NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F010560

Metagenome / Metatranscriptome Family F010560

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F010560
Family Type Metagenome / Metatranscriptome
Number of Sequences 302
Average Sequence Length 43 residues
Representative Sequence GAKLEMLWRYEQYFYPGDGWASGFMTREGSTGLIRVDIRP
Number of Associated Samples 227
Number of Associated Scaffolds 302

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.78 %
% of genes near scaffold ends (potentially truncated) 88.74 %
% of genes from short scaffolds (< 2000 bps) 87.42 %
Associated GOLD sequencing projects 209
AlphaFold2 3D model prediction Yes
3D model pTM-score0.31

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (93.046 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(22.517 % of family members)
Environment Ontology (ENVO) Unclassified
(33.444 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(52.649 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 25.00%    Coil/Unstructured: 75.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.31
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 302 Family Scaffolds
PF08241Methyltransf_11 16.89
PF13489Methyltransf_23 4.97
PF00685Sulfotransfer_1 4.64
PF10459Peptidase_S46 1.66
PF01066CDP-OH_P_transf 1.66
PF13211DUF4019 1.32
PF13091PLDc_2 0.99
PF13469Sulfotransfer_3 0.66
PF13649Methyltransf_25 0.66
PF13847Methyltransf_31 0.66
PF04402SIMPL 0.33
PF02899Phage_int_SAM_1 0.33
PF05960DUF885 0.33
PF01988VIT1 0.33
PF13676TIR_2 0.33
PF06144DNA_pol3_delta 0.33
PF01344Kelch_1 0.33
PF09424YqeY 0.33
PF13508Acetyltransf_7 0.33
PF01148CTP_transf_1 0.33
PF02915Rubrerythrin 0.33
PF13884Peptidase_S74 0.33
PF01128IspD 0.33
PF03447NAD_binding_3 0.33
PF12847Methyltransf_18 0.33

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 302 Family Scaffolds
COG5050sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferasesLipid transport and metabolism [I] 1.66
COG1183Phosphatidylserine synthaseLipid transport and metabolism [I] 1.66
COG0558Phosphatidylglycerophosphate synthaseLipid transport and metabolism [I] 1.66
COG2068CTP:molybdopterin cytidylyltransferase MocACoenzyme transport and metabolism [H] 0.33
COG4974Site-specific recombinase XerDReplication, recombination and repair [L] 0.33
COG4973Site-specific recombinase XerCReplication, recombination and repair [L] 0.33
COG4805Uncharacterized conserved protein, DUF885 familyFunction unknown [S] 0.33
COG3471Predicted secreted (periplasmic) proteinFunction unknown [S] 0.33
COG2968Uncharacterized conserved protein YggE, contains kinase-interacting SIMPL domainFunction unknown [S] 0.33
COG2859Outer membrane channel-forming protein BP26/OMP28, SIMPL familyCell wall/membrane/envelope biogenesis [M] 0.33
COG2812DNA polymerase III, gamma/tau subunitsReplication, recombination and repair [L] 0.33
COG1814Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 familyInorganic ion transport and metabolism [P] 0.33
COG1633Rubrerythrin, includes spore coat protein YhjRInorganic ion transport and metabolism [P] 0.33
COG1466DNA polymerase III, delta subunitReplication, recombination and repair [L] 0.33
COG12112-C-methyl-D-erythritol 4-phosphate cytidylyltransferaseLipid transport and metabolism [I] 0.33
COG1207Bifunctional protein GlmU, N-acetylglucosamine-1-phosphate-uridyltransferase/glucosamine-1-phosphate-acetyltransferaseCell wall/membrane/envelope biogenesis [M] 0.33
COG0746Molybdopterin-guanine dinucleotide biosynthesis protein ACoenzyme transport and metabolism [H] 0.33


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms93.05 %
UnclassifiedrootN/A6.95 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090014|GPIPI_16589056All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1390Open in IMG/M
2088090014|GPIPI_16808372All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1561Open in IMG/M
2170459005|F1BAP7Q02GSK7YAll Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium532Open in IMG/M
2170459023|GZGNO2B02HZ8TLAll Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium514Open in IMG/M
3300000559|F14TC_103814977All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium758Open in IMG/M
3300000709|KanNP_Total_F14TBDRAFT_1023629All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium517Open in IMG/M
3300000886|AL3A1W_1568666All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300000890|JGI11643J12802_11324857All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300000955|JGI1027J12803_100603539All Organisms → cellular organisms → Bacteria1355Open in IMG/M
3300000955|JGI1027J12803_102879040All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1232Open in IMG/M
3300000955|JGI1027J12803_106802323All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium625Open in IMG/M
3300000955|JGI1027J12803_107175788All Organisms → cellular organisms → Bacteria1284Open in IMG/M
3300001431|F14TB_100087121All Organisms → cellular organisms → Bacteria → Proteobacteria1665Open in IMG/M
3300001686|C688J18823_10290607All Organisms → cellular organisms → Bacteria1076Open in IMG/M
3300002126|JGI24035J26624_1009041All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium978Open in IMG/M
3300002128|JGI24036J26619_10140834All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium505Open in IMG/M
3300004114|Ga0062593_102485420All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium586Open in IMG/M
3300004157|Ga0062590_100081024All Organisms → cellular organisms → Bacteria → Proteobacteria1967Open in IMG/M
3300004463|Ga0063356_103547245All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300005093|Ga0062594_101898005All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium632Open in IMG/M
3300005171|Ga0066677_10082335All Organisms → cellular organisms → Bacteria1674Open in IMG/M
3300005171|Ga0066677_10584217All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300005172|Ga0066683_10464886All Organisms → cellular organisms → Bacteria774Open in IMG/M
3300005177|Ga0066690_10115499All Organisms → cellular organisms → Bacteria1738Open in IMG/M
3300005179|Ga0066684_10967017All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium552Open in IMG/M
3300005180|Ga0066685_10895443All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300005181|Ga0066678_10324653All Organisms → cellular organisms → Bacteria1012Open in IMG/M
3300005187|Ga0066675_10277398All Organisms → cellular organisms → Bacteria1206Open in IMG/M
3300005187|Ga0066675_10424977All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia984Open in IMG/M
3300005187|Ga0066675_10703567All Organisms → cellular organisms → Bacteria760Open in IMG/M
3300005290|Ga0065712_10650304All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300005293|Ga0065715_10053668All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium867Open in IMG/M
3300005332|Ga0066388_101115515All Organisms → cellular organisms → Bacteria → Proteobacteria1337Open in IMG/M
3300005335|Ga0070666_10405231All Organisms → cellular organisms → Bacteria981Open in IMG/M
3300005355|Ga0070671_100932282All Organisms → cellular organisms → Bacteria759Open in IMG/M
3300005367|Ga0070667_100176402All Organisms → cellular organisms → Bacteria1889Open in IMG/M
3300005439|Ga0070711_100855386All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium774Open in IMG/M
3300005445|Ga0070708_102179153All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300005446|Ga0066686_10894877All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300005450|Ga0066682_10019348All Organisms → cellular organisms → Bacteria3823Open in IMG/M
3300005450|Ga0066682_10546163All Organisms → cellular organisms → Bacteria733Open in IMG/M
3300005450|Ga0066682_10759473All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium589Open in IMG/M
3300005451|Ga0066681_10691916All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300005451|Ga0066681_10752036All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300005454|Ga0066687_10037069All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia2192Open in IMG/M
3300005458|Ga0070681_11240068All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300005536|Ga0070697_100239660All Organisms → cellular organisms → Bacteria → Proteobacteria1548Open in IMG/M
3300005553|Ga0066695_10650717All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300005553|Ga0066695_10878417All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300005555|Ga0066692_10078907All Organisms → cellular organisms → Bacteria1906Open in IMG/M
3300005560|Ga0066670_10691989All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium618Open in IMG/M
3300005561|Ga0066699_10191495All Organisms → cellular organisms → Bacteria1419Open in IMG/M
3300005561|Ga0066699_10656788All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium751Open in IMG/M
3300005569|Ga0066705_10115804All Organisms → cellular organisms → Bacteria1611Open in IMG/M
3300005574|Ga0066694_10386484All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300005586|Ga0066691_10301954All Organisms → cellular organisms → Bacteria944Open in IMG/M
3300005587|Ga0066654_10082415All Organisms → cellular organisms → Bacteria1511Open in IMG/M
3300005587|Ga0066654_10465304All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium692Open in IMG/M
3300005598|Ga0066706_10927284All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium676Open in IMG/M
3300005616|Ga0068852_102290021All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300005713|Ga0066905_102297931All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300005764|Ga0066903_101340864All Organisms → cellular organisms → Bacteria → Proteobacteria1340Open in IMG/M
3300005764|Ga0066903_101609370All Organisms → cellular organisms → Bacteria1232Open in IMG/M
3300005764|Ga0066903_101953846All Organisms → cellular organisms → Bacteria → Proteobacteria1125Open in IMG/M
3300005764|Ga0066903_102451855All Organisms → cellular organisms → Bacteria1009Open in IMG/M
3300005764|Ga0066903_107667853All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus556Open in IMG/M
3300005843|Ga0068860_100636638All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1074Open in IMG/M
3300005937|Ga0081455_10181458All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1593Open in IMG/M
3300006031|Ga0066651_10219955All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1007Open in IMG/M
3300006034|Ga0066656_11063310All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300006046|Ga0066652_100585370All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1050Open in IMG/M
3300006046|Ga0066652_101301231All Organisms → cellular organisms → Bacteria686Open in IMG/M
3300006173|Ga0070716_101067748All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300006173|Ga0070716_101641882All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium529Open in IMG/M
3300006796|Ga0066665_10336969All Organisms → cellular organisms → Bacteria1226Open in IMG/M
3300006796|Ga0066665_10672012All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia822Open in IMG/M
3300006800|Ga0066660_10569308All Organisms → cellular organisms → Bacteria950Open in IMG/M
3300006844|Ga0075428_102359708All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium547Open in IMG/M
3300007265|Ga0099794_10554173All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300009012|Ga0066710_104884553All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300009038|Ga0099829_11801712All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium500Open in IMG/M
3300009137|Ga0066709_101486073All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium979Open in IMG/M
3300009137|Ga0066709_101665074All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium908Open in IMG/M
3300009137|Ga0066709_103615958All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia561Open in IMG/M
3300009137|Ga0066709_103788892All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300009143|Ga0099792_10356972All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium883Open in IMG/M
3300009147|Ga0114129_12549220All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300009553|Ga0105249_10829857All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium989Open in IMG/M
3300010043|Ga0126380_11301443All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium633Open in IMG/M
3300010046|Ga0126384_11025615All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium752Open in IMG/M
3300010301|Ga0134070_10320742All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300010301|Ga0134070_10444393All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300010320|Ga0134109_10165077All Organisms → cellular organisms → Bacteria803Open in IMG/M
3300010320|Ga0134109_10213038All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium717Open in IMG/M
3300010320|Ga0134109_10233329All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia689Open in IMG/M
3300010320|Ga0134109_10459865All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300010322|Ga0134084_10103535All Organisms → cellular organisms → Bacteria911Open in IMG/M
3300010322|Ga0134084_10226373All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium665Open in IMG/M
3300010325|Ga0134064_10425480All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia536Open in IMG/M
3300010325|Ga0134064_10480568All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300010329|Ga0134111_10035009All Organisms → cellular organisms → Bacteria → Proteobacteria1766Open in IMG/M
3300010329|Ga0134111_10402251All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium586Open in IMG/M
3300010358|Ga0126370_11189499All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium708Open in IMG/M
3300010361|Ga0126378_10931931All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium974Open in IMG/M
3300010364|Ga0134066_10069213All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium956Open in IMG/M
3300010366|Ga0126379_11999449All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium682Open in IMG/M
3300010376|Ga0126381_101031686All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1187Open in IMG/M
3300010376|Ga0126381_101117248All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1139Open in IMG/M
3300010397|Ga0134124_12822395All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300011003|Ga0138514_100064142All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia761Open in IMG/M
3300011269|Ga0137392_11358958All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia569Open in IMG/M
3300012189|Ga0137388_11276055All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300012198|Ga0137364_10014090All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium4697Open in IMG/M
3300012198|Ga0137364_10074916All Organisms → cellular organisms → Bacteria2324Open in IMG/M
3300012198|Ga0137364_10366973All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1075Open in IMG/M
3300012198|Ga0137364_10378457All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1058Open in IMG/M
3300012199|Ga0137383_10044038All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus3175Open in IMG/M
3300012199|Ga0137383_10730229All Organisms → cellular organisms → Bacteria723Open in IMG/M
3300012200|Ga0137382_10066171All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia2302Open in IMG/M
3300012201|Ga0137365_10507403All Organisms → cellular organisms → Bacteria886Open in IMG/M
3300012201|Ga0137365_11192430All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium545Open in IMG/M
3300012202|Ga0137363_10232473All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1492Open in IMG/M
3300012202|Ga0137363_10596721All Organisms → cellular organisms → Bacteria932Open in IMG/M
3300012202|Ga0137363_11080101All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300012202|Ga0137363_11713893All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium521Open in IMG/M
3300012203|Ga0137399_11231557All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300012203|Ga0137399_11303846All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium610Open in IMG/M
3300012204|Ga0137374_10242398All Organisms → cellular organisms → Bacteria → Proteobacteria1517Open in IMG/M
3300012206|Ga0137380_11232889All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300012208|Ga0137376_10371395All Organisms → cellular organisms → Bacteria1242Open in IMG/M
3300012208|Ga0137376_10528700All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1023Open in IMG/M
3300012208|Ga0137376_10532430All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1019Open in IMG/M
3300012208|Ga0137376_11735108All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300012210|Ga0137378_10031640All Organisms → cellular organisms → Bacteria4690Open in IMG/M
3300012210|Ga0137378_11189980All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium678Open in IMG/M
3300012211|Ga0137377_10131996All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium2386Open in IMG/M
3300012211|Ga0137377_11367867All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium637Open in IMG/M
3300012285|Ga0137370_10397199All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium835Open in IMG/M
3300012285|Ga0137370_10952518All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium530Open in IMG/M
3300012349|Ga0137387_10652083All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium762Open in IMG/M
3300012349|Ga0137387_11314728All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300012353|Ga0137367_10425960All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium940Open in IMG/M
3300012354|Ga0137366_10552834All Organisms → cellular organisms → Bacteria828Open in IMG/M
3300012361|Ga0137360_10304710All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1323Open in IMG/M
3300012361|Ga0137360_10891451All Organisms → cellular organisms → Bacteria767Open in IMG/M
3300012362|Ga0137361_10404565All Organisms → cellular organisms → Bacteria → Proteobacteria1254Open in IMG/M
3300012362|Ga0137361_11702370All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium550Open in IMG/M
3300012582|Ga0137358_10386687All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium947Open in IMG/M
3300012685|Ga0137397_11107259All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300012911|Ga0157301_10145617All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium748Open in IMG/M
3300012918|Ga0137396_11071266All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium578Open in IMG/M
3300012922|Ga0137394_11539463All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300012923|Ga0137359_11192147All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium649Open in IMG/M
3300012924|Ga0137413_11631681All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium528Open in IMG/M
3300012925|Ga0137419_10519886All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium947Open in IMG/M
3300012927|Ga0137416_11363920All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium641Open in IMG/M
3300012927|Ga0137416_11472815All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium618Open in IMG/M
3300012929|Ga0137404_10272881All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1459Open in IMG/M
3300012941|Ga0162652_100010449All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1143Open in IMG/M
3300012948|Ga0126375_11104991All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium653Open in IMG/M
3300012948|Ga0126375_11767166All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300012957|Ga0164303_11398577All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium523Open in IMG/M
3300012960|Ga0164301_10808253All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium718Open in IMG/M
3300012961|Ga0164302_10716425All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium743Open in IMG/M
3300012971|Ga0126369_11687747All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium723Open in IMG/M
3300012977|Ga0134087_10216090All Organisms → cellular organisms → Bacteria865Open in IMG/M
3300012985|Ga0164308_10823783All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium811Open in IMG/M
3300012987|Ga0164307_11843575All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium513Open in IMG/M
3300013296|Ga0157374_12396810All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300014166|Ga0134079_10016882All Organisms → cellular organisms → Bacteria2305Open in IMG/M
3300014166|Ga0134079_10201931All Organisms → cellular organisms → Bacteria834Open in IMG/M
3300014325|Ga0163163_10948982All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium923Open in IMG/M
3300015077|Ga0173483_10698867All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300015357|Ga0134072_10328605All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300015371|Ga0132258_11408986All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus1761Open in IMG/M
3300015372|Ga0132256_103764542All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium510Open in IMG/M
3300015373|Ga0132257_103226165All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300015374|Ga0132255_104886500All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300016319|Ga0182033_10953795All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium761Open in IMG/M
3300016357|Ga0182032_11471786All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium591Open in IMG/M
3300016387|Ga0182040_10216634All Organisms → cellular organisms → Bacteria → Proteobacteria1418Open in IMG/M
3300017654|Ga0134069_1130942All Organisms → cellular organisms → Bacteria830Open in IMG/M
3300017654|Ga0134069_1343148All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium536Open in IMG/M
3300017657|Ga0134074_1363417All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300017792|Ga0163161_11606142All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium574Open in IMG/M
3300017997|Ga0184610_1036549All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus1402Open in IMG/M
3300018051|Ga0184620_10081237All Organisms → cellular organisms → Bacteria971Open in IMG/M
3300018061|Ga0184619_10209192All Organisms → cellular organisms → Bacteria897Open in IMG/M
3300018071|Ga0184618_10049396All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus1524Open in IMG/M
3300018076|Ga0184609_10087397All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus1385Open in IMG/M
3300018431|Ga0066655_11270403All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300018433|Ga0066667_12212077All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium512Open in IMG/M
3300018469|Ga0190270_12065477All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300018482|Ga0066669_10381304All Organisms → cellular organisms → Bacteria1185Open in IMG/M
3300019865|Ga0193748_1022262All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium597Open in IMG/M
3300019875|Ga0193701_1016545All Organisms → cellular organisms → Bacteria → Proteobacteria1491Open in IMG/M
3300019883|Ga0193725_1025383All Organisms → cellular organisms → Bacteria1603Open in IMG/M
3300019883|Ga0193725_1125954All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300019886|Ga0193727_1044651All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus1455Open in IMG/M
3300019997|Ga0193711_1045788All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium528Open in IMG/M
3300020001|Ga0193731_1160514All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia546Open in IMG/M
3300020004|Ga0193755_1163367All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium666Open in IMG/M
3300020015|Ga0193734_1034366All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium950Open in IMG/M
3300020018|Ga0193721_1007438All Organisms → cellular organisms → Bacteria2865Open in IMG/M
3300020022|Ga0193733_1126853All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium702Open in IMG/M
3300020170|Ga0179594_10026757All Organisms → cellular organisms → Bacteria1807Open in IMG/M
3300020580|Ga0210403_11463160All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300021080|Ga0210382_10101866All Organisms → cellular organisms → Bacteria1196Open in IMG/M
3300021168|Ga0210406_10265604All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1404Open in IMG/M
3300021344|Ga0193719_10165427All Organisms → cellular organisms → Bacteria951Open in IMG/M
3300021560|Ga0126371_10270973All Organisms → cellular organisms → Bacteria1818Open in IMG/M
3300021560|Ga0126371_10675155All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1182Open in IMG/M
3300022756|Ga0222622_10061931All Organisms → cellular organisms → Bacteria2164Open in IMG/M
3300022756|Ga0222622_11347261All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium525Open in IMG/M
3300023058|Ga0193714_1056375All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium559Open in IMG/M
3300024222|Ga0247691_1071143All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium525Open in IMG/M
3300025903|Ga0207680_11359442All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300025905|Ga0207685_10320227All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria773Open in IMG/M
3300025906|Ga0207699_11058692All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium600Open in IMG/M
3300025907|Ga0207645_10345984All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium994Open in IMG/M
3300025916|Ga0207663_10130045All Organisms → cellular organisms → Bacteria1738Open in IMG/M
3300025928|Ga0207700_10115107All Organisms → cellular organisms → Bacteria2171Open in IMG/M
3300025928|Ga0207700_11626229All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium571Open in IMG/M
3300025929|Ga0207664_10234631All Organisms → cellular organisms → Bacteria1596Open in IMG/M
3300025930|Ga0207701_11644362All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300025931|Ga0207644_10135822All Organisms → cellular organisms → Bacteria1888Open in IMG/M
3300025932|Ga0207690_11706207All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium526Open in IMG/M
3300025936|Ga0207670_10577391All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium921Open in IMG/M
3300025949|Ga0207667_11711452All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300025972|Ga0207668_11629965All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300025981|Ga0207640_10836326All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium800Open in IMG/M
3300025986|Ga0207658_10807700All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium852Open in IMG/M
3300026035|Ga0207703_11321931All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300026309|Ga0209055_1061729All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1584Open in IMG/M
3300026309|Ga0209055_1231405All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300026316|Ga0209155_1119946All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium917Open in IMG/M
3300026326|Ga0209801_1074270All Organisms → cellular organisms → Bacteria1500Open in IMG/M
3300026326|Ga0209801_1315568All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300026329|Ga0209375_1109244All Organisms → cellular organisms → Bacteria1231Open in IMG/M
3300026331|Ga0209267_1034194All Organisms → cellular organisms → Bacteria2404Open in IMG/M
3300026342|Ga0209057_1079082All Organisms → cellular organisms → Bacteria → Proteobacteria1399Open in IMG/M
3300026498|Ga0257156_1126722All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300026537|Ga0209157_1057994All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium2008Open in IMG/M
3300026537|Ga0209157_1191759All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium875Open in IMG/M
3300026540|Ga0209376_1406459All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia509Open in IMG/M
3300026542|Ga0209805_1114115All Organisms → cellular organisms → Bacteria → Proteobacteria1281Open in IMG/M
3300026542|Ga0209805_1360573All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300026547|Ga0209156_10165401All Organisms → cellular organisms → Bacteria1067Open in IMG/M
3300026547|Ga0209156_10308855All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300026550|Ga0209474_10328673All Organisms → cellular organisms → Bacteria875Open in IMG/M
3300026552|Ga0209577_10354926All Organisms → cellular organisms → Bacteria1077Open in IMG/M
3300027018|Ga0208475_1004182All Organisms → cellular organisms → Bacteria → Proteobacteria1410Open in IMG/M
3300027018|Ga0208475_1013846All Organisms → cellular organisms → Bacteria787Open in IMG/M
3300027018|Ga0208475_1019189All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300027576|Ga0209003_1014877All Organisms → cellular organisms → Bacteria1212Open in IMG/M
3300027748|Ga0209689_1275519All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium666Open in IMG/M
3300027846|Ga0209180_10101055All Organisms → cellular organisms → Bacteria1643Open in IMG/M
3300028536|Ga0137415_10130364All Organisms → cellular organisms → Bacteria2358Open in IMG/M
3300028768|Ga0307280_10254218All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium633Open in IMG/M
3300028784|Ga0307282_10212108All Organisms → cellular organisms → Bacteria927Open in IMG/M
3300028793|Ga0307299_10007748All Organisms → cellular organisms → Bacteria3758Open in IMG/M
3300028807|Ga0307305_10268113All Organisms → cellular organisms → Bacteria779Open in IMG/M
3300028828|Ga0307312_10338293All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium983Open in IMG/M
3300028875|Ga0307289_10105648All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1150Open in IMG/M
3300028878|Ga0307278_10491405All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300028884|Ga0307308_10032805All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia2419Open in IMG/M
3300028884|Ga0307308_10090183All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1457Open in IMG/M
3300030916|Ga0075386_12101405All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium706Open in IMG/M
3300031231|Ga0170824_104983861All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium552Open in IMG/M
3300031231|Ga0170824_109894961All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300031231|Ga0170824_119552925All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300031716|Ga0310813_12149860All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300031720|Ga0307469_10113964All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1937Open in IMG/M
3300031781|Ga0318547_11042301All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300031820|Ga0307473_10690517All Organisms → cellular organisms → Bacteria716Open in IMG/M
3300032017|Ga0310899_10353277All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium695Open in IMG/M
3300032174|Ga0307470_11903781All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium506Open in IMG/M
3300032180|Ga0307471_101740712All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium776Open in IMG/M
3300032261|Ga0306920_100733774All Organisms → cellular organisms → Bacteria → Proteobacteria1454Open in IMG/M
3300033412|Ga0310810_10241484All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1997Open in IMG/M
3300033412|Ga0310810_11329310All Organisms → cellular organisms → Bacteria561Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil22.52%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil18.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil10.93%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil6.62%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.97%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil3.64%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.64%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.32%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.32%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.65%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.32%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.32%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.99%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.99%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.99%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.99%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.66%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.66%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.66%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.66%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.66%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.66%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.66%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.66%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.66%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.33%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.33%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.33%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.33%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.33%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.33%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.33%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.33%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.33%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.33%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.33%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.33%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.33%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.33%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.33%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.33%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.33%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.33%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090014Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
2170459005Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
2170459023Grass soil microbial communities from Rothamsted Park, UK - FA3 (control condition)EnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000709Amended soil microbial communities from Kansas Great Prairies, USA - Total DNA F1.4 TB amended with BrdU and acetate no abondanceEnvironmentalOpen in IMG/M
3300000886Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-65cm-3A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300002126Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5Host-AssociatedOpen in IMG/M
3300002128Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011003Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012941Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300017657Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019865Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s1EnvironmentalOpen in IMG/M
3300019875Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2EnvironmentalOpen in IMG/M
3300019883Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2EnvironmentalOpen in IMG/M
3300019886Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2EnvironmentalOpen in IMG/M
3300019997Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m2EnvironmentalOpen in IMG/M
3300020001Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2EnvironmentalOpen in IMG/M
3300020004Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2EnvironmentalOpen in IMG/M
3300020015Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1EnvironmentalOpen in IMG/M
3300020018Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2EnvironmentalOpen in IMG/M
3300020022Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300023058Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m1EnvironmentalOpen in IMG/M
3300024222Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK32EnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300026316Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes)EnvironmentalOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300026329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes)EnvironmentalOpen in IMG/M
3300026331Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes)EnvironmentalOpen in IMG/M
3300026342Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes)EnvironmentalOpen in IMG/M
3300026498Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-AEnvironmentalOpen in IMG/M
3300026537Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes)EnvironmentalOpen in IMG/M
3300026540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)EnvironmentalOpen in IMG/M
3300026542Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027018Grasslands soil microbial communities from Kansas, USA, that are Nitrogen fertilized - NN575 (SPAdes)EnvironmentalOpen in IMG/M
3300027471Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027576Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027748Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300030916Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300032017Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPIPI_039779602088090014SoilPSGAKLEMLWRYEQYFYPGNGWASGFMTNGSSTGLVQLDIHP
GPIPI_039114002088090014SoilLQMLWRYEQFFYPGNGWTSGFMTREGSTGLIRIEIKE
E41_010018702170459005Grass SoilHIYYEIRWKKSSGANLEMLWRYEQFLYPGNGWASGFMTRQGSTGLIRIEMKD
FA3_121022902170459023Grass SoilRRNIYQEIRWKKPSGTTLQMLWRYEQFFYLGNGWTSGLMTREGATGLIRIEIKE
F14TC_10381497723300000559SoilIRWKKSSGANLEMLWRYEQFFYPSNGWASGFMTREGSTGLIRVEIKE*
KanNP_Total_F14TBDRAFT_102362923300000709SoilHIYYEIRWKKSSGANLEMVWRYEQFFYPGNGWASGFMTREGSTGLIRVEIKE*
AL3A1W_156866623300000886PermafrostWEKPTGGRLEMLWRYEQYFYDGWASGFMTRQGTVGLIRVDIRP*
JGI11643J12802_1132485723300000890SoilKLEMLWRYEQYFYPVNGWASGFMTHEGSTGLIQLDISP*
JGI1027J12803_10060353913300000955SoilGAKLEMLWRYEQYFYSGAGWASGFMTREDSTGLIRVDIRL*
JGI1027J12803_10287904013300000955SoilGAKLEMLWRYEQYFYSDDGWASGFMTREGSTGLIRVDIRL*
JGI1027J12803_10680232323300000955SoilVLWRYEQLFFPGNGWANGFMTREGSTGLIRVEIKK*
JGI1027J12803_10717578843300000955SoilGANLRMLWRYEQFFYPDNGWTGGFMTREGSTGLIRVEIKL*
F14TB_10008712133300001431SoilWKKPSGAKLEMLWRYEQYFYPDNGWASGFMTYKGSTGLISVEIKQ*
C688J18823_1029060713300001686SoilMVWRYEQFFYPGNGWTSGFMTREGSTGLIRIDIKE
JGI24035J26624_100904123300002126Corn, Switchgrass And Miscanthus RhizosphereIRWKKSSGAKLHMLWRYEQFFYPGNGWTSGLMTREGSTGLILVDIKD*
JGI24036J26619_1014083423300002128Corn, Switchgrass And Miscanthus RhizosphereKRHTYYEILWKKSSGANLRMLWRYEQFFYPGNGWAGGLMTREGSTGLTRVEIKQ*
Ga0062593_10248542023300004114SoilYEIVWKKSSGANLQMLWRYEQFFYSGNGWAGGFMTREGSTGLIRVEIKE*
Ga0062590_10008102413300004157SoilSSGASLQMLWRYDQFFYPGNGWTSSVMTREGSTGLIRVDIKE*
Ga0063356_10354724513300004463Arabidopsis Thaliana RhizosphereYQEIRWNKSSGVKLQMLWRYDQFFYPRNGWTSSLMTREGSTGLIRIDIKE*
Ga0062594_10189800533300005093SoilSSGAKLQMLWRYEQFFYPGNGWTSGFMTREGSTGLIRVKVEE*
Ga0066672_1041012733300005167SoilGAKLEMLWRYEQYFYPQDRWTEAFMTRPGSTGLIRIDISNVAR*
Ga0066672_1054413613300005167SoilQKVNGDRLDMRWRYEQYFYDRWASGFMTHEGTTGLIRAEIRLTKIARC*
Ga0066672_1075424533300005167SoilGAKLEMLWRYEQYFYPQDRWTEAFMTRPGSTGLIRIDISNAAR*
Ga0066677_1008233513300005171SoilLIWNKPSGAKLEMVWRYEQYFYPGDGWGSGFMTREGSTGLIQVDIHP*
Ga0066677_1051249623300005171SoilRLDMRWRYEQYFYDRWASGFMTREGTTGLIQAEIRPTKIARR*
Ga0066677_1058421723300005171SoilSGAKLEMLWRYEQYFYPGNGWASGFMTREGSTGLIRLNIQP*
Ga0066683_1046488613300005172SoilKSSGATLEMLWRYEQYFYPRNGWGSGFMTREGSTGLIRLDIRP*
Ga0066690_1011549933300005177SoilKSSGAKLEMLWRYEQVFYPGNGWASGFMTREGSTGLVRIDIRQ*
Ga0066684_1096701713300005179SoilPELEMLWRYEQYFYPGNGWASGFMTRAGSTGLVRLEIKE*
Ga0066685_1089544323300005180SoilWKKTTGATLDMIWRYEQFFYGQQLIPGNGWGSGFMTREGSTGLIQVTIKE*
Ga0066678_1032465313300005181SoilVLWKKSSGGKLEMLWRYEQYFYPGNGWASGFMTHEGSTGLILLDIRP*
Ga0066676_1076516133300005186SoilKLEMLWRYEQYFYPQDRWTEAFMTRPGSTGLIRIDISNAAR*
Ga0066675_1027739823300005187SoilIYYQLRWKKSSGATLEMLWRYEQYFYPRNGWGSGFMTREGSTGLIRLDIRP*
Ga0066675_1042497723300005187SoilWKKQNSSELRMAWRYEQYFYRGDGWASGFMTHEGTTGLIKVDVEN*
Ga0066675_1070356713300005187SoilPSGAKLEMLWRYEQYFYPGDGWASGFMTREGSTGLIKVDISP*
Ga0065712_1065030413300005290Miscanthus RhizosphereTGATLDMIWRYEQFFYGQQLIPGNGWGNGFMTREGSTGLIEVTIKE*
Ga0065715_1005366813300005293Miscanthus RhizosphereAKLQMLWRYEQFFYPGNGWTSGFMTREGSTGLIRVKVEE*
Ga0066388_10111551533300005332Tropical Forest SoilGAKLEMLWRYEQFFYPGSGWASGFMTREGSTGLTRVKINE*
Ga0070666_1040523123300005335Switchgrass RhizosphereTYQKILWTKSSGASLQMLWRYDQFFYPGNGWTSSVMTREGSTGLIRVDIKE*
Ga0070671_10093228213300005355Switchgrass RhizosphereKGSGEKLEMTWRYEQYFYPRDGWASGFMTHARTTGLVRVKISR*
Ga0070667_10017640233300005367Switchgrass RhizosphereWKKSSGAKLQMLWRYEQFFYPGNGWTSGLITREGSTGLILVDIKD*
Ga0070711_10085538623300005439Corn, Switchgrass And Miscanthus RhizosphereGASLQMLWRYEQFFFRGDGWTSGFMTREGSTGLIRIEIKE*
Ga0070708_10217915313300005445Corn, Switchgrass And Miscanthus RhizosphereWKKPSGMKLEMLWRYEQYFYSGEGWTSGFMTREGSTGLIRADIRP*
Ga0066686_1089487713300005446SoilSWKRHLYYKLRWKKTTGATLDMIWRYEQFFYGQQLIPGNGWGSGFMTREGSTGLIQVTIKE*
Ga0066682_1001934843300005450SoilMYYQLRWKKASGETLEMLWRYEQYFYPGNGWGSGFMTREGSTGLIRVDLHL*
Ga0066682_1054616323300005450SoilSGAKLEMLWRYEQYFYPGNGWASGFMTRESSTGLIRVEIKE*
Ga0066682_1075947323300005450SoilSGADLQMLWRYEQFFYPGIGWGSGFMTHKGSTRLTRVKINE*
Ga0066681_1069191613300005451SoilMIWRYEQFFYGQRLIPGNGWGNGFMTHEGSTGLIQLDIHP*
Ga0066681_1075203613300005451SoilLDMIWRYEQFFYGQQLIPDNGWGSGFMTHEGSTGLIQLDISP*
Ga0066687_1003706933300005454SoilWKKRNGAKLDMLWRYEQYFYSTDRWSSGFMMREGSTGLIRVGISNDAR*
Ga0070681_1124006823300005458Corn RhizosphereWKKSSGANLEILWRYEQFFYPGNGWTSGFMTREGSTGLIRVDIKE*
Ga0068867_10100029413300005459Miscanthus RhizosphereLYYRLIWEKSGGARLEMVWRYEQYFYEDWASGFMTRAGTTGLIHVDIRP*
Ga0070697_10023966033300005536Corn, Switchgrass And Miscanthus RhizosphereTGATLDMIWRYEQFFYGQQLIPGNGWGNGFMTREGSTGLIQVAIKQ*
Ga0066695_1065071713300005553SoilDMIWRYEQFFYGQRLIPGNGWGNGFMTHEGSTGLIQLDIHP*
Ga0066695_1072836613300005553SoilLWRYEQYFYPEDRWTEAFMTRPGSTGLIRIDISNASR*
Ga0066695_1087841713300005553SoilSGAKLEMLWRYEQYFYPGNGWASGFMTREGSTGLIRVNIQP*
Ga0066692_1007890733300005555SoilLWKKPSGAKLEMLWRYEQYFYPELGWASGFMTREGSTGLIGVDISLGR*
Ga0066707_1069424213300005556SoilEMLWRYEQYFYPQDRWTEAFMTRPGSTGLIRIDISNASR*
Ga0066670_1069198913300005560SoilEVRWKKLSGTNLEMLWRYEQFFYPGNGWGSGFMTREGVTGLTRVRIND*
Ga0066699_1019149513300005561SoilRHIHYRLLWKKPSGAKLEMLWRYEQYFYPELGWGSGFMTREGSTGLIGVDISLGR*
Ga0066699_1065678823300005561SoilMRWRYEQYFYDRWASGFMTHEGTTGLIQAEIRPTKIARR*
Ga0066705_1007687733300005569SoilHLYYELSWQKQNGERLEMRWRYEQYFYDRWASGFMTHEGTTGLIRAEIRPAKIAGR*
Ga0066705_1011580413300005569SoilKQNGAKLEMLWRYEQYFYPGDGWAGGFMTHEGSTGLIRLDIQP*
Ga0066694_1038648423300005574SoilLRWKKTTGATLDMIWRYEQFFYGQQLIPGNGWGNGFMTREGSTGLIQLDIHP*
Ga0066708_1074969923300005576SoilRLNMRWRYEQYFYDRWASGFMTHEGTTGLIQAEIRPTKIARR*
Ga0066691_1030195433300005586SoilMLWRYEQYFYPQDRWTEAFMTRPGSTGLIRIDISNAAR*
Ga0066654_1008241513300005587SoilTWKKQNGAKLDMLWRYEQYFYSTDGWASGFMTHEGSTGLIRVGIANGAR*
Ga0066654_1046530423300005587SoilLWRYEQFFYPANGWASRFMTREGSTCLIRAEIKE*
Ga0066706_1092728413300005598SoilIRWRKSAGVTLEMLWRYKQFFYPGKGWAGGFMMREDSSGLIRVEIKE*
Ga0068852_10229002123300005616Corn RhizosphereRLEMVWRYEQPYYDGWASGFMTRAGTTGLIRVEIRP*
Ga0066905_10229793113300005713Tropical Forest SoilGWLWRYEQYFNENWASGFMTRAGTTGLIRVDIRP*
Ga0066903_10134086433300005764Tropical Forest SoilNLEMLWRYEQFFYPGNGWASASMTREGSTGLIRVKINE*
Ga0066903_10160937033300005764Tropical Forest SoilSGATLEMLWRYEQYFYPKTGWGSGFMTGEDSSGLTKINIHL*
Ga0066903_10195384633300005764Tropical Forest SoilLWRYEQFFYPGNGWVGGLMTREGSTGLIRVQIKQ*
Ga0066903_10245185523300005764Tropical Forest SoilEIVWKKSSGANLQMVWRYEQLFFSGNGWASGFMARQGSTGLVRVEIKQ*
Ga0066903_10766785323300005764Tropical Forest SoilVRWKKSSGANLEMLWRYEQFFYPGNGWDSGFMTHEGSTGLIRVKIDE*
Ga0068860_10063663813300005843Switchgrass RhizosphereEMVWRYEQTYYEGWASGFMTRAGTTGLIRVEIRP*
Ga0081455_1018145813300005937Tabebuia Heterophylla RhizosphereKLKMVWRYEQYFYNVWTSGFMTREGSTGLISVQISP*
Ga0066651_1021995513300006031SoilMLWRYEQFFYPANGWASRFMTREGSTGLIRAEIKE*
Ga0066656_1106331013300006034SoilSGAKLEMLWRYEQYFYPDNGWASGFMTYKGSTGLIQLDISP*
Ga0066652_10058537023300006046SoilLEMLWRYEQYFYPRDGWASGFMTHEGSTGLIQVHIKE*
Ga0066652_10125139033300006046SoilGARLEMLWRYEQYFYPEDRWTEAFMTRPGSTGLIRIDISNASR*
Ga0066652_10130123113300006046SoilWKKSSGANLEMLWRYEQFLYPGNGWASGFMTRQGFTGLIRIEIKN*
Ga0075017_10129775123300006059WatershedsRYEQYFYQNDGWVEAFMTRPGATGLIRVEISNGSR*
Ga0070716_10106774823300006173Corn, Switchgrass And Miscanthus RhizosphereQNGAKLEMLWRYEQYFYSGDGWANGFMTREGSTGLIRVDIRL*
Ga0070716_10164188223300006173Corn, Switchgrass And Miscanthus RhizosphereEMLWRYEQFFYPGSGWGSGFMTHESSTGLIRVKINE*
Ga0066665_1033696913300006796SoilTLEMLWRYEQYFYPGNGWASGFMTREGSTGLIRLDIRP*
Ga0066665_1067201243300006796SoilSGAKLEMLWRYEQYFYPGNGWASGFMTHEGSTGLIRLDIQP*
Ga0066660_1056930823300006800SoilYYRLIWKKRNSAKLDMIWRYEQYFYSTYGWASGFMTREGSTGLIRVDISNGGR*
Ga0075428_10235970813300006844Populus RhizosphereSGANLRMLWRYEQFFYPGNGWAGGLMTREGSTGLTRVEIKQ*
Ga0099794_1055417323300007265Vadose Zone SoilWRKPNGVTMEMLWRYEQYFYPGNGWASGFMIREGSTGLIRLDIRP*
Ga0066710_10488455323300009012Grasslands SoilWKKTSGAKLEMLWRYEQYFYPGNGWASGFMTHEGSTGLIRLDIQP
Ga0099829_1180171223300009038Vadose Zone SoilKKASGAKLEMLWRYEQFFYPGNGWASGFMTRESSTGLIRVKINE*
Ga0066709_10148607313300009137Grasslands SoilIYYEIVWKKSSGANLQMLWRYEQFFYPGNGWAGEFMTREGSTGLIRVEIKE*
Ga0066709_10166507423300009137Grasslands SoilNLEMLWRYEQYFYPGNGWGSGFMTHEGSTGLIRVDIHP*
Ga0066709_10361595833300009137Grasslands SoilWRYEQYFYPEDRWTEAFMTRPGSTGLIRIDISNASR*
Ga0066709_10378889223300009137Grasslands SoilYYQLLWKKTSGAKLEMLWRYEQYFYPGNGWASGFMTHEGSTGLIRLDIQP*
Ga0099792_1035697223300009143Vadose Zone SoilRWKKGSGAKLEMLWRYEQFFYPGSGWGSGFMTRESSTGLIRVKINE*
Ga0114129_1254922023300009147Populus RhizosphereEMLWRYEQYFYPVNGWASGVMTHEGSTGLIQLDISP*
Ga0105249_1082985723300009553Switchgrass RhizosphereVRWKKSSGANLEMLWRYEQYFYPGDGWASGFMTHQGSTGLIRVDIKE*
Ga0126380_1130144323300010043Tropical Forest SoilEILWKKSTGANLWMLWRYEQFFYPGNGWAGGFMTRQGSTGLVRVEIKE*
Ga0126384_1102561513300010046Tropical Forest SoilEMLWRYEQFFYSGNGWASGFMTCQGSTGLIRLEIKG*
Ga0134070_1032074213300010301Grasslands SoilYQLRWKKSSGATLEMLWRYEQYFYPGNGWASGFMTREGSTGLIRLDIRP*
Ga0134070_1044439313300010301Grasslands SoilLQMLWRYEQYFYPGTGWASGFMTREGSTGLIRLDIRP*
Ga0134109_1016507713300010320Grasslands SoilPSGAQLQMLWRYEQYFYPGTGWASGFMTREGSTGLIRLDIRP*
Ga0134109_1021303823300010320Grasslands SoilEIRWKKSSGAKLQMLWRYEQVFYPGNGWTSGLMTREGSTGLIRVDIKE*
Ga0134109_1023332913300010320Grasslands SoilHMYYQLRWKKASGETLEMLWRYEQYFYPGNGWGSGFMTREGSTGLIRVDLHL*
Ga0134109_1045986513300010320Grasslands SoilLLWKKPSGATLEMLWRYEQPFYDCWGSGFMTCEGSTGLVRIDIRP*
Ga0134084_1010353513300010322Grasslands SoilMLWRYEQYFYPHTGWGSGFMTRQGSTGLIRIDIRL*
Ga0134084_1022637313300010322Grasslands SoilDMIWRYEQYFYSADGWASGFMMREGSTGLIRVDISNGAR*
Ga0134064_1042548013300010325Grasslands SoilLEMLWRYEQYFYPGNGWASGFMTREGSTGLIRVEIQP*
Ga0134064_1048056823300010325Grasslands SoilKKTTGAKLDMIWRYEQFFYGQQLIPDNGWGSGFMTHEGSTGLIQLDISP*
Ga0134111_1003500933300010329Grasslands SoilGMIWRYQQFFYGQRLIPGNGWGNGFMTHEGSTGLIQLDIHP*
Ga0134111_1040225123300010329Grasslands SoilKLDMLWRYEQYFYSADGWASGFMMREGSTGLIRVDIPNGAR*
Ga0126370_1118949913300010358Tropical Forest SoilKKSSGAKLEMLWRYEQFFYPGSGWASGFMTQEGSTGLIGVKISE*
Ga0126378_1093193113300010361Tropical Forest SoilNLKMVWRYEQFFYPGNGWASGFMTHEGSTGLIRVEIKE*
Ga0134066_1006921313300010364Grasslands SoilTGATLDMIWRYEQFFYGQQLIPGNGWGNGFMTHEGSTGLIQLDIHP*
Ga0126379_1199944923300010366Tropical Forest SoilLEMLWRYEQYFYPDNGWASGLMTYKGSTGLIRLDISP*
Ga0126381_10103168623300010376Tropical Forest SoilMLWRYEQFFYRGKGWGSGFVTREGAAGLNQVEIKK*
Ga0126381_10111724833300010376Tropical Forest SoilTKSSGAKLQMLWRYEQFFYPGNGWTTGFMTREGSTGLIRVEIKE*
Ga0134124_1282239513300010397Terrestrial SoilKKSAGAKLEMLWRYEQYFYPANGWASGFMTRAGSTGLIQVAVKE*
Ga0134121_1316476313300010401Terrestrial SoilLYYRLVWERPGGGRLEMLWRYEQYFYENWASGFMTRAGTTGLIRVDIRP*
Ga0138514_10006414223300011003SoilMSGRQMLWRYEQYFYPTDGWAAGNMTREGNTGLIKAEIKP*
Ga0137392_1135895823300011269Vadose Zone SoilLEMLWRYEQYFYPEDRWTEAFMTRPGSTGLIRINISNAPR*
Ga0137388_1127605523300012189Vadose Zone SoilGAKLEMMCRYEQYFYPGLGWGSGFMTREGSTGLIGVDLSLGR*
Ga0137364_1001409013300012198Vadose Zone SoilYQLRWKKSSGPELEMLWRYEQYFYPGNGWASGFMIRQGSTGLVRLQIKE*
Ga0137364_1007491643300012198Vadose Zone SoilYYRLLWKKPSGAKLEMLWRYEQYFYPGNGWASGFMTYKGATGLIQLDIKE*
Ga0137364_1036697323300012198Vadose Zone SoilLYYRVTWKKQNSTKLDMLWRYEQYFYSADGWASGFMMREGSTGLIRVDISNGAR*
Ga0137364_1037845723300012198Vadose Zone SoilRWKKSSGANLEMLWRYEQFLYPGNGWASGFMTRQGSTGLIRIEMKD*
Ga0137383_1004403813300012199Vadose Zone SoilWKKRNGAKLDMLWRYEQYFYSTDGWASGFMMRKGSTGLIRVDISNGAR*
Ga0137383_1073022913300012199Vadose Zone SoilKLEMLWRYEQYFYPGDGWGSGFMTREGSTGLIRVDIHP*
Ga0137382_1006617113300012200Vadose Zone SoilSGAKLEMLWRYEQYFYPANGWASGFMTRAGSTGLIQVAIKE*
Ga0137365_1050740313300012201Vadose Zone SoilGAKLEMLWRYEQYFYPGDGWASGFMTREGSTGLIRVDIRP*
Ga0137365_1119243023300012201Vadose Zone SoilYYEIRWKKSSGANLEMLWRYEQFFYPGKGWASGFMTREGSTGLIRAGIKE*
Ga0137363_1023247313300012202Vadose Zone SoilSGATLEMLWRYEQYFYPGNGWASGFMTRQGSTGLIQVEIKN*
Ga0137363_1059672123300012202Vadose Zone SoilSGAKLEMLWRYEQYFYPDSGWANGFMTYKGSTGLIQLDIQP*
Ga0137363_1108010113300012202Vadose Zone SoilLEMLWRYEQYYYAADGWPSGLMTREGSTGLIRVDIHP*
Ga0137363_1171389313300012202Vadose Zone SoilLWRYEQFFYLGNGWTSGFMTREGSTGLIQVKITE*
Ga0137399_1123155723300012203Vadose Zone SoilEMLWRYEQYFYPGNGWASGFMVREGSTGLVRLEIKD*
Ga0137399_1130384623300012203Vadose Zone SoilERLWRYEQFFYPGDGWASGFMTRHGSTGLIRIEMKE*
Ga0137374_1024239833300012204Vadose Zone SoilSKLEMLWRYEQYFYPSNGWASGFMTREGSTGLIQLNISP*
Ga0137362_1083830813300012205Vadose Zone SoilRYEQYFYPEDRWTEAFMTRPGSTGLIRIDISNASR*
Ga0137380_1123288913300012206Vadose Zone SoilTSGAKLEMAWRYEQYFYPGNGWASGFMTHEGSTGLIQLDIQP*
Ga0137376_1037139513300012208Vadose Zone SoilLQMLWRYEQYFYPGNGWASGFMTREGSTGLIRLDIRP*
Ga0137376_1052870013300012208Vadose Zone SoilLRWKKTTGATLDMIWRYEQFFYGQQLIPGNGWGNGFMTREGSTGLIRAEIKE*
Ga0137376_1053243023300012208Vadose Zone SoilYMYYQLRWKKSSGPELEMLWRYEQYFYPGNGWASGFMVREGSTGLVRLEIKD*
Ga0137376_1173510813300012208Vadose Zone SoilYQLRWKKSSGPELEMLWRYEQYFYPGNGWASGFMVREGSTGLVRLEIKD*
Ga0137378_1003164063300012210Vadose Zone SoilYYRVLWKKSSGAKLEMLWRYEQYFYPGNDWTSGFMTHEGSTGLIQLDIRP*
Ga0137378_1118998013300012210Vadose Zone SoilRHIYYEIRWKKASGADLQMLWHYEQFFYPGNGWGSGFMTHKGSTRLTRVKINE*
Ga0137377_1013199633300012211Vadose Zone SoilEMLWRYEQYFYPCNGWASGFMTRESSTGLIRVEIKE*
Ga0137377_1136786713300012211Vadose Zone SoilNLEMLWRYEQYFYPANGWGSGFMTREGSTGLIRVDIHL*
Ga0137370_1039719923300012285Vadose Zone SoilFWRYEQYFYPADRWAKGFMTRPGSTGLIRIDISNASR*
Ga0137370_1095251813300012285Vadose Zone SoilNSTKLDMLWRYEPYFYSADHWASGFMMREGSTGLIRVDISNGAR*
Ga0137387_1065208313300012349Vadose Zone SoilLEMLWRYEQFFYPGKGWASGFMTREDSTGLIRAEIKE*
Ga0137387_1131472823300012349Vadose Zone SoilAKLEMLWRYEQYFYPGDGWAGGFMTREGSTGLIRENIQP*
Ga0137367_1042596023300012353Vadose Zone SoilGVKLEMLWRYEQYFYPGNGWASGFMTHEGSTGLIQLDISP*
Ga0137366_1055283423300012354Vadose Zone SoilKLEMLWRYEQYFYPGNGWASGFMTRESSTGLIRVEIKE*
Ga0137360_1030471033300012361Vadose Zone SoilMLWRYEQFLYPGNGWASGFMTRQGSTGLIRIEMKD*
Ga0137360_1089145123300012361Vadose Zone SoilLWRYEQYFYPSDGWGSGFMTRVGSTGLIQVDIHP*
Ga0137361_1040456533300012362Vadose Zone SoilLEMLWRYEQYFYPGNGWGSSFMTHERSTGLIRVDIRL*
Ga0137361_1170237013300012362Vadose Zone SoilAQLQMLWRYEQYFYPGNGWASGFMTRQGSTGLIRLDIRP*
Ga0137358_1038668713300012582Vadose Zone SoilLEMLWRYEQYYYAADGWASGLMTREGSTGLIRVDIQK*
Ga0137397_1093685333300012685Vadose Zone SoilWRYEQYFYPDDRWTAAFMSRPGSTGLFGIDISNAAR*
Ga0137397_1110725923300012685Vadose Zone SoilLWRYEQYFYPSDGWTGGNMTREGTTGLIKVEIRP*
Ga0157301_1014561713300012911SoilMLWRYQQYFYPDNGWASGFMTYNGSTGLIQLDISP*
Ga0137396_1107126623300012918Vadose Zone SoilEMLWRYEQYFYPGNGWASGFMTRQGSTGLIQVEIKN*
Ga0137394_1153946313300012922Vadose Zone SoilMLWRYEQYFYPGNGWASGFMTREGSTGLIQVAINE*
Ga0137359_1119214713300012923Vadose Zone SoilKLEMLWRYEQVFYPGNGWAGGFMTREGSTGLVRIDIKQ*
Ga0137413_1163168123300012924Vadose Zone SoilRVHWKKSAGANLEMLWRYEQYFYPGNGWASGFMTRQGFTGLIRVEIKN*
Ga0137419_1051988613300012925Vadose Zone SoilMLWRYEQYFYPDSGWANGFMTYKGSTGLIQLDIQP*
Ga0137416_1136392013300012927Vadose Zone SoilRWKKASGANLEMLWRYEQFFYPGSGWASGFTKREGSTGLTRVKINE*
Ga0137416_1147281513300012927Vadose Zone SoilMLWRYEQYFYPGNGWASGFMTRQGSTGLIQVEIKN*
Ga0137404_1027288133300012929Vadose Zone SoilWKKPSGAKLEMLWRYEQYFYPDNGWVGGFMTDGSSTGLVQLDIHP*
Ga0137407_1193570613300012930Vadose Zone SoilMLWRYEQYFYPEDRWTEAFMTRPGSTGLIRINISNTPR*
Ga0162652_10001044933300012941SoilLEMLWRYEQYLYPGNGWASGFMTRQGSTGLIQVEIKN*
Ga0126375_1110499113300012948Tropical Forest SoilLWRYEQFFYPGNGWASEFMTREGSTGLVRVDIKQ*
Ga0126375_1176716623300012948Tropical Forest SoilSGATLEMLWRYEQHFNQSNGWGSGFMTREGATGLIRIDIQL*
Ga0164303_1139857723300012957SoilTYQKILWKKSSGASLQMLWRYDQFFYPGNGWTSSVMTREGSTGLIRVDMKE*
Ga0164301_1080825323300012960SoilRWKKSSGATLEMLWRYEQYFYPGNGWASGFMTREGSTGLIQVEIKN*
Ga0164302_1071642513300012961SoilRWKKSSGATLEMLWRYEQYFYPGNGWASGFMTREGSTGLMQVEIKN*
Ga0126369_1168774723300012971Tropical Forest SoilRWKKSSGQTLKMLWRYEQFFYRGKGWAGGTMTRENSSGLVLLQIKE*
Ga0134087_1021609023300012977Grasslands SoilGATLDMIWRYEQFFYGQQLIPGNGWGSGFMTREGSTGLIQVTIKE*
Ga0164308_1082378323300012985SoilYYRVRWKKSSGATLEMLWRYEQYFYPGNGWASGFMTREGSTGLIQVEITN*
Ga0164307_1184357523300012987SoilHLYYRVRWKKSAGTSLEMLWQYEQYFYPSNGWASGFMTRQGFTGLIQIEIKN*
Ga0157374_1239681023300013296Miscanthus RhizospherePSPSLKRHPFQEIRWKKSTGPNLKMFWRYEQFFYTGSVWASGSMTREGSTGLIRIEIGP*
Ga0134079_1001688213300014166Grasslands SoilKTTGAKLDMIWRYEQFFYGQQLIPDNGWGSGFMTHEGSTGLIQLDISP*
Ga0134079_1020193123300014166Grasslands SoilYYQLRWKKSSGATLEMLWCYEQYLYPGNGWGSGFMTREGFTGLIQLDIRP*
Ga0163163_1094898213300014325Switchgrass RhizosphereGAKLHMLWRYEQFFYPGNGWTSGLITREGSTGLILVDIKD*
Ga0173483_1069886723300015077SoilAKLEMLWRYQQYFYPDNGWASGFMTYNGSTGLIQLDISP*
Ga0134072_1032860513300015357Grasslands SoilRHIYYQLRWKKSSGPELEMLWRYEQYFYPGNGWASGFMTREGSTGLIRVEIQP*
Ga0132258_1140898613300015371Arabidopsis RhizosphereDGGRLEMLWRYEQYFYENWGSGFMTRGGTTGLIRVDIRP*
Ga0132256_10376454223300015372Arabidopsis RhizosphereHIYQEIRWKKSSGARLQMLWRYEQFFYPGNGWTSGFMTREGSTGLIRVDIKE*
Ga0132257_10322616523300015373Arabidopsis RhizosphereHLYYRLLWKKSAGAKLEMLWRYEQYFYPANGWASGFMTRAGSTGLIQVAVKE*
Ga0132255_10488650023300015374Arabidopsis RhizosphereMTGQKRHIYYEIMWKKSSGANLQMVWRYEQFFYPGNGWASGFMTRQGSTGLVRVEIK*
Ga0182033_1095379523300016319SoilTYYEILWKKSSGANLRMLWRYQQFFPGNGWAGGLMTREGSTGLIRVEVKQ
Ga0182032_1147178623300016357SoilYEILWKKSSGANLQMLWGYEQFFYPGNGWAGGFMTREGSTGLIRVEIKE
Ga0182040_1021663413300016387SoilILWKKSSGANLQMLWGYEQFFYPGNGWAGGFMTREGSTGLIRVEIKE
Ga0134069_113094223300017654Grasslands SoilSGAKLEMLWRYEQYFYPGNGWASGFMTHEGSTGLIQLDIRP
Ga0134069_134314823300017654Grasslands SoilWKKSSGANLQMLWRYEQFLYSGNGWAGEFMTREGSTGLIRAEIKE
Ga0134074_136341723300017657Grasslands SoilYYQLRWKKASGETLEMLWRYEQYFYPGNGWGSGFMTREGSTGLIRVDLHL
Ga0163161_1160614223300017792Switchgrass RhizosphereYQEIRWKKSSGAKLQMLWRYEQYFYPANGWGNGFMTKEGSTGLVEVDIRP
Ga0184610_103654933300017997Groundwater SedimentYYGLHWKKPSGATLEMLWRYEQYFYPANSWGSGFMTREGSTGLVEVDIRP
Ga0184604_1017699623300018000Groundwater SedimentVWEKPDGGRLEMVWRYEQYFYENWASGFMTRAGTTGLIRVDIRP
Ga0184620_1008123723300018051Groundwater SedimentKLEMLWRYEQYFYPANGWGSGFMTKEGSTGLVEVQIRP
Ga0184619_1020919223300018061Groundwater SedimentHRYYQLIWNKPSGAKLEMLWRYEQYFYPSDGWGSGFMTREGSTGLIRVDIHP
Ga0184618_1004939613300018071Groundwater SedimentRVLWKKPSGANLEMLWRYEQYFYPASGWGSGFMTREDSTGLIRVDIHL
Ga0184609_1008739713300018076Groundwater SedimentRHVYYGLHWKKPSGATLKMLWRYEQYFYPANGWGSGFMTKEGSTGLVEVDIRP
Ga0066655_1127040323300018431Grasslands SoilYGEMLEMLCRYEQYFYPGNGWGSGFMTREGSTGLIRVDLHL
Ga0066667_1221207713300018433Grasslands SoilRMYYQLRWKKPSGATLEMLWSYEQYFYSSWGSGFMTREGSTGLIRVDIQLRKPAAPK
Ga0190270_1206547723300018469SoilRLEMLWRYEQYFYENWASGFMTRAGTTGLIRVDIRP
Ga0066669_1038130433300018482Grasslands SoilSGAKLEMLWRYEQYFYPGNGWASGFMTHEGSTGLIRLDIQP
Ga0193748_102226213300019865SoilSSGANLEMLWRYEQFLYPGNGWASGFMTRQGSAGLIRIKLKN
Ga0193701_101654513300019875SoilDYRLLWKKPSGAKLEMLWRYEQYFYPANGWASGFMTRTGSTGLIQVAIKE
Ga0193725_102538333300019883SoilMLWRYEQYFYPVNGWASGFMTHEGSTGLIQLDISP
Ga0193725_112595413300019883SoilMLWLYEQYFYPANGWASGFMTRAGSTGLIQVAIKE
Ga0193727_104465133300019886SoilYELRWKKPSGATLEMLWRYEQYFYPANGWGSGFMTREGSTGLVEVDIRP
Ga0193711_104578823300019997SoilSSGANLEMLWRYEQFFYPGNGWASGFMTRQGSTGLIRIEMKD
Ga0193731_116051423300020001SoilKLEMLWRYEQYFYPGDGWASGFMTREGSTGLIRVDIRP
Ga0193755_116336733300020004SoilQNGAKLEMLWRYEQYYYAGDRWASGLMTREGSTGLIRVDIQK
Ga0193734_103436623300020015SoilGANLEMLWRYEQFLYPGNGWASGFMTRQGSTGLIRIEMKD
Ga0193721_100743813300020018SoilELHWKKPSGARLEMLWRYEQYFYPANGWGNGFMTKEESTGLVEVDIRP
Ga0193733_112685323300020022SoilMLWRYEQYFYSDNGWAGGFMTREGSTGLIKLDIRP
Ga0179594_1002675733300020170Vadose Zone SoilKKPSGAKLEMLWRYEQYFYPDRGWASGFMTYKGSTGLIQLDIQP
Ga0210403_1146316013300020580SoilWRYEQYFYPGNGWASGFMTREGSTGLIGVDISLGR
Ga0210382_1010186633300021080Groundwater SedimentGAKLEMLWRYEQYFYPANGWGSGFMTKEGSTGLVEVQIRP
Ga0210406_1026560433300021168SoilYYRLLWNKPSGAKLEMLWRYEQYFYPGNGWASGFMTREGSTGLIGVDISLGR
Ga0193719_1016542723300021344SoilLEILWRYEQYFYPANGWASGFMTNAGSTGLIQVAIKE
Ga0126371_1027097313300021560Tropical Forest SoilHTYYEILWKKSSGANLKMVWRYEQFFYPGNGWASGFMTHEGSTGLIRVEIKE
Ga0126371_1067515523300021560Tropical Forest SoilMLWRYEQFFYRGKGWGSGFVTREGAAGLNQVEIKK
Ga0222622_1006193143300022756Groundwater SedimentSGANLEMLWRYEQYFYPANGWGSGFMTREGSTGLIRVDIRR
Ga0222622_1134726123300022756Groundwater SedimentKPSGARLEMLWRYEQYFYPANGWGNGFMTKEESTGLVEVDIRP
Ga0193714_105637523300023058SoilWKKSSGANLQMLWRYEQFFYPGNGWTSGFMTREGSTGLIRVDIKE
Ga0247691_107114313300024222SoilSAATLEMLWRYEQYFYPGNGWASGFMTRQGSTGLIRVDIKE
Ga0207680_1135944213300025903Switchgrass RhizosphereWEKPGGGRLDMLWRYEQYFYENWASGFMTRAGTTGLIRVDIRP
Ga0207685_1032022723300025905Corn, Switchgrass And Miscanthus RhizosphereMLWRYEQYFYPGNGWGSGFMTREGFTGLIQLDIRP
Ga0207699_1105869213300025906Corn, Switchgrass And Miscanthus RhizosphereYRVQWKKSSGATLEMLWRYEQYFYPGNGWASGFMTRQGSTGLIQVEIKN
Ga0207645_1034598413300025907Miscanthus RhizosphereKRHTYQEIRWKKSSGANLKMLWRYDQFFYAGNGWASGSMTREGSTGLIRIEIEL
Ga0207663_1013004513300025916Corn, Switchgrass And Miscanthus RhizosphereRVRWKKSSGATLEMLWRYEQYFYPGNGWASGFMTRQGSTGLIEVEIKN
Ga0207646_1086510213300025922Corn, Switchgrass And Miscanthus RhizosphereLWRYEQYFYPEDRWTEAFMTRPGSTGLIRIDISDASR
Ga0207700_1011510743300025928Corn, Switchgrass And Miscanthus RhizosphereRYEQFFYGQQLIPGNGWGNGFMTREGSTGLIQVAIKQ
Ga0207700_1162622923300025928Corn, Switchgrass And Miscanthus RhizosphereSSGANLEMLWRYEQYFYPGNGWASGFMTHQGSTGLIRVDIKE
Ga0207664_1023463113300025929Agricultural SoilQNGAKLEMLWRYEQYFYSGDGWANGFMTREGSTGLIRVDIRL
Ga0207701_1164436213300025930Corn, Switchgrass And Miscanthus RhizosphereMLWRYEQYFYPANGWASGFMTRAGSTGLIQVAVKE
Ga0207644_1013582213300025931Switchgrass RhizosphereWKKSSGAKLQMLWRYEQFFYPGNGWTSGFMTREGSTGLIRVKVEE
Ga0207690_1170620713300025932Corn RhizosphereATLEMLWRYEQYFYTTNGWGSGFMTKEGSTGLVEVDIRP
Ga0207670_1057739113300025936Switchgrass RhizosphereKLHMLWRYEQFFYPGNGWTSGLITREGSTGLILVDIKD
Ga0207667_1171145223300025949Corn RhizosphereARLEMVWRYEQWFYEDWASGFMTTPGTTGLIRVDIRP
Ga0207668_1162996523300025972Switchgrass RhizosphereATLKMLWRYEQYFYPTNGWGSGFMIHEGATGLVEVDIRPHTDK
Ga0207640_1083632613300025981Corn RhizosphereTYQKILWKKSSGASLQMLWRYDQFFYPGNGWTSSVMTREGSTGLIRVDIKE
Ga0207658_1080770013300025986Switchgrass RhizosphereQEIRWQKSSGAKLQMVWRYDQFFYPRNGWTSRFMTREGSTGLIRIDIKE
Ga0207703_1132193123300026035Switchgrass RhizosphereVYYQLHWKKPSGARLEMLWRYEQYFYPANGWGNGFMTKEGSTGLVEVDIRP
Ga0207648_1110366513300026089Miscanthus RhizosphereHLYYRLIWEKSGGARLEMVWRYEQYFYEDWASGFMTRAGTTGLIHVDIRP
Ga0209055_106172913300026309SoilGPKLEMLWRYEQYFYPGNGWASGFMTREGSTGLIRVEIQP
Ga0209055_123140513300026309SoilWKKRNSAKLDMIWRYEQYFYSTYGWASGFMTREGSTGLIRVDISNGGR
Ga0209155_111994633300026316SoilLYYQLTWKKQNGAKLDMLWRYEQYFYSTDGWASGFMTHEGSTGLIRVGISNGAR
Ga0209801_107427013300026326SoilLRWKKSSGATLEMLWRYEQYFYPRNGWGSGFMTREGSTGLIRLDIRP
Ga0209801_131556823300026326SoilMLWRYEQYFYPELGWGSGFMTREGSTGLIGVDISLGR
Ga0209375_110924413300026329SoilEMLWRYEQYFYPGNGWASGFMTHEGSTGLIRLDIQP
Ga0209267_103419443300026331SoilWKKSSGPKLEMLWRYEQYFYPGNGWASGFMTREGSTGLIRVEIQP
Ga0209057_107908213300026342SoilKPSGATLEMLWRYEQPFYDRWGSGFMTREGSTGLVRIDIRP
Ga0257156_112672213300026498SoilAKLEILWRYEQYFYSGGGWASGFMTHEGSTGLIRVDIRP
Ga0209157_105799453300026537SoilRLTWKKRNGAKLDMLWRYEQYFYSADGWASGFMMREGSTGLIRVDIPNGAR
Ga0209157_119175923300026537SoilWKRHMYYQLLWKKPSGATLEMLWRYEQPFYDRWGSGFMTREGSTGLVRIDIRP
Ga0209376_140645913300026540SoilEMLWRYEQYFYPEDRWTEAFMTRPGSTGLIRIDISNASR
Ga0209805_111411513300026542SoilMVWRYEQYFYPGDGWGSGFMTREGSTGLIQVDIHP
Ga0209805_136057313300026542SoilEMLWRYEQYFYPQDRWTEAFMTRPGSTGLIRIDISNAAR
Ga0209156_1016540113300026547SoilIYYQLRWKKSSGATLEMLWRYEQYFYPRNGWGSGFMTREGSTGLIRLDIRP
Ga0209156_1030885513300026547SoilEMLWRYEQYFYPGNGWASGFMTHEGSTGLIQLDIRP
Ga0209161_1013931733300026548SoilLVWQKQNGSRLKMVWRYEQYFYDSWASGFMVRDGITGLIRAEIRP
Ga0209474_1032867323300026550SoilLDMIWRYEQFFYGQQLIPGNGWGSGFMTREGSTGLIQVTIKE
Ga0209577_1035492623300026552SoilGAKLEMLWRYEQYFYPELGWGSGFMTREGSTGLIGVDISLGR
Ga0208475_100418233300027018SoilAKLEMLWRYEQYFYPGNGWASGFMTHEGSTGLIQLDISP
Ga0208475_101384613300027018SoilYYRLLWKKPAGAKLEMLWRYEQYFYPGNGWASGFMTREGSTGLIQVVIKE
Ga0208475_101918913300027018SoilWKKPSGAKLEMLWRYEQYFYPGSGWASGFMTYKGSTGLIQLNISP
Ga0209995_108606523300027471Arabidopsis Thaliana RhizosphereYYRLVWERPDGGRLEMLWRYEQYFYENWASGFMTRAGTTGLIRVDIRP
Ga0209003_101487713300027576Forest SoilEMLWRYEQFFYPRNGWVGGTMTRESSTGLVLVKIKQ
Ga0209689_127551923300027748SoilEMLWRYEQFFYPGNGWGSGFMTRESSTGLVRIDINQ
Ga0209180_1010105523300027846Vadose Zone SoilWRYEQYFYPEDRWTEAFMTRPGSTGLIRINISISN
Ga0137415_1013036413300028536Vadose Zone SoilKKPSGAKLEMLWRYEQYFYPGTGWASGFTTYKGSTGLIQLDINH
Ga0307280_1025421823300028768SoilKRHIYYEIRWKKSSGANLEMLWRYEQFLYPGNGWASGFMTRHGSTGLIRIEMKD
Ga0307282_1021210813300028784SoilKLEMLWRYEQYFYPANGWASGFMTRTGSTGLIQVAIKE
Ga0307299_1000774843300028793SoilSGAKLEMLWRYEQYFYPANGWASGFMTRTGSTGLIQVAIKE
Ga0307305_1026811313300028807SoilRVLWKKPSGVKLEILWRYEQYFYPDNGWVGGFMTNGSSTGLVQLDIHP
Ga0307312_1033829323300028828SoilRYEQFFYGQQLIPGNGWASGFMTHEGSTGLIQLDISP
Ga0307289_1010564833300028875SoilKKSSGATLEMLWRYEQYFYPGNGWASGFMTREGSTGLILVEIRN
Ga0307278_1049140513300028878SoilKRHMYYQLLWKKPSGATLEMLWRYEQPFYESWGSGFMIREDSTGLIRVDIQP
Ga0307308_1003280543300028884SoilMEMLWRYEQYFYPGNGWASGFMIREGSTGLIQLDIRP
Ga0307308_1009018333300028884SoilYYRVLWKKPSGVKLEILWRYEQYFYPDNGWVGGFMANRSSTGLLQVDIHP
Ga0075386_1210140513300030916SoilEMLWRYEQFFYPGNGWGSGFMTREGFTGLIRIEIKN
Ga0170824_10498386123300031231Forest SoilYRVHWKKSSGANLEMLWRYEQYFYPGNGWASGFVTHQGFTGLIQVEIKN
Ga0170824_10989496113300031231Forest SoilKPSGANLEMLWRYEQYFYPGNGWASGFMTRERSTGLTQVAIKQ
Ga0170824_11955292513300031231Forest SoilGAKLEMLWRYEQYFYSGDGWASGFMTREGSTGLIRVDIRP
Ga0310813_1214986013300031716SoilSTLKMVWRYEQYFYSPAWTSGFMTREGSTGLIDVQVSD
Ga0307469_1011396433300031720Hardwood Forest SoilKSSGANLEMLWRYEQYFYPGNGWASGFMTRQGSTGLIRVEIKN
Ga0318547_1104230113300031781SoilMTGQSPSWKRHTYYEILWKKSAGANLRMLWGDEQFFYPGNDWAGGLMTRKARRG
Ga0307473_1069051723300031820Hardwood Forest SoilKKPSGAKLEMLWRYEQYFYPDNGWVGGLMANRSSTGLLHVDIHP
Ga0310899_1035327723300032017SoilQEIRWKKSSGANLKMLWRYEQFFYAGNGWASGSMTQEGSTGLIRIEIEL
Ga0307470_1190378113300032174Hardwood Forest SoilLYYRVRWKKSSGATLEMLWRYEQYFYPGNGWASGFMTRQGSTGLIEVEIKN
Ga0307471_10174071223300032180Hardwood Forest SoilLYYRVRWKKSSGATLEMLWRYEQYFYPGNGWANGFMTRQGATGLIRVEIKN
Ga0306920_10073377433300032261SoilIYYEILWKKSSGANLRMLWRYEQFFYPGNGWASGFMTREGSTGLIRVEIKQ
Ga0310810_1024148433300033412SoilRHTYQKILWKKSSGASLQMLWRYDQFFYPGNGWTSSVMTREGSTGLIRVDIKE
Ga0310810_1132931023300033412SoilKSSGSTLEMLWRYEQYFYPASGWGNTFMTREGSTGLIKIDIRL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.