLILFIMLLVIYLK* |
| Ga0068502_11291074 | 3300006336 | Marine | MKFIWEKLKAIKETLLVTAFNRYQGFILFVMLLVIYLK* |
| Ga0068502_12002744 | 3300006336 | Marine | MHNEFLWEKFKAYKETLFVTTFNRYQGLILFIMLVVIYLK* |
| Ga0068502_13180971 | 3300006336 | Marine | MKFIWEKFKAFKKYTLITVPNRYMGLVLFAMLLVIYLK* |
| Ga0068502_13497062 | 3300006336 | Marine | MHNEILMGKLKAFKESLFVTTFNKYQGLILFLMLLVIYLK* |
| Ga0068502_13995482 | 3300006336 | Marine | MKFIWEKLKAYKEYVLVTSFNRYQGLILFVMLLVIYLK* |
| Ga0068502_14623403 | 3300006336 | Marine | MKFIWEKLKAIKETLFVTTFNRYQGLILFLMLLAIWYK* |
| Ga0068482_11953733 | 3300006338 | Marine | MKFIWEKLKSYKERVLVTIPNRYMGLVLFLMLLVIYLK* |
| Ga0068482_13241543 | 3300006338 | Marine | MNFLWEKCKAYKETLLVTTFNRYQGLILFLMLLAI* |
| Ga0068482_13938561 | 3300006338 | Marine | LMNFLWEKCKAYKETLLVTTFNRYQGLILFLMLLAIWYK* |
| Ga0068481_12043363 | 3300006339 | Marine | MKFLWEKLKAIKETLLVTAFNRYQGLILFLMLLVIYLK* |
| Ga0068481_14085464 | 3300006339 | Marine | MKLIWEKLKAYKEYVLVTAFNRYQGLILFVMLLVIYLK* |
| Ga0068503_101874076 | 3300006340 | Marine | REGTMRFLWEKCKAYKEWVLVTIPNRYMGLVLLLMLLVIYLK* |
| Ga0068503_102867574 | 3300006340 | Marine | MKFLWEKLKAYKEWVLVTLPNRYMGLVLLLMLLAIWYK* |
| Ga0068503_103357993 | 3300006340 | Marine | MKFIWEKLKACPKWVLVTIPNRYMGLVLLVMLLVIYLK* |
| Ga0068503_103358003 | 3300006340 | Marine | MNFIKFIWEKCKAYKEWMLVTLPNRYMGLVLILMLLVIYFK* |
| Ga0068503_104111302 | 3300006340 | Marine | MKNIWEKFKAHKETLLVTIPNRYMGLILFLMLLAICYK* |
| Ga0068503_104362021 | 3300006340 | Marine | MKFIWEKLKAFKETLLVTAFNRYQGLILFLMLLVIYLK* |
| Ga0068503_104389712 | 3300006340 | Marine | MNFIKFIWEKCKAYKEWMLVTLPNRYMGVVLILMLLVIYFK* |
| Ga0068503_104433152 | 3300006340 | Marine | MKFLWEKLMACKEVLLVQTFNRYQGLILFVMLLVIYLK* |
| Ga0068503_104749452 | 3300006340 | Marine | MKFIWEKLKAIKETLLVTAFNRYQGLILFLMLLVIYLK* |
| Ga0068503_105522092 | 3300006340 | Marine | MKYVWEKFKAFKKYTLVTVPNRYMGLVLFAMLLVIYLK* |
| Ga0068503_105842342 | 3300006340 | Marine | MNFIKFIWEKCKAYKEWMLVTLPNRYMGLVLFLMLLVIYLK* |
| Ga0068503_106685912 | 3300006340 | Marine | MKFIWEKLKAIKETILVTAFNRYQGLILFLMLLVIYLK* |
| Ga0068503_111275061 | 3300006340 | Marine | RRRLMKFIWEKLKAIKETLLVTAFNRYQGLILFVMLLVIYLK* |
| Ga0068503_111479131 | 3300006340 | Marine | MKFIWEKLKAYQERILVTVPNMFMGLVLFLMLLVIYLK* |
| Ga0068493_102470723 | 3300006341 | Marine | VTLNRRSYMKFIWEKFKAFKKYILVTVPNRYMGLVLFAMLLVIYLK* |
| Ga0068493_104961562 | 3300006341 | Marine | MKFLWEKLKAYKEWALVTIPNRYMGLVLLLMLLVIYFK* |
| Ga0068493_106334863 | 3300006341 | Marine | MKFLWEKLMACKEFLLVQTFNRYQGLILFVMLLVIYLK* |
| Ga0068493_110170182 | 3300006341 | Marine | MKFLWEKLKAYKEWILVTLPNRYMGLVLLLMLLVIYLK* |
| Ga0099697_11592613 | 3300006347 | Marine | MKFLWEKLKAYKEWVLITIPNRYMGLVLLLMLLVIYLK* |
| Ga0099697_14202303 | 3300006347 | Marine | MKFIWEKLKAFKKYTLVTVPNRYMGLVLLLMLLVIYLK* |
| Ga0099958_13603642 | 3300006567 | Marine | WEKLKAIKETLLVTAVNRYQGLILFLMLLVIYLK* |
| Ga0099958_13793123 | 3300006567 | Marine | TNYRRCIMKFLWEKLKAYKEWVLVTLPNKYMGLVLLLMLLAILYK* |
| Ga0101728_1027162 | 3300006654 | Marine | MKFLWEKFKAYKEWVLVTIPNRYMGLVLLLMLLAIYYK* |
| Ga0101728_1035364 | 3300006654 | Marine | MNFIKFIWEKXXAXKEWXLVTVPNRXMGLXXXXMXLVIYFK* |
| Ga0098070_1036152 | 3300006726 | Marine | MIHFAWEKLKSIHEMIFVTTFNKYQGLVLFLMLLAIYFK* |
| Ga0098033_10543091 | 3300006736 | Marine | NYRRCIMKFLWEKLKAIKETLLVTAFNRYQGLILFLMLLVIYLK* |
| Ga0098033_12061671 | 3300006736 | Marine | MKFLWEKTKAYKEELLVTMMNKYQGLILLIMLLVIWYK* |
| Ga0098035_10452031 | 3300006738 | Marine | DGGIMKFVWEKLKAGHESLFVTAFNRYQGLVLFLMLVAIILK* |
| Ga0098035_11067771 | 3300006738 | Marine | KFVWEKLKAGHESLFVTAFNRYQGLVLFLMLVAIILK* |
| Ga0098035_11097102 | 3300006738 | Marine | MKFVWEKLKAGHESLFVTTFNRYQGLVLFLMLLAIVLK* |
| Ga0098035_11272572 | 3300006738 | Marine | MIHFAWEKLKAIHEMIFVTTFNKYQGLVLFLMLLAIYFK* |
| Ga0098035_12234481 | 3300006738 | Marine | MKCVWEKFKSYHEAIFVTLFNKYQGLVLFLMLLAIYFK* |
| Ga0098040_10084481 | 3300006751 | Marine | MKFAWEKLKSYHEAVFVTLFNKYQGLVLFLMLLAIYFK* |
| Ga0098040_10166872 | 3300006751 | Marine | MKFVWEKLKAGHESLFVTAFNRYQGLVLFLMLVAIILK* |
| Ga0098040_10477713 | 3300006751 | Marine | MIHLAWEKLKSIHELIFVTTFNRYQGLVLFLMLLAIYFK* |
| Ga0098040_10844131 | 3300006751 | Marine | MIAKIWNKFNDIFNHQLLVTLPNRYQGLILFVMLVVIYLK* |
| Ga0098039_10120055 | 3300006753 | Marine | MLSRIWQWFNVNKERVLVTFPNKYQGLILFTMLLVIYLK* |
| Ga0098039_12168232 | 3300006753 | Marine | MKFVWEKCKACHQTIFVTLFNKYQGLVLFLMLLAIYFK* |
| Ga0098039_12799951 | 3300006753 | Marine | MKFIWEKLKAYKEYILVTTFNKYQGLILFVMLLVIYLK* |
| Ga0098039_13292992 | 3300006753 | Marine | MKFVWEKLKAYKEYVLVTTFNKYQGLILFVMLLVIYLK* |
| Ga0098039_13386742 | 3300006753 | Marine | MKFLWEKVKAYKQTILVTIPNRYRGVVLLLILLAIWYK* |
| Ga0098044_11346252 | 3300006754 | Marine | MKCVWEKFKSYHEAIFVTLFNKYQGLVLFLMLLTIYFK* |
| Ga0098044_13796732 | 3300006754 | Marine | MIKFLWEKLKAYHQAIFVTLFNKYQGLVLFLMLLAIYFK* |
| Ga0098071_1171991 | 3300006768 | Marine | MKFVWEKLKAGHESVFVTAFNRYQGLVLFLMLLAIILK* |
| Ga0098054_11300753 | 3300006789 | Marine | MIHLAWEKLKAIHEMIFVTTFNKYQGLVLFLMLLAIYFK* |
| Ga0098055_12724032 | 3300006793 | Marine | MKFLWEKLKAIKETLLVTAFNRYQGFILFVMLLVIYLK* |
| Ga0066376_100594494 | 3300006900 | Marine | MVSRIWQWLNINKERVLVTFFNKYQGLILFSMLLVIYLK* |
| Ga0098060_11364661 | 3300006921 | Marine | MKFVWEKLKAGHESLFVTAFNRYQGLVLFLMLLAIILK* |
| Ga0098060_11604862 | 3300006921 | Marine | MKFAWEKLKSYHETIFVTLFNRYQGFVLFLMLVAIILK* |
| Ga0098045_11386451 | 3300006922 | Marine | LAWEKLKAIHELIFITTFNRYQGLVLFLMLLAIYFK* |
| Ga0098053_11067402 | 3300006923 | Marine | MKFLWEKTKAYKEELLVTMMNKYQGLILLIMLLVI* |
| Ga0098036_10046518 | 3300006929 | Marine | MKFIWDKCIAGVTFTLVTIPNRYQGLILFIMLLAIYYK* |
| Ga0098036_10366923 | 3300006929 | Marine | MIHLAWEKLKAIHELIFITTFNRYQGLVLFLMLLAIYFK* |
| Ga0098036_10383452 | 3300006929 | Marine | MKFIWEKFKAYREFLLVQTFNRYQGLILFIMLVVIYLKP* |
| Ga0098036_10821724 | 3300006929 | Marine | MKFIWEKFKAYKEYILVTVFNRYQGLILFLMLLVIYLK* |
| Ga0098036_10927922 | 3300006929 | Marine | MKFIWEKFKAFKELLLVTTFNKYQGLILFVMLLVIYLK* |
| Ga0098046_10695273 | 3300006990 | Marine | MKFVWEKLKAGHESLFITAFNRYQGLVLFLMLLVIY |
| Ga0105020_12521912 | 3300007514 | Marine | MIAKIWNKFNDIFNHQLLVTLPNRYQGLILFVMLLVIYLK* |
| Ga0098052_10272251 | 3300008050 | Marine | MKFVWEKLKAGHESLFVTAFNRYQGLVLFLMLVAIIL |
| Ga0098052_11880863 | 3300008050 | Marine | MIKFLWEKLKAYHQAIFVTLFNKYQGLVLFLMLLAIYFE* |
| Ga0098052_12778482 | 3300008050 | Marine | MKFIWEKIKAFKESLFVTTFNRYQGLILFVMLLVIYLK* |
| Ga0098052_13150881 | 3300008050 | Marine | MMFIWEKFKALKESLLVTTFNKYQGLILFVMLLVIYLK* |
| Ga0114898_10051995 | 3300008216 | Deep Ocean | MKFLWQKFKACKRELLISIPNRYMGLVLLLMLLVIYFK* |
| Ga0114898_10159545 | 3300008216 | Deep Ocean | MKFIWEKLKAIKEGALVTVPNRYMGLILLLMLLAIWYK* |
| Ga0114898_10285553 | 3300008216 | Deep Ocean | MKFLWEKIKAYKEIIFITIPNRYMGIVLFLMLLAIILK* |
| Ga0114898_11470222 | 3300008216 | Deep Ocean | MKFLWEKLKAIKETILVTAFNRYQGLILFVMLLVIYLK* |
| Ga0114899_10211542 | 3300008217 | Deep Ocean | MKFLWQKLKVYKTLLLISIPNKYQGLILFLMLLAIWYK* |
| Ga0114899_10451393 | 3300008217 | Deep Ocean | MKFLWEKFKAFKESLLVTTFNKYQGLILFLMLLVIYLK* |
| Ga0114899_10553522 | 3300008217 | Deep Ocean | MKFIWEKFKAYKEWMLVTIPNRYMGLVLFLMLLVIYLK* |
| Ga0114899_10692823 | 3300008217 | Deep Ocean | MKFIWEKIKAFKESLFVTTFNRYQGLILFLMLLVIYLK* |
| Ga0114904_10554443 | 3300008218 | Deep Ocean | MKYAWEKFNAYKTLLLISIPNKYQGLILFLMLLAIWYK |
| Ga0114910_10282403 | 3300008220 | Deep Ocean | MKFIWEKLKAYKEVILVTVPTRYMGLVLLLMLLAILYK* |
| Ga0114910_12275691 | 3300008220 | Deep Ocean | MKFLWQKLKAYETLLLISIPNKYQGLILFVMLLVIYLK |
| Ga0098072_1145482 | 3300008949 | Marine | MKYVWEKLKACKRELLISIPNRYMGLVLLLMLLVIYLK* |
| Ga0114950_110427712 | 3300009030 | Deep Subsurface | MKFIWEKLKAYKKWVLVTVPNRYMGLVLLLMLLVIYLK* |
| Ga0118716_12165391 | 3300009370 | Marine | MIHFAWEKLKSIHEMIFVTTFNKYQGLVLFLMLLAIY |
| Ga0118716_12356842 | 3300009370 | Marine | MKFLWEKIKAFKESIFVTTFNRYQGLILFIMLVVIYLK* |
| Ga0114902_10732343 | 3300009413 | Deep Ocean | MKFIWEKIKAFKESLFVTTFNRYQGLILFIMLLVIYLK* |
| Ga0114908_10344333 | 3300009418 | Deep Ocean | MKFIWENLKAIKETFLVTAFNRYQGLILFLMLLVIYLK* |
| Ga0114908_11929571 | 3300009418 | Deep Ocean | MKYAWEKFNAYKTLLLISIPNKYQGLILFLMLLAIWYK* |
| Ga0105214_1050142 | 3300009595 | Marine Oceanic | MKNIWEKIKAHKENLLVTIPNRYMGLILFLMLLAIYYR* |
| Ga0114900_10273822 | 3300009602 | Deep Ocean | MKFLWEKFKSYKEWVLVTVPNRYMGLVLLLMLLAIWYK* |
| Ga0114900_10461304 | 3300009602 | Deep Ocean | MKFLWEKLKAIKETILVTAFNRYQGLILFLMLLVIYLK* |
| Ga0114900_11554922 | 3300009602 | Deep Ocean | MKFVWEKLKAMHESVFITTFNRYQGLVLFLMLLAIILK |
| Ga0114911_10085361 | 3300009603 | Deep Ocean | MKFLWEKIKAYKEIIFITIPNRYMGIVLFLMLLAI |
| Ga0105217_1106731 | 3300009612 | Marine Oceanic | MKFIWEKLKAFKKYTLVTVPNRYQGLILFAMLLVIYLK* |
| Ga0105236_10566811 | 3300009619 | Marine Oceanic | MKFIWEKLKAIKETILVTAFNRYQGLILFVMLLVIY |
| Ga0105173_10779401 | 3300009622 | Marine Oceanic | MKNIWEKFKAYQTKLLVTIPNRYMGLVLLGMLLVIYLK* |
| Ga0114999_103086832 | 3300009786 | Marine | MIKFIWEKFKAYKENLFVTIPNRYMGLILFLMLLAIWYK* |
| Ga0098061_11925262 | 3300010151 | Marine | MKFIWEKLKAAHESVFITTFNRYQGLVLFLMLVAIILK* |
| Ga0098061_12554202 | 3300010151 | Marine | FVWEKLKAGHESLFVTAFNRYQGLVLFLMLVAIILK* |
| Ga0098059_11901293 | 3300010153 | Marine | EPMKCVWEKFKSYHEAIFVTLFNKYQGLVLFLMLLAIYFK* |
| Ga0114934_103571201 | 3300011013 | Deep Subsurface | STYIGGTMKFIWEKLKAGHELIFVTTFNRYQGLVLFLMLLAIYYK* |
| Ga0181372_10954241 | 3300017705 | Marine | MKLLWEKLKAIKEYVLVTAFNRYQGLILFVMLLVI |
| Ga0181375_10272402 | 3300017718 | Marine | MKFLWEKLKAIKEMLLVTAFNRYQGLILFVMLLVIYLK |
| Ga0181385_11256772 | 3300017764 | Seawater | GGIMKFFWEKIKATHERLFVTTFNRYQGLVLFLMLLAIYYK |
| Ga0181432_11786562 | 3300017775 | Seawater | MKFIWEKLKSYKETLFITIPNRYMGIVLFLMLLAIILK |
| Ga0181432_12071882 | 3300017775 | Seawater | IWEKFKACKRELLISIPNRYMGLVLFLMLLVIYLK |
| Ga0211566_10194594 | 3300020272 | Marine | MKYLWEKLKAHKELILVTLPNKYMGLVLFLMLLAIWYK |
| Ga0211623_101294273 | 3300020399 | Marine | MKFLWEKLKAIKETLLVTAFNRYQGFILFVMLLVIYLK |
| Ga0226832_100046685 | 3300021791 | Hydrothermal Vent Fluids | MKFIWEKIKAFKESLFVTTFNRYQGLILFVMLLVIYLK |
| Ga0226832_100095198 | 3300021791 | Hydrothermal Vent Fluids | MMFIWEKLKSYKEYLLITIPNKYMGLVLFLMLLAIWYK |
| Ga0226832_102364862 | 3300021791 | Hydrothermal Vent Fluids | MKFIWEKIKAFKESLFVTTFNRYQGLILFIMLLVIYLK |
| Ga0226832_104337642 | 3300021791 | Hydrothermal Vent Fluids | MKFLWEKIKAYKEIIFITIPNRYMGIVLFLMLLAIILK |
| Ga0232635_11254112 | 3300021973 | Hydrothermal Vent Fluids | MNFIKFIWEKFKACKEGVLVTVPNRYMGLVLLFMLLVIYFK |
| Ga0232646_11164842 | 3300021978 | Hydrothermal Vent Fluids | MKFLWEKLKAYKEWVLITVPNQYMGLILLLMLLVIYFK |
| Ga0232646_11293442 | 3300021978 | Hydrothermal Vent Fluids | MKFIWEKLKAYKKWVLVTVPNRYMGLVLLLMLLVIYLK |
| Ga0209992_100242822 | 3300024344 | Deep Subsurface | MKIIWEKLKAYHEKVFVTLFNKYQGLVLFLMLLAIYFK |
| Ga0209988_107168092 | 3300024431 | Deep Subsurface | MKFLWEKFKAYKEILLVTIPNKYMGMVLVFMLLVIYFK |
| (restricted) Ga0255049_101692173 | 3300024517 | Seawater | MKFLWEKLKAYREYVLVTAFNRYQGLILFVMLLVIYLK |
| (restricted) Ga0255048_1000082415 | 3300024518 | Seawater | MNFIWEKLKAFKETLFVTTFNRYQGLILFIMLVVIYLK |
| (restricted) Ga0255047_105777941 | 3300024520 | Seawater | MKFLWEKLKAIKETILVTAFNRYQGLILFVMLLVIYLK |
| Ga0207889_10116993 | 3300025042 | Marine | MKFLWEKIKAYKETIFITVPNRYMGMVLFLMLLAIILK |
| Ga0207889_10117522 | 3300025042 | Marine | MKFLWEKFKAYKEFVLITVPNRYMGLVLLLMLLAIWYK |
| Ga0207891_10190153 | 3300025044 | Marine | MKFIWEKLKAFKKYTLVTVPNRYQGLILFAMLLVIYLK |
| Ga0207901_10007747 | 3300025045 | Marine | MLSRIWQLFNVNKERVLVTFFNKYQGLILFTMLLVIYLK |
| Ga0207901_10011717 | 3300025045 | Marine | LMKFLWEKLKAYKEILFVTTFNRYQGLILFIMLVVIYLK |
| Ga0207901_10248722 | 3300025045 | Marine | MKFLWEKLKAIKETLLVTAFNRYQGLILFVMLLVIYLK |
| Ga0207901_10486252 | 3300025045 | Marine | MKFLWEKIKAYKETLFITVPNRYMGIVLFLMLLAIILK |
| Ga0207902_10241682 | 3300025046 | Marine | MKFIWEKLKAIKETILVTAFNRYQGLILFLMLLVIYLK |
| Ga0207898_10386142 | 3300025049 | Marine | MKFLWGKCKACVTFILVTLPNRYMGLVLLLMLLAIWYK |
| Ga0207898_10518781 | 3300025049 | Marine | MKFLWEKFKAIKESLLVTTFNKYQGLILFLMLLAI |
| Ga0207892_10039881 | 3300025050 | Marine | MKFLWEKIKAYKEYILVTVFNRYQGLILFLMLLVIYLK |
| Ga0207892_10411662 | 3300025050 | Marine | MKFMWEKLKAYKEWILVTLPNRYMGLVLLLMLLAI |
| Ga0207887_10078135 | 3300025069 | Marine | MNFIKFIWEKLKAYREWTLVTVPNRYMGLVLFLMLLVIYLK |
| Ga0207887_10299721 | 3300025069 | Marine | MKFLWEKIKAYKETIFITVPNRYMGIVLFLMLLAIILK |
| Ga0207887_10735502 | 3300025069 | Marine | MKFIWEKLKAIKETLLVTAFNRYQGLILFLMLLVIYLK |
| Ga0207887_10848862 | 3300025069 | Marine | MKFLWEKLMACKEFLLVQTFNRYQGLILFLMLLVIY |
| Ga0207887_10865642 | 3300025069 | Marine | MKFLWEKLMACKEFLLVQTFNRYQGLILFVMLVII |
| Ga0208156_10267853 | 3300025082 | Marine | MKFIWEKLKAIKETLLVTAFNRYQGLILFVMLLVIYLK |
| Ga0208011_10038982 | 3300025096 | Marine | MKCVWEKFKSYHEAIFVTLFNKYQGLVLFLMLLAIYFK |
| Ga0208011_10064734 | 3300025096 | Marine | MKFLWEKTKAYKEELLVTMMNKYQGLILLIMLLVIWYK |
| Ga0208011_10357811 | 3300025096 | Marine | MKFIWEKFKAYKEFIVVQTFNRYQGLILFIMLVVIYLK |
| Ga0208011_10700511 | 3300025096 | Marine | FIWEKLKACKEFLLVQTFNRYQGLILFVMLVVIYLK |
| Ga0208553_10044532 | 3300025109 | Marine | MKFLWEKVKAYKQTILVTIPNRYRGIILLLILLAIWYK |
| Ga0208158_10062225 | 3300025110 | Marine | MKFVWEKLKAGHESLFVTAFNRYQGLVLFLMLVAIILK |
| Ga0209349_10022321 | 3300025112 | Marine | LSTYGGTMKFVWEKLKAGHESLFVTAFNRYQGLVLFLMLVAIILK |
| Ga0209349_10457121 | 3300025112 | Marine | MKFVWEKLKAGHESLFVTAFNRYQGLVLFLMLVAI |
| Ga0208433_10799832 | 3300025114 | Marine | MKFVWEKLKAGHESLFVTTFNRYQGLVLFLMLLAIVLK |
| Ga0209434_11065622 | 3300025122 | Marine | MKFIWEKLKAAHESVFITTFNRYQGLVLFLMLLAIILK |
| Ga0209644_10010832 | 3300025125 | Marine | MKFLWEKFKAYQEWVLVTVPNRYMGLVLLLMLLAIWYK |
| Ga0209644_10250961 | 3300025125 | Marine | MNFIKYIWEKLKAYKEWMLVTLPNRYMGLVLFLMLLV |
| Ga0209644_10253943 | 3300025125 | Marine | MKFIWEKLKACPKWVLVTIPNRYMGLVLLLMLLVIYLK |
| Ga0209644_10335372 | 3300025125 | Marine | MKNIWEKFKAHKETLLVTIPNRYMGLILFLMLLAICYK |
| Ga0209644_10404223 | 3300025125 | Marine | TYVRRRIMKFLWEKLMACKKWVLVTIPNRYMGLVLLLMLLVIYLK |
| Ga0209644_10404973 | 3300025125 | Marine | MKFLWEKLNAYKEWMLVTLPNRYMGLVLILMLLVIYLK |
| Ga0209644_10649901 | 3300025125 | Marine | MKFIWEKLKAYKEYVLVTSFNRYQGLILFVMLLVIYL |
| Ga0209644_10779351 | 3300025125 | Marine | MKFIWENLKAIKETLLVTAFNRYQGLILFVMLLVIYLK |
| Ga0209644_10814581 | 3300025125 | Marine | MKFIWEKLKALKESVLVTTFNRYQGLILFVMLLVIYLK |
| Ga0209644_10915803 | 3300025125 | Marine | MKFIWEKLKAIKETILVTAFNRYQGLILFLMLLVIYL |
| Ga0209644_10992611 | 3300025125 | Marine | MKFLWEKLKAYKETLLITIPNKYMGLVLLLMLLVIYLK |
| Ga0209644_11004652 | 3300025125 | Marine | MKFIWEKLKAIKETLLVTAFNKYQGLILFLMLLVIYLK |
| Ga0209644_11130712 | 3300025125 | Marine | MKFLWEKFKAYKERVLVTVPNRYMGLVLFLMLLVIYLK |
| Ga0209644_11171532 | 3300025125 | Marine | MKFIWEKLKAFKETLLVTAFNRYQGLILFLMLLVIYLK |
| Ga0209644_11316171 | 3300025125 | Marine | MKFIWEKLKAYKEYILVTVFNRYQGLILFLMLLVIYLK |
| Ga0209644_11557542 | 3300025125 | Marine | MKFIWEKLKAYKEILLVTIPNKYMGMVLIFMLLVIYF |
| Ga0209644_11673162 | 3300025125 | Marine | MKFLWEKLKALKESVLVTTFNKYQGLILFAMLLVIYFK |
| Ga0209644_11703962 | 3300025125 | Marine | MKLIWERLKAVKETLLVTAFNRYQGLILFLMLLVI |
| Ga0209644_11716721 | 3300025125 | Marine | MNFIKFIWEKLKAYKEILFVTIPNKYMGMVLFLMLLVIYFK |
| Ga0208919_10016234 | 3300025128 | Marine | MKFIWEKFKAFKELLLVTTFNKYQGLILFVMLLVIYLK |
| Ga0208919_10076468 | 3300025128 | Marine | MKFIWDKCIAGVTFTLVTIPNRYQGLILFIMLLAIYYK |
| Ga0208919_11382382 | 3300025128 | Marine | MKFIWEKFKAYKEYILVTVFNRYQGLILFLMLLVIYLK |
| Ga0209128_11613291 | 3300025131 | Marine | MIKFLWEKLKAYHQAIFVTLFNKYQGLVLFLMLLAIYFK |
| Ga0208299_100367410 | 3300025133 | Marine | MKFLWEKIKAFKESIFVTTFNRYQGLILFIMLVVIYLK |
| Ga0209756_10234604 | 3300025141 | Marine | MKFVWEKLKAGHESLFVTAFNRYQGLVLFLMLVAILLK |
| Ga0209756_13058391 | 3300025141 | Marine | TNHRRSLMKFIWEKFKAYKEFIVVQTFNRYQGLILFIMLVVIYLK |
| Ga0207880_10446622 | 3300025247 | Deep Ocean | MKFLWEKLKAYKEWGLVTIPNRYMGLVLLLMLLVIYLK |
| Ga0207876_10155903 | 3300025259 | Deep Ocean | MKFLWEKCKAYKEWALVTIPNRYMGLVLLLILLAIYYK |
| Ga0208029_10026573 | 3300025264 | Deep Ocean | MKFLWQKLKVYKTLLLISIPNKYQGLILFLMLLAIWYK |
| Ga0208179_10061774 | 3300025267 | Deep Ocean | MKFIWEKLKAIKEGALVTVPNRYMGLILLLMLLAIWYK |
| Ga0208179_11146001 | 3300025267 | Deep Ocean | TYVGRCIMMFIWEKFKALKESLLVTTFNKYQGLILFVMLLVIYLK |
| Ga0207894_10609431 | 3300025268 | Deep Ocean | RCLMKFLWEKLKAIKETLLVTAFNRYQGFILFVMLLVIYLK |
| Ga0208813_10830282 | 3300025270 | Deep Ocean | MKFLWEKIKAYKEIIFITIPNRYMGIVLFLMLLAII |
| Ga0208180_10866462 | 3300025277 | Deep Ocean | MKFLWEKFKAFKESLLVTTFNKYQGLILFLMLLVIYLK |
| Ga0207881_10296603 | 3300025281 | Deep Ocean | MKFLWEKCKAYKEWVLVTIPNRYMGLVLLLMLLAIYYK |
| Ga0208030_10312415 | 3300025282 | Deep Ocean | MKFIWEKIKAFKESLFVTTFNRYQGLILFLMLLVIYLK |
| Ga0208316_10033735 | 3300025296 | Deep Ocean | MKFLWQKFKACKRELLISIPNRYMGLVLLLMLLVIYFK |
| Ga0208181_10761081 | 3300025300 | Deep Ocean | MNFLWEKCKAYKETLLVTTFNRYQGLILFLMLLAIWYK |
| Ga0208450_10258222 | 3300025301 | Deep Ocean | MKFIWEKLKAYKEVILVTVPTRYMGLVLLLMLLAILYK |
| Ga0209757_100007602 | 3300025873 | Marine | MLARIWQWLNVNKERVLVTFFNKYQGLILFSMLLVIYLK |
| Ga0209757_100049432 | 3300025873 | Marine | MKYVWEKFKALKETLLVTNFNKYQGLILFLMLLVIYFK |
| Ga0209757_100214044 | 3300025873 | Marine | MKNIWEKFKAHKEKLLVTTPNRYMGLVLFAMLLVIYLK |
| Ga0209757_100347403 | 3300025873 | Marine | MKYVWEKLKAHKENLLVSIPNRYMGLILFLMLLVIYLK |
| Ga0209757_100601504 | 3300025873 | Marine | MKFIWEKFKAYKEFIVVQTFNRYQGLILFIMLVVIYL |
| Ga0209757_100615521 | 3300025873 | Marine | MKFIWEKLKAYKEYVLVTSFNRYQGLILFVMLLVIYLK |
| Ga0209757_100621173 | 3300025873 | Marine | MKFLWEKLKAYKETLLITIPNKYMGLVLLLMLLVIYSK |
| Ga0209757_100624973 | 3300025873 | Marine | CLMKFLWEKFKACKKWVLVTIPNRYMGLVLLLMLLAIWYK |
| Ga0209757_100652073 | 3300025873 | Marine | MRYVWEKLKAFKKYILVTVPNRYMGLVLLLMLLVIYLK |
| Ga0209757_100706632 | 3300025873 | Marine | MKFIWEKLKAYKEWILVTVPNRYMGLVLLLMLLAIWYK |
| Ga0209757_100755963 | 3300025873 | Marine | MKFLWEQLKAYKEWVLVTIPNRYMGLVLLFMLLVIYFK |
| Ga0209757_100796062 | 3300025873 | Marine | MKFIWEKLKAIKEEVLVTIPNRYMGLVLLLMLLAIWYK |
| Ga0209757_100802572 | 3300025873 | Marine | MKFMWEKLKAYKEWILVTLPNRYMGLVLLLMLLVIYLK |
| Ga0209757_101062311 | 3300025873 | Marine | MKFIWEKLKAFKKWVLVTVPNRYMGLVLLLMLLVIYFK |
| Ga0209757_101181553 | 3300025873 | Marine | MKYVWEKFKAFKKYTLVTVPNRYMGLVLFAMLLVIYLK |
| Ga0209757_101417252 | 3300025873 | Marine | MKYVWEKFKAHKENLLVTLPNKYMGLILFLMLLVIYLR |
| Ga0209757_101818403 | 3300025873 | Marine | MKFIWEKLKAYKEYILVTVFNRYQGLILFLMLLVI |
| Ga0209757_101909161 | 3300025873 | Marine | RRCIMKFLWEKLKAYKEWVLVTLPNRYMGLVLLLMLLVIYLK |
| Ga0209757_102446942 | 3300025873 | Marine | MKFLWKKLMACKEFLLVQTFNRYQGLILFVMLVIIYLK |
| Ga0209757_102718692 | 3300025873 | Marine | MKFLWEKLKAYKEILLVTVPNKYMGMVLVFMLLVIYFK |
| Ga0208113_10679911 | 3300026087 | Marine | NRRCYMRYVWEKLKAHKENLLVTIPNRYMGLILFLMLVVIYLK |
| Ga0207992_11707753 | 3300026263 | Marine | MKFLWEKVKAYKQTILVTIPNRYRGIVLLLILLVI |
| Ga0209402_103336832 | 3300027847 | Marine | MIKFIWEKFKAYKENLFVTIPNRYMGLILFLMLLAIWYK |
| (restricted) Ga0255053_105979041 | 3300027868 | Seawater | MNFIWEKIKAFKETLFVTIFNRYQGLILFIMLVVIYLK |
| Ga0256382_10061605 | 3300028022 | Seawater | MNFIKFIWEKCKAYQEWMLVTLPNRYMGLVLILMLLVIYLK |
| Ga0256382_10096663 | 3300028022 | Seawater | MMFIWEKFKALKESLLVTTFNKYQGLILFVMLLVIYLK |
| Ga0256383_1006434 | 3300028448 | Seawater | MIKFIWEKIKTFKEALLVTTFNRYQGLILFVMLLVIYLK |
| Ga0310121_100046486 | 3300031801 | Marine | MKFLWEKLKAYKEILLVTIPNKYMGMVLIFMLLVIYLK |
| Ga0310121_100855232 | 3300031801 | Marine | MKFLWEKIKAYKETIFITLPNRYMGIVLFLMLLAIILK |
| Ga0310121_100864156 | 3300031801 | Marine | MKFLWEKLKAYKEFVLITVPNRYMGLVLLLMLLAIWYK |
| Ga0310123_100783444 | 3300031802 | Marine | MKFLWEKFKAYKETLLVTIPNKYMGLVLLLMLLVIYFK |
| Ga0310123_102848833 | 3300031802 | Marine | MKFLWEKLKAYKETLLVTIPNRYMGLVLLLMLLVIYFK |
| Ga0310123_103104802 | 3300031802 | Marine | MKFLWEKLMAYKKWVLVTIPNRYMGLVLLFMLIVIYFK |
| Ga0310344_100144682 | 3300032006 | Seawater | MIHLVWERFKQYREHVLVTFFNKYQGLILFVMLLAIWYK |
| Ga0310345_100241724 | 3300032278 | Seawater | MLSRIWQWFNVNKERVLVTFPNKYQGLILFTMLLVIYLK |
| Ga0310342_1030169332 | 3300032820 | Seawater | MKLLWEKLKAIKEYVLVTAFNRYQGLILFVMLLVIYLK |
| Ga0326755_035615_263_379 | 3300034628 | Filtered Seawater | MKFLWEKLKAFKETLLVTAFNRYQGLILFLMLLVIYLK |
| Ga0326741_003555_2408_2527 | 3300034654 | Filtered Seawater | MIARIWQWLNINKERVLVTFFNKYQGLILFSMLLVIYLK |
| Ga0326748_020680_3_128 | 3300034656 | Filtered Seawater | RRIMKFLWEKCKAYKEWVLVTIQNRYMGLVLLLILLAIYYK |
| Ga0326748_070506_395_499 | 3300034656 | Filtered Seawater | MKFLWEKLMACKKWVLVTVPNRYMGLVLLFMLFAL |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |