Basic Information | |
---|---|
Family ID | F010560 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 302 |
Average Sequence Length | 43 residues |
Representative Sequence | GAKLEMLWRYEQYFYPGDGWASGFMTREGSTGLIRVDIRP |
Number of Associated Samples | 227 |
Number of Associated Scaffolds | 302 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.78 % |
% of genes near scaffold ends (potentially truncated) | 88.74 % |
% of genes from short scaffolds (< 2000 bps) | 87.42 % |
Associated GOLD sequencing projects | 209 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.31 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (93.046 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (22.517 % of family members) |
Environment Ontology (ENVO) | Unclassified (33.444 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.649 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 25.00% Coil/Unstructured: 75.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 302 Family Scaffolds |
---|---|---|
PF08241 | Methyltransf_11 | 16.89 |
PF13489 | Methyltransf_23 | 4.97 |
PF00685 | Sulfotransfer_1 | 4.64 |
PF10459 | Peptidase_S46 | 1.66 |
PF01066 | CDP-OH_P_transf | 1.66 |
PF13211 | DUF4019 | 1.32 |
PF13091 | PLDc_2 | 0.99 |
PF13469 | Sulfotransfer_3 | 0.66 |
PF13649 | Methyltransf_25 | 0.66 |
PF13847 | Methyltransf_31 | 0.66 |
PF04402 | SIMPL | 0.33 |
PF02899 | Phage_int_SAM_1 | 0.33 |
PF05960 | DUF885 | 0.33 |
PF01988 | VIT1 | 0.33 |
PF13676 | TIR_2 | 0.33 |
PF06144 | DNA_pol3_delta | 0.33 |
PF01344 | Kelch_1 | 0.33 |
PF09424 | YqeY | 0.33 |
PF13508 | Acetyltransf_7 | 0.33 |
PF01148 | CTP_transf_1 | 0.33 |
PF02915 | Rubrerythrin | 0.33 |
PF13884 | Peptidase_S74 | 0.33 |
PF01128 | IspD | 0.33 |
PF03447 | NAD_binding_3 | 0.33 |
PF12847 | Methyltransf_18 | 0.33 |
COG ID | Name | Functional Category | % Frequency in 302 Family Scaffolds |
---|---|---|---|
COG5050 | sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferases | Lipid transport and metabolism [I] | 1.66 |
COG1183 | Phosphatidylserine synthase | Lipid transport and metabolism [I] | 1.66 |
COG0558 | Phosphatidylglycerophosphate synthase | Lipid transport and metabolism [I] | 1.66 |
COG2068 | CTP:molybdopterin cytidylyltransferase MocA | Coenzyme transport and metabolism [H] | 0.33 |
COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.33 |
COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.33 |
COG4805 | Uncharacterized conserved protein, DUF885 family | Function unknown [S] | 0.33 |
COG3471 | Predicted secreted (periplasmic) protein | Function unknown [S] | 0.33 |
COG2968 | Uncharacterized conserved protein YggE, contains kinase-interacting SIMPL domain | Function unknown [S] | 0.33 |
COG2859 | Outer membrane channel-forming protein BP26/OMP28, SIMPL family | Cell wall/membrane/envelope biogenesis [M] | 0.33 |
COG2812 | DNA polymerase III, gamma/tau subunits | Replication, recombination and repair [L] | 0.33 |
COG1814 | Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 family | Inorganic ion transport and metabolism [P] | 0.33 |
COG1633 | Rubrerythrin, includes spore coat protein YhjR | Inorganic ion transport and metabolism [P] | 0.33 |
COG1466 | DNA polymerase III, delta subunit | Replication, recombination and repair [L] | 0.33 |
COG1211 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase | Lipid transport and metabolism [I] | 0.33 |
COG1207 | Bifunctional protein GlmU, N-acetylglucosamine-1-phosphate-uridyltransferase/glucosamine-1-phosphate-acetyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.33 |
COG0746 | Molybdopterin-guanine dinucleotide biosynthesis protein A | Coenzyme transport and metabolism [H] | 0.33 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 93.05 % |
Unclassified | root | N/A | 6.95 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2088090014|GPIPI_16589056 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1390 | Open in IMG/M |
2088090014|GPIPI_16808372 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1561 | Open in IMG/M |
2170459005|F1BAP7Q02GSK7Y | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 532 | Open in IMG/M |
2170459023|GZGNO2B02HZ8TL | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 514 | Open in IMG/M |
3300000559|F14TC_103814977 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 758 | Open in IMG/M |
3300000709|KanNP_Total_F14TBDRAFT_1023629 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 517 | Open in IMG/M |
3300000886|AL3A1W_1568666 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300000890|JGI11643J12802_11324857 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300000955|JGI1027J12803_100603539 | All Organisms → cellular organisms → Bacteria | 1355 | Open in IMG/M |
3300000955|JGI1027J12803_102879040 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1232 | Open in IMG/M |
3300000955|JGI1027J12803_106802323 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 625 | Open in IMG/M |
3300000955|JGI1027J12803_107175788 | All Organisms → cellular organisms → Bacteria | 1284 | Open in IMG/M |
3300001431|F14TB_100087121 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1665 | Open in IMG/M |
3300001686|C688J18823_10290607 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
3300002126|JGI24035J26624_1009041 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 978 | Open in IMG/M |
3300002128|JGI24036J26619_10140834 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 505 | Open in IMG/M |
3300004114|Ga0062593_102485420 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 586 | Open in IMG/M |
3300004157|Ga0062590_100081024 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1967 | Open in IMG/M |
3300004463|Ga0063356_103547245 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300005093|Ga0062594_101898005 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 632 | Open in IMG/M |
3300005171|Ga0066677_10082335 | All Organisms → cellular organisms → Bacteria | 1674 | Open in IMG/M |
3300005171|Ga0066677_10584217 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
3300005172|Ga0066683_10464886 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
3300005177|Ga0066690_10115499 | All Organisms → cellular organisms → Bacteria | 1738 | Open in IMG/M |
3300005179|Ga0066684_10967017 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 552 | Open in IMG/M |
3300005180|Ga0066685_10895443 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300005181|Ga0066678_10324653 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
3300005187|Ga0066675_10277398 | All Organisms → cellular organisms → Bacteria | 1206 | Open in IMG/M |
3300005187|Ga0066675_10424977 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 984 | Open in IMG/M |
3300005187|Ga0066675_10703567 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
3300005290|Ga0065712_10650304 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300005293|Ga0065715_10053668 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 867 | Open in IMG/M |
3300005332|Ga0066388_101115515 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1337 | Open in IMG/M |
3300005335|Ga0070666_10405231 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
3300005355|Ga0070671_100932282 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
3300005367|Ga0070667_100176402 | All Organisms → cellular organisms → Bacteria | 1889 | Open in IMG/M |
3300005439|Ga0070711_100855386 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 774 | Open in IMG/M |
3300005445|Ga0070708_102179153 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300005446|Ga0066686_10894877 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
3300005450|Ga0066682_10019348 | All Organisms → cellular organisms → Bacteria | 3823 | Open in IMG/M |
3300005450|Ga0066682_10546163 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
3300005450|Ga0066682_10759473 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 589 | Open in IMG/M |
3300005451|Ga0066681_10691916 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
3300005451|Ga0066681_10752036 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300005454|Ga0066687_10037069 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2192 | Open in IMG/M |
3300005458|Ga0070681_11240068 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
3300005536|Ga0070697_100239660 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1548 | Open in IMG/M |
3300005553|Ga0066695_10650717 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300005553|Ga0066695_10878417 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300005555|Ga0066692_10078907 | All Organisms → cellular organisms → Bacteria | 1906 | Open in IMG/M |
3300005560|Ga0066670_10691989 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 618 | Open in IMG/M |
3300005561|Ga0066699_10191495 | All Organisms → cellular organisms → Bacteria | 1419 | Open in IMG/M |
3300005561|Ga0066699_10656788 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 751 | Open in IMG/M |
3300005569|Ga0066705_10115804 | All Organisms → cellular organisms → Bacteria | 1611 | Open in IMG/M |
3300005574|Ga0066694_10386484 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
3300005586|Ga0066691_10301954 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
3300005587|Ga0066654_10082415 | All Organisms → cellular organisms → Bacteria | 1511 | Open in IMG/M |
3300005587|Ga0066654_10465304 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 692 | Open in IMG/M |
3300005598|Ga0066706_10927284 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 676 | Open in IMG/M |
3300005616|Ga0068852_102290021 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300005713|Ga0066905_102297931 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300005764|Ga0066903_101340864 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1340 | Open in IMG/M |
3300005764|Ga0066903_101609370 | All Organisms → cellular organisms → Bacteria | 1232 | Open in IMG/M |
3300005764|Ga0066903_101953846 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1125 | Open in IMG/M |
3300005764|Ga0066903_102451855 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
3300005764|Ga0066903_107667853 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 556 | Open in IMG/M |
3300005843|Ga0068860_100636638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1074 | Open in IMG/M |
3300005937|Ga0081455_10181458 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1593 | Open in IMG/M |
3300006031|Ga0066651_10219955 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1007 | Open in IMG/M |
3300006034|Ga0066656_11063310 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300006046|Ga0066652_100585370 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1050 | Open in IMG/M |
3300006046|Ga0066652_101301231 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
3300006173|Ga0070716_101067748 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300006173|Ga0070716_101641882 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 529 | Open in IMG/M |
3300006796|Ga0066665_10336969 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
3300006796|Ga0066665_10672012 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 822 | Open in IMG/M |
3300006800|Ga0066660_10569308 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
3300006844|Ga0075428_102359708 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 547 | Open in IMG/M |
3300007265|Ga0099794_10554173 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
3300009012|Ga0066710_104884553 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300009038|Ga0099829_11801712 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 500 | Open in IMG/M |
3300009137|Ga0066709_101486073 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 979 | Open in IMG/M |
3300009137|Ga0066709_101665074 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 908 | Open in IMG/M |
3300009137|Ga0066709_103615958 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 561 | Open in IMG/M |
3300009137|Ga0066709_103788892 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300009143|Ga0099792_10356972 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 883 | Open in IMG/M |
3300009147|Ga0114129_12549220 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
3300009553|Ga0105249_10829857 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 989 | Open in IMG/M |
3300010043|Ga0126380_11301443 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 633 | Open in IMG/M |
3300010046|Ga0126384_11025615 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 752 | Open in IMG/M |
3300010301|Ga0134070_10320742 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300010301|Ga0134070_10444393 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300010320|Ga0134109_10165077 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
3300010320|Ga0134109_10213038 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 717 | Open in IMG/M |
3300010320|Ga0134109_10233329 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 689 | Open in IMG/M |
3300010320|Ga0134109_10459865 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300010322|Ga0134084_10103535 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
3300010322|Ga0134084_10226373 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 665 | Open in IMG/M |
3300010325|Ga0134064_10425480 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 536 | Open in IMG/M |
3300010325|Ga0134064_10480568 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300010329|Ga0134111_10035009 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1766 | Open in IMG/M |
3300010329|Ga0134111_10402251 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 586 | Open in IMG/M |
3300010358|Ga0126370_11189499 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 708 | Open in IMG/M |
3300010361|Ga0126378_10931931 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 974 | Open in IMG/M |
3300010364|Ga0134066_10069213 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 956 | Open in IMG/M |
3300010366|Ga0126379_11999449 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 682 | Open in IMG/M |
3300010376|Ga0126381_101031686 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1187 | Open in IMG/M |
3300010376|Ga0126381_101117248 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1139 | Open in IMG/M |
3300010397|Ga0134124_12822395 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300011003|Ga0138514_100064142 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 761 | Open in IMG/M |
3300011269|Ga0137392_11358958 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 569 | Open in IMG/M |
3300012189|Ga0137388_11276055 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300012198|Ga0137364_10014090 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 4697 | Open in IMG/M |
3300012198|Ga0137364_10074916 | All Organisms → cellular organisms → Bacteria | 2324 | Open in IMG/M |
3300012198|Ga0137364_10366973 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1075 | Open in IMG/M |
3300012198|Ga0137364_10378457 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1058 | Open in IMG/M |
3300012199|Ga0137383_10044038 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 3175 | Open in IMG/M |
3300012199|Ga0137383_10730229 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
3300012200|Ga0137382_10066171 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2302 | Open in IMG/M |
3300012201|Ga0137365_10507403 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
3300012201|Ga0137365_11192430 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 545 | Open in IMG/M |
3300012202|Ga0137363_10232473 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1492 | Open in IMG/M |
3300012202|Ga0137363_10596721 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
3300012202|Ga0137363_11080101 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300012202|Ga0137363_11713893 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 521 | Open in IMG/M |
3300012203|Ga0137399_11231557 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
3300012203|Ga0137399_11303846 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 610 | Open in IMG/M |
3300012204|Ga0137374_10242398 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1517 | Open in IMG/M |
3300012206|Ga0137380_11232889 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300012208|Ga0137376_10371395 | All Organisms → cellular organisms → Bacteria | 1242 | Open in IMG/M |
3300012208|Ga0137376_10528700 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1023 | Open in IMG/M |
3300012208|Ga0137376_10532430 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1019 | Open in IMG/M |
3300012208|Ga0137376_11735108 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300012210|Ga0137378_10031640 | All Organisms → cellular organisms → Bacteria | 4690 | Open in IMG/M |
3300012210|Ga0137378_11189980 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 678 | Open in IMG/M |
3300012211|Ga0137377_10131996 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2386 | Open in IMG/M |
3300012211|Ga0137377_11367867 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 637 | Open in IMG/M |
3300012285|Ga0137370_10397199 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 835 | Open in IMG/M |
3300012285|Ga0137370_10952518 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 530 | Open in IMG/M |
3300012349|Ga0137387_10652083 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 762 | Open in IMG/M |
3300012349|Ga0137387_11314728 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300012353|Ga0137367_10425960 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 940 | Open in IMG/M |
3300012354|Ga0137366_10552834 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
3300012361|Ga0137360_10304710 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1323 | Open in IMG/M |
3300012361|Ga0137360_10891451 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
3300012362|Ga0137361_10404565 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1254 | Open in IMG/M |
3300012362|Ga0137361_11702370 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 550 | Open in IMG/M |
3300012582|Ga0137358_10386687 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 947 | Open in IMG/M |
3300012685|Ga0137397_11107259 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300012911|Ga0157301_10145617 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 748 | Open in IMG/M |
3300012918|Ga0137396_11071266 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 578 | Open in IMG/M |
3300012922|Ga0137394_11539463 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300012923|Ga0137359_11192147 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 649 | Open in IMG/M |
3300012924|Ga0137413_11631681 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 528 | Open in IMG/M |
3300012925|Ga0137419_10519886 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 947 | Open in IMG/M |
3300012927|Ga0137416_11363920 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 641 | Open in IMG/M |
3300012927|Ga0137416_11472815 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 618 | Open in IMG/M |
3300012929|Ga0137404_10272881 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1459 | Open in IMG/M |
3300012941|Ga0162652_100010449 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1143 | Open in IMG/M |
3300012948|Ga0126375_11104991 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 653 | Open in IMG/M |
3300012948|Ga0126375_11767166 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300012957|Ga0164303_11398577 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 523 | Open in IMG/M |
3300012960|Ga0164301_10808253 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 718 | Open in IMG/M |
3300012961|Ga0164302_10716425 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 743 | Open in IMG/M |
3300012971|Ga0126369_11687747 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 723 | Open in IMG/M |
3300012977|Ga0134087_10216090 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
3300012985|Ga0164308_10823783 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 811 | Open in IMG/M |
3300012987|Ga0164307_11843575 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 513 | Open in IMG/M |
3300013296|Ga0157374_12396810 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300014166|Ga0134079_10016882 | All Organisms → cellular organisms → Bacteria | 2305 | Open in IMG/M |
3300014166|Ga0134079_10201931 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
3300014325|Ga0163163_10948982 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 923 | Open in IMG/M |
3300015077|Ga0173483_10698867 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300015357|Ga0134072_10328605 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300015371|Ga0132258_11408986 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1761 | Open in IMG/M |
3300015372|Ga0132256_103764542 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 510 | Open in IMG/M |
3300015373|Ga0132257_103226165 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300015374|Ga0132255_104886500 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300016319|Ga0182033_10953795 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 761 | Open in IMG/M |
3300016357|Ga0182032_11471786 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 591 | Open in IMG/M |
3300016387|Ga0182040_10216634 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1418 | Open in IMG/M |
3300017654|Ga0134069_1130942 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
3300017654|Ga0134069_1343148 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 536 | Open in IMG/M |
3300017657|Ga0134074_1363417 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300017792|Ga0163161_11606142 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 574 | Open in IMG/M |
3300017997|Ga0184610_1036549 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1402 | Open in IMG/M |
3300018051|Ga0184620_10081237 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
3300018061|Ga0184619_10209192 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
3300018071|Ga0184618_10049396 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1524 | Open in IMG/M |
3300018076|Ga0184609_10087397 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1385 | Open in IMG/M |
3300018431|Ga0066655_11270403 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300018433|Ga0066667_12212077 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 512 | Open in IMG/M |
3300018469|Ga0190270_12065477 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
3300018482|Ga0066669_10381304 | All Organisms → cellular organisms → Bacteria | 1185 | Open in IMG/M |
3300019865|Ga0193748_1022262 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 597 | Open in IMG/M |
3300019875|Ga0193701_1016545 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1491 | Open in IMG/M |
3300019883|Ga0193725_1025383 | All Organisms → cellular organisms → Bacteria | 1603 | Open in IMG/M |
3300019883|Ga0193725_1125954 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300019886|Ga0193727_1044651 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1455 | Open in IMG/M |
3300019997|Ga0193711_1045788 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 528 | Open in IMG/M |
3300020001|Ga0193731_1160514 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 546 | Open in IMG/M |
3300020004|Ga0193755_1163367 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 666 | Open in IMG/M |
3300020015|Ga0193734_1034366 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 950 | Open in IMG/M |
3300020018|Ga0193721_1007438 | All Organisms → cellular organisms → Bacteria | 2865 | Open in IMG/M |
3300020022|Ga0193733_1126853 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 702 | Open in IMG/M |
3300020170|Ga0179594_10026757 | All Organisms → cellular organisms → Bacteria | 1807 | Open in IMG/M |
3300020580|Ga0210403_11463160 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300021080|Ga0210382_10101866 | All Organisms → cellular organisms → Bacteria | 1196 | Open in IMG/M |
3300021168|Ga0210406_10265604 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1404 | Open in IMG/M |
3300021344|Ga0193719_10165427 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
3300021560|Ga0126371_10270973 | All Organisms → cellular organisms → Bacteria | 1818 | Open in IMG/M |
3300021560|Ga0126371_10675155 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1182 | Open in IMG/M |
3300022756|Ga0222622_10061931 | All Organisms → cellular organisms → Bacteria | 2164 | Open in IMG/M |
3300022756|Ga0222622_11347261 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 525 | Open in IMG/M |
3300023058|Ga0193714_1056375 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 559 | Open in IMG/M |
3300024222|Ga0247691_1071143 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 525 | Open in IMG/M |
3300025903|Ga0207680_11359442 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300025905|Ga0207685_10320227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 773 | Open in IMG/M |
3300025906|Ga0207699_11058692 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 600 | Open in IMG/M |
3300025907|Ga0207645_10345984 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 994 | Open in IMG/M |
3300025916|Ga0207663_10130045 | All Organisms → cellular organisms → Bacteria | 1738 | Open in IMG/M |
3300025928|Ga0207700_10115107 | All Organisms → cellular organisms → Bacteria | 2171 | Open in IMG/M |
3300025928|Ga0207700_11626229 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 571 | Open in IMG/M |
3300025929|Ga0207664_10234631 | All Organisms → cellular organisms → Bacteria | 1596 | Open in IMG/M |
3300025930|Ga0207701_11644362 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300025931|Ga0207644_10135822 | All Organisms → cellular organisms → Bacteria | 1888 | Open in IMG/M |
3300025932|Ga0207690_11706207 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 526 | Open in IMG/M |
3300025936|Ga0207670_10577391 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 921 | Open in IMG/M |
3300025949|Ga0207667_11711452 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300025972|Ga0207668_11629965 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300025981|Ga0207640_10836326 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 800 | Open in IMG/M |
3300025986|Ga0207658_10807700 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 852 | Open in IMG/M |
3300026035|Ga0207703_11321931 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
3300026309|Ga0209055_1061729 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1584 | Open in IMG/M |
3300026309|Ga0209055_1231405 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300026316|Ga0209155_1119946 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 917 | Open in IMG/M |
3300026326|Ga0209801_1074270 | All Organisms → cellular organisms → Bacteria | 1500 | Open in IMG/M |
3300026326|Ga0209801_1315568 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300026329|Ga0209375_1109244 | All Organisms → cellular organisms → Bacteria | 1231 | Open in IMG/M |
3300026331|Ga0209267_1034194 | All Organisms → cellular organisms → Bacteria | 2404 | Open in IMG/M |
3300026342|Ga0209057_1079082 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1399 | Open in IMG/M |
3300026498|Ga0257156_1126722 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300026537|Ga0209157_1057994 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2008 | Open in IMG/M |
3300026537|Ga0209157_1191759 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 875 | Open in IMG/M |
3300026540|Ga0209376_1406459 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 509 | Open in IMG/M |
3300026542|Ga0209805_1114115 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1281 | Open in IMG/M |
3300026542|Ga0209805_1360573 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300026547|Ga0209156_10165401 | All Organisms → cellular organisms → Bacteria | 1067 | Open in IMG/M |
3300026547|Ga0209156_10308855 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
3300026550|Ga0209474_10328673 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
3300026552|Ga0209577_10354926 | All Organisms → cellular organisms → Bacteria | 1077 | Open in IMG/M |
3300027018|Ga0208475_1004182 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1410 | Open in IMG/M |
3300027018|Ga0208475_1013846 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
3300027018|Ga0208475_1019189 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
3300027576|Ga0209003_1014877 | All Organisms → cellular organisms → Bacteria | 1212 | Open in IMG/M |
3300027748|Ga0209689_1275519 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 666 | Open in IMG/M |
3300027846|Ga0209180_10101055 | All Organisms → cellular organisms → Bacteria | 1643 | Open in IMG/M |
3300028536|Ga0137415_10130364 | All Organisms → cellular organisms → Bacteria | 2358 | Open in IMG/M |
3300028768|Ga0307280_10254218 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 633 | Open in IMG/M |
3300028784|Ga0307282_10212108 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
3300028793|Ga0307299_10007748 | All Organisms → cellular organisms → Bacteria | 3758 | Open in IMG/M |
3300028807|Ga0307305_10268113 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
3300028828|Ga0307312_10338293 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 983 | Open in IMG/M |
3300028875|Ga0307289_10105648 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1150 | Open in IMG/M |
3300028878|Ga0307278_10491405 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300028884|Ga0307308_10032805 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2419 | Open in IMG/M |
3300028884|Ga0307308_10090183 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1457 | Open in IMG/M |
3300030916|Ga0075386_12101405 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 706 | Open in IMG/M |
3300031231|Ga0170824_104983861 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 552 | Open in IMG/M |
3300031231|Ga0170824_109894961 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300031231|Ga0170824_119552925 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300031716|Ga0310813_12149860 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300031720|Ga0307469_10113964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1937 | Open in IMG/M |
3300031781|Ga0318547_11042301 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300031820|Ga0307473_10690517 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
3300032017|Ga0310899_10353277 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 695 | Open in IMG/M |
3300032174|Ga0307470_11903781 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 506 | Open in IMG/M |
3300032180|Ga0307471_101740712 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 776 | Open in IMG/M |
3300032261|Ga0306920_100733774 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1454 | Open in IMG/M |
3300033412|Ga0310810_10241484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1997 | Open in IMG/M |
3300033412|Ga0310810_11329310 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 22.52% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.54% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.93% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 6.62% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.97% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 3.64% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.64% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.32% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.32% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.65% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.99% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.99% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.32% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.32% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.99% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.99% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.99% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.99% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.66% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.66% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.66% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.66% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.66% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.66% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.66% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.66% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.66% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.33% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.33% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.33% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.33% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.33% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.33% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.33% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.33% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.33% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.33% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.33% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.33% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.33% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.33% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.33% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.33% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.33% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.33% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
2170459023 | Grass soil microbial communities from Rothamsted Park, UK - FA3 (control condition) | Environmental | Open in IMG/M |
3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
3300000709 | Amended soil microbial communities from Kansas Great Prairies, USA - Total DNA F1.4 TB amended with BrdU and acetate no abondance | Environmental | Open in IMG/M |
3300000886 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-65cm-3A)- 1 week illumina | Environmental | Open in IMG/M |
3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Host-Associated | Open in IMG/M |
3300002128 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012941 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015 | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019865 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s1 | Environmental | Open in IMG/M |
3300019875 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2 | Environmental | Open in IMG/M |
3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
3300019997 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m2 | Environmental | Open in IMG/M |
3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
3300020015 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1 | Environmental | Open in IMG/M |
3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300023058 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m1 | Environmental | Open in IMG/M |
3300024222 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK32 | Environmental | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300027018 | Grasslands soil microbial communities from Kansas, USA, that are Nitrogen fertilized - NN575 (SPAdes) | Environmental | Open in IMG/M |
3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) | Host-Associated | Open in IMG/M |
3300027576 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300030916 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
GPIPI_03977960 | 2088090014 | Soil | PSGAKLEMLWRYEQYFYPGNGWASGFMTNGSSTGLVQLDIHP |
GPIPI_03911400 | 2088090014 | Soil | LQMLWRYEQFFYPGNGWTSGFMTREGSTGLIRIEIKE |
E41_01001870 | 2170459005 | Grass Soil | HIYYEIRWKKSSGANLEMLWRYEQFLYPGNGWASGFMTRQGSTGLIRIEMKD |
FA3_12102290 | 2170459023 | Grass Soil | RRNIYQEIRWKKPSGTTLQMLWRYEQFFYLGNGWTSGLMTREGATGLIRIEIKE |
F14TC_1038149772 | 3300000559 | Soil | IRWKKSSGANLEMLWRYEQFFYPSNGWASGFMTREGSTGLIRVEIKE* |
KanNP_Total_F14TBDRAFT_10236292 | 3300000709 | Soil | HIYYEIRWKKSSGANLEMVWRYEQFFYPGNGWASGFMTREGSTGLIRVEIKE* |
AL3A1W_15686662 | 3300000886 | Permafrost | WEKPTGGRLEMLWRYEQYFYDGWASGFMTRQGTVGLIRVDIRP* |
JGI11643J12802_113248572 | 3300000890 | Soil | KLEMLWRYEQYFYPVNGWASGFMTHEGSTGLIQLDISP* |
JGI1027J12803_1006035391 | 3300000955 | Soil | GAKLEMLWRYEQYFYSGAGWASGFMTREDSTGLIRVDIRL* |
JGI1027J12803_1028790401 | 3300000955 | Soil | GAKLEMLWRYEQYFYSDDGWASGFMTREGSTGLIRVDIRL* |
JGI1027J12803_1068023232 | 3300000955 | Soil | VLWRYEQLFFPGNGWANGFMTREGSTGLIRVEIKK* |
JGI1027J12803_1071757884 | 3300000955 | Soil | GANLRMLWRYEQFFYPDNGWTGGFMTREGSTGLIRVEIKL* |
F14TB_1000871213 | 3300001431 | Soil | WKKPSGAKLEMLWRYEQYFYPDNGWASGFMTYKGSTGLISVEIKQ* |
C688J18823_102906071 | 3300001686 | Soil | MVWRYEQFFYPGNGWTSGFMTREGSTGLIRIDIKE |
JGI24035J26624_10090412 | 3300002126 | Corn, Switchgrass And Miscanthus Rhizosphere | IRWKKSSGAKLHMLWRYEQFFYPGNGWTSGLMTREGSTGLILVDIKD* |
JGI24036J26619_101408342 | 3300002128 | Corn, Switchgrass And Miscanthus Rhizosphere | KRHTYYEILWKKSSGANLRMLWRYEQFFYPGNGWAGGLMTREGSTGLTRVEIKQ* |
Ga0062593_1024854202 | 3300004114 | Soil | YEIVWKKSSGANLQMLWRYEQFFYSGNGWAGGFMTREGSTGLIRVEIKE* |
Ga0062590_1000810241 | 3300004157 | Soil | SSGASLQMLWRYDQFFYPGNGWTSSVMTREGSTGLIRVDIKE* |
Ga0063356_1035472451 | 3300004463 | Arabidopsis Thaliana Rhizosphere | YQEIRWNKSSGVKLQMLWRYDQFFYPRNGWTSSLMTREGSTGLIRIDIKE* |
Ga0062594_1018980053 | 3300005093 | Soil | SSGAKLQMLWRYEQFFYPGNGWTSGFMTREGSTGLIRVKVEE* |
Ga0066672_104101273 | 3300005167 | Soil | GAKLEMLWRYEQYFYPQDRWTEAFMTRPGSTGLIRIDISNVAR* |
Ga0066672_105441361 | 3300005167 | Soil | QKVNGDRLDMRWRYEQYFYDRWASGFMTHEGTTGLIRAEIRLTKIARC* |
Ga0066672_107542453 | 3300005167 | Soil | GAKLEMLWRYEQYFYPQDRWTEAFMTRPGSTGLIRIDISNAAR* |
Ga0066677_100823351 | 3300005171 | Soil | LIWNKPSGAKLEMVWRYEQYFYPGDGWGSGFMTREGSTGLIQVDIHP* |
Ga0066677_105124962 | 3300005171 | Soil | RLDMRWRYEQYFYDRWASGFMTREGTTGLIQAEIRPTKIARR* |
Ga0066677_105842172 | 3300005171 | Soil | SGAKLEMLWRYEQYFYPGNGWASGFMTREGSTGLIRLNIQP* |
Ga0066683_104648861 | 3300005172 | Soil | KSSGATLEMLWRYEQYFYPRNGWGSGFMTREGSTGLIRLDIRP* |
Ga0066690_101154993 | 3300005177 | Soil | KSSGAKLEMLWRYEQVFYPGNGWASGFMTREGSTGLVRIDIRQ* |
Ga0066684_109670171 | 3300005179 | Soil | PELEMLWRYEQYFYPGNGWASGFMTRAGSTGLVRLEIKE* |
Ga0066685_108954432 | 3300005180 | Soil | WKKTTGATLDMIWRYEQFFYGQQLIPGNGWGSGFMTREGSTGLIQVTIKE* |
Ga0066678_103246531 | 3300005181 | Soil | VLWKKSSGGKLEMLWRYEQYFYPGNGWASGFMTHEGSTGLILLDIRP* |
Ga0066676_107651613 | 3300005186 | Soil | KLEMLWRYEQYFYPQDRWTEAFMTRPGSTGLIRIDISNAAR* |
Ga0066675_102773982 | 3300005187 | Soil | IYYQLRWKKSSGATLEMLWRYEQYFYPRNGWGSGFMTREGSTGLIRLDIRP* |
Ga0066675_104249772 | 3300005187 | Soil | WKKQNSSELRMAWRYEQYFYRGDGWASGFMTHEGTTGLIKVDVEN* |
Ga0066675_107035671 | 3300005187 | Soil | PSGAKLEMLWRYEQYFYPGDGWASGFMTREGSTGLIKVDISP* |
Ga0065712_106503041 | 3300005290 | Miscanthus Rhizosphere | TGATLDMIWRYEQFFYGQQLIPGNGWGNGFMTREGSTGLIEVTIKE* |
Ga0065715_100536681 | 3300005293 | Miscanthus Rhizosphere | AKLQMLWRYEQFFYPGNGWTSGFMTREGSTGLIRVKVEE* |
Ga0066388_1011155153 | 3300005332 | Tropical Forest Soil | GAKLEMLWRYEQFFYPGSGWASGFMTREGSTGLTRVKINE* |
Ga0070666_104052312 | 3300005335 | Switchgrass Rhizosphere | TYQKILWTKSSGASLQMLWRYDQFFYPGNGWTSSVMTREGSTGLIRVDIKE* |
Ga0070671_1009322821 | 3300005355 | Switchgrass Rhizosphere | KGSGEKLEMTWRYEQYFYPRDGWASGFMTHARTTGLVRVKISR* |
Ga0070667_1001764023 | 3300005367 | Switchgrass Rhizosphere | WKKSSGAKLQMLWRYEQFFYPGNGWTSGLITREGSTGLILVDIKD* |
Ga0070711_1008553862 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | GASLQMLWRYEQFFFRGDGWTSGFMTREGSTGLIRIEIKE* |
Ga0070708_1021791531 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | WKKPSGMKLEMLWRYEQYFYSGEGWTSGFMTREGSTGLIRADIRP* |
Ga0066686_108948771 | 3300005446 | Soil | SWKRHLYYKLRWKKTTGATLDMIWRYEQFFYGQQLIPGNGWGSGFMTREGSTGLIQVTIKE* |
Ga0066682_100193484 | 3300005450 | Soil | MYYQLRWKKASGETLEMLWRYEQYFYPGNGWGSGFMTREGSTGLIRVDLHL* |
Ga0066682_105461632 | 3300005450 | Soil | SGAKLEMLWRYEQYFYPGNGWASGFMTRESSTGLIRVEIKE* |
Ga0066682_107594732 | 3300005450 | Soil | SGADLQMLWRYEQFFYPGIGWGSGFMTHKGSTRLTRVKINE* |
Ga0066681_106919161 | 3300005451 | Soil | MIWRYEQFFYGQRLIPGNGWGNGFMTHEGSTGLIQLDIHP* |
Ga0066681_107520361 | 3300005451 | Soil | LDMIWRYEQFFYGQQLIPDNGWGSGFMTHEGSTGLIQLDISP* |
Ga0066687_100370693 | 3300005454 | Soil | WKKRNGAKLDMLWRYEQYFYSTDRWSSGFMMREGSTGLIRVGISNDAR* |
Ga0070681_112400682 | 3300005458 | Corn Rhizosphere | WKKSSGANLEILWRYEQFFYPGNGWTSGFMTREGSTGLIRVDIKE* |
Ga0068867_1010002941 | 3300005459 | Miscanthus Rhizosphere | LYYRLIWEKSGGARLEMVWRYEQYFYEDWASGFMTRAGTTGLIHVDIRP* |
Ga0070697_1002396603 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | TGATLDMIWRYEQFFYGQQLIPGNGWGNGFMTREGSTGLIQVAIKQ* |
Ga0066695_106507171 | 3300005553 | Soil | DMIWRYEQFFYGQRLIPGNGWGNGFMTHEGSTGLIQLDIHP* |
Ga0066695_107283661 | 3300005553 | Soil | LWRYEQYFYPEDRWTEAFMTRPGSTGLIRIDISNASR* |
Ga0066695_108784171 | 3300005553 | Soil | SGAKLEMLWRYEQYFYPGNGWASGFMTREGSTGLIRVNIQP* |
Ga0066692_100789073 | 3300005555 | Soil | LWKKPSGAKLEMLWRYEQYFYPELGWASGFMTREGSTGLIGVDISLGR* |
Ga0066707_106942421 | 3300005556 | Soil | EMLWRYEQYFYPQDRWTEAFMTRPGSTGLIRIDISNASR* |
Ga0066670_106919891 | 3300005560 | Soil | EVRWKKLSGTNLEMLWRYEQFFYPGNGWGSGFMTREGVTGLTRVRIND* |
Ga0066699_101914951 | 3300005561 | Soil | RHIHYRLLWKKPSGAKLEMLWRYEQYFYPELGWGSGFMTREGSTGLIGVDISLGR* |
Ga0066699_106567882 | 3300005561 | Soil | MRWRYEQYFYDRWASGFMTHEGTTGLIQAEIRPTKIARR* |
Ga0066705_100768773 | 3300005569 | Soil | HLYYELSWQKQNGERLEMRWRYEQYFYDRWASGFMTHEGTTGLIRAEIRPAKIAGR* |
Ga0066705_101158041 | 3300005569 | Soil | KQNGAKLEMLWRYEQYFYPGDGWAGGFMTHEGSTGLIRLDIQP* |
Ga0066694_103864842 | 3300005574 | Soil | LRWKKTTGATLDMIWRYEQFFYGQQLIPGNGWGNGFMTREGSTGLIQLDIHP* |
Ga0066708_107496992 | 3300005576 | Soil | RLNMRWRYEQYFYDRWASGFMTHEGTTGLIQAEIRPTKIARR* |
Ga0066691_103019543 | 3300005586 | Soil | MLWRYEQYFYPQDRWTEAFMTRPGSTGLIRIDISNAAR* |
Ga0066654_100824151 | 3300005587 | Soil | TWKKQNGAKLDMLWRYEQYFYSTDGWASGFMTHEGSTGLIRVGIANGAR* |
Ga0066654_104653042 | 3300005587 | Soil | LWRYEQFFYPANGWASRFMTREGSTCLIRAEIKE* |
Ga0066706_109272841 | 3300005598 | Soil | IRWRKSAGVTLEMLWRYKQFFYPGKGWAGGFMMREDSSGLIRVEIKE* |
Ga0068852_1022900212 | 3300005616 | Corn Rhizosphere | RLEMVWRYEQPYYDGWASGFMTRAGTTGLIRVEIRP* |
Ga0066905_1022979311 | 3300005713 | Tropical Forest Soil | GWLWRYEQYFNENWASGFMTRAGTTGLIRVDIRP* |
Ga0066903_1013408643 | 3300005764 | Tropical Forest Soil | NLEMLWRYEQFFYPGNGWASASMTREGSTGLIRVKINE* |
Ga0066903_1016093703 | 3300005764 | Tropical Forest Soil | SGATLEMLWRYEQYFYPKTGWGSGFMTGEDSSGLTKINIHL* |
Ga0066903_1019538463 | 3300005764 | Tropical Forest Soil | LWRYEQFFYPGNGWVGGLMTREGSTGLIRVQIKQ* |
Ga0066903_1024518552 | 3300005764 | Tropical Forest Soil | EIVWKKSSGANLQMVWRYEQLFFSGNGWASGFMARQGSTGLVRVEIKQ* |
Ga0066903_1076678532 | 3300005764 | Tropical Forest Soil | VRWKKSSGANLEMLWRYEQFFYPGNGWDSGFMTHEGSTGLIRVKIDE* |
Ga0068860_1006366381 | 3300005843 | Switchgrass Rhizosphere | EMVWRYEQTYYEGWASGFMTRAGTTGLIRVEIRP* |
Ga0081455_101814581 | 3300005937 | Tabebuia Heterophylla Rhizosphere | KLKMVWRYEQYFYNVWTSGFMTREGSTGLISVQISP* |
Ga0066651_102199551 | 3300006031 | Soil | MLWRYEQFFYPANGWASRFMTREGSTGLIRAEIKE* |
Ga0066656_110633101 | 3300006034 | Soil | SGAKLEMLWRYEQYFYPDNGWASGFMTYKGSTGLIQLDISP* |
Ga0066652_1005853702 | 3300006046 | Soil | LEMLWRYEQYFYPRDGWASGFMTHEGSTGLIQVHIKE* |
Ga0066652_1012513903 | 3300006046 | Soil | GARLEMLWRYEQYFYPEDRWTEAFMTRPGSTGLIRIDISNASR* |
Ga0066652_1013012311 | 3300006046 | Soil | WKKSSGANLEMLWRYEQFLYPGNGWASGFMTRQGFTGLIRIEIKN* |
Ga0075017_1012977512 | 3300006059 | Watersheds | RYEQYFYQNDGWVEAFMTRPGATGLIRVEISNGSR* |
Ga0070716_1010677482 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | QNGAKLEMLWRYEQYFYSGDGWANGFMTREGSTGLIRVDIRL* |
Ga0070716_1016418822 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | EMLWRYEQFFYPGSGWGSGFMTHESSTGLIRVKINE* |
Ga0066665_103369691 | 3300006796 | Soil | TLEMLWRYEQYFYPGNGWASGFMTREGSTGLIRLDIRP* |
Ga0066665_106720124 | 3300006796 | Soil | SGAKLEMLWRYEQYFYPGNGWASGFMTHEGSTGLIRLDIQP* |
Ga0066660_105693082 | 3300006800 | Soil | YYRLIWKKRNSAKLDMIWRYEQYFYSTYGWASGFMTREGSTGLIRVDISNGGR* |
Ga0075428_1023597081 | 3300006844 | Populus Rhizosphere | SGANLRMLWRYEQFFYPGNGWAGGLMTREGSTGLTRVEIKQ* |
Ga0099794_105541732 | 3300007265 | Vadose Zone Soil | WRKPNGVTMEMLWRYEQYFYPGNGWASGFMIREGSTGLIRLDIRP* |
Ga0066710_1048845532 | 3300009012 | Grasslands Soil | WKKTSGAKLEMLWRYEQYFYPGNGWASGFMTHEGSTGLIRLDIQP |
Ga0099829_118017122 | 3300009038 | Vadose Zone Soil | KKASGAKLEMLWRYEQFFYPGNGWASGFMTRESSTGLIRVKINE* |
Ga0066709_1014860731 | 3300009137 | Grasslands Soil | IYYEIVWKKSSGANLQMLWRYEQFFYPGNGWAGEFMTREGSTGLIRVEIKE* |
Ga0066709_1016650742 | 3300009137 | Grasslands Soil | NLEMLWRYEQYFYPGNGWGSGFMTHEGSTGLIRVDIHP* |
Ga0066709_1036159583 | 3300009137 | Grasslands Soil | WRYEQYFYPEDRWTEAFMTRPGSTGLIRIDISNASR* |
Ga0066709_1037888922 | 3300009137 | Grasslands Soil | YYQLLWKKTSGAKLEMLWRYEQYFYPGNGWASGFMTHEGSTGLIRLDIQP* |
Ga0099792_103569722 | 3300009143 | Vadose Zone Soil | RWKKGSGAKLEMLWRYEQFFYPGSGWGSGFMTRESSTGLIRVKINE* |
Ga0114129_125492202 | 3300009147 | Populus Rhizosphere | EMLWRYEQYFYPVNGWASGVMTHEGSTGLIQLDISP* |
Ga0105249_108298572 | 3300009553 | Switchgrass Rhizosphere | VRWKKSSGANLEMLWRYEQYFYPGDGWASGFMTHQGSTGLIRVDIKE* |
Ga0126380_113014432 | 3300010043 | Tropical Forest Soil | EILWKKSTGANLWMLWRYEQFFYPGNGWAGGFMTRQGSTGLVRVEIKE* |
Ga0126384_110256151 | 3300010046 | Tropical Forest Soil | EMLWRYEQFFYSGNGWASGFMTCQGSTGLIRLEIKG* |
Ga0134070_103207421 | 3300010301 | Grasslands Soil | YQLRWKKSSGATLEMLWRYEQYFYPGNGWASGFMTREGSTGLIRLDIRP* |
Ga0134070_104443931 | 3300010301 | Grasslands Soil | LQMLWRYEQYFYPGTGWASGFMTREGSTGLIRLDIRP* |
Ga0134109_101650771 | 3300010320 | Grasslands Soil | PSGAQLQMLWRYEQYFYPGTGWASGFMTREGSTGLIRLDIRP* |
Ga0134109_102130382 | 3300010320 | Grasslands Soil | EIRWKKSSGAKLQMLWRYEQVFYPGNGWTSGLMTREGSTGLIRVDIKE* |
Ga0134109_102333291 | 3300010320 | Grasslands Soil | HMYYQLRWKKASGETLEMLWRYEQYFYPGNGWGSGFMTREGSTGLIRVDLHL* |
Ga0134109_104598651 | 3300010320 | Grasslands Soil | LLWKKPSGATLEMLWRYEQPFYDCWGSGFMTCEGSTGLVRIDIRP* |
Ga0134084_101035351 | 3300010322 | Grasslands Soil | MLWRYEQYFYPHTGWGSGFMTRQGSTGLIRIDIRL* |
Ga0134084_102263731 | 3300010322 | Grasslands Soil | DMIWRYEQYFYSADGWASGFMMREGSTGLIRVDISNGAR* |
Ga0134064_104254801 | 3300010325 | Grasslands Soil | LEMLWRYEQYFYPGNGWASGFMTREGSTGLIRVEIQP* |
Ga0134064_104805682 | 3300010325 | Grasslands Soil | KKTTGAKLDMIWRYEQFFYGQQLIPDNGWGSGFMTHEGSTGLIQLDISP* |
Ga0134111_100350093 | 3300010329 | Grasslands Soil | GMIWRYQQFFYGQRLIPGNGWGNGFMTHEGSTGLIQLDIHP* |
Ga0134111_104022512 | 3300010329 | Grasslands Soil | KLDMLWRYEQYFYSADGWASGFMMREGSTGLIRVDIPNGAR* |
Ga0126370_111894991 | 3300010358 | Tropical Forest Soil | KKSSGAKLEMLWRYEQFFYPGSGWASGFMTQEGSTGLIGVKISE* |
Ga0126378_109319311 | 3300010361 | Tropical Forest Soil | NLKMVWRYEQFFYPGNGWASGFMTHEGSTGLIRVEIKE* |
Ga0134066_100692131 | 3300010364 | Grasslands Soil | TGATLDMIWRYEQFFYGQQLIPGNGWGNGFMTHEGSTGLIQLDIHP* |
Ga0126379_119994492 | 3300010366 | Tropical Forest Soil | LEMLWRYEQYFYPDNGWASGLMTYKGSTGLIRLDISP* |
Ga0126381_1010316862 | 3300010376 | Tropical Forest Soil | MLWRYEQFFYRGKGWGSGFVTREGAAGLNQVEIKK* |
Ga0126381_1011172483 | 3300010376 | Tropical Forest Soil | TKSSGAKLQMLWRYEQFFYPGNGWTTGFMTREGSTGLIRVEIKE* |
Ga0134124_128223951 | 3300010397 | Terrestrial Soil | KKSAGAKLEMLWRYEQYFYPANGWASGFMTRAGSTGLIQVAVKE* |
Ga0134121_131647631 | 3300010401 | Terrestrial Soil | LYYRLVWERPGGGRLEMLWRYEQYFYENWASGFMTRAGTTGLIRVDIRP* |
Ga0138514_1000641422 | 3300011003 | Soil | MSGRQMLWRYEQYFYPTDGWAAGNMTREGNTGLIKAEIKP* |
Ga0137392_113589582 | 3300011269 | Vadose Zone Soil | LEMLWRYEQYFYPEDRWTEAFMTRPGSTGLIRINISNAPR* |
Ga0137388_112760552 | 3300012189 | Vadose Zone Soil | GAKLEMMCRYEQYFYPGLGWGSGFMTREGSTGLIGVDLSLGR* |
Ga0137364_100140901 | 3300012198 | Vadose Zone Soil | YQLRWKKSSGPELEMLWRYEQYFYPGNGWASGFMIRQGSTGLVRLQIKE* |
Ga0137364_100749164 | 3300012198 | Vadose Zone Soil | YYRLLWKKPSGAKLEMLWRYEQYFYPGNGWASGFMTYKGATGLIQLDIKE* |
Ga0137364_103669732 | 3300012198 | Vadose Zone Soil | LYYRVTWKKQNSTKLDMLWRYEQYFYSADGWASGFMMREGSTGLIRVDISNGAR* |
Ga0137364_103784572 | 3300012198 | Vadose Zone Soil | RWKKSSGANLEMLWRYEQFLYPGNGWASGFMTRQGSTGLIRIEMKD* |
Ga0137383_100440381 | 3300012199 | Vadose Zone Soil | WKKRNGAKLDMLWRYEQYFYSTDGWASGFMMRKGSTGLIRVDISNGAR* |
Ga0137383_107302291 | 3300012199 | Vadose Zone Soil | KLEMLWRYEQYFYPGDGWGSGFMTREGSTGLIRVDIHP* |
Ga0137382_100661711 | 3300012200 | Vadose Zone Soil | SGAKLEMLWRYEQYFYPANGWASGFMTRAGSTGLIQVAIKE* |
Ga0137365_105074031 | 3300012201 | Vadose Zone Soil | GAKLEMLWRYEQYFYPGDGWASGFMTREGSTGLIRVDIRP* |
Ga0137365_111924302 | 3300012201 | Vadose Zone Soil | YYEIRWKKSSGANLEMLWRYEQFFYPGKGWASGFMTREGSTGLIRAGIKE* |
Ga0137363_102324731 | 3300012202 | Vadose Zone Soil | SGATLEMLWRYEQYFYPGNGWASGFMTRQGSTGLIQVEIKN* |
Ga0137363_105967212 | 3300012202 | Vadose Zone Soil | SGAKLEMLWRYEQYFYPDSGWANGFMTYKGSTGLIQLDIQP* |
Ga0137363_110801011 | 3300012202 | Vadose Zone Soil | LEMLWRYEQYYYAADGWPSGLMTREGSTGLIRVDIHP* |
Ga0137363_117138931 | 3300012202 | Vadose Zone Soil | LWRYEQFFYLGNGWTSGFMTREGSTGLIQVKITE* |
Ga0137399_112315572 | 3300012203 | Vadose Zone Soil | EMLWRYEQYFYPGNGWASGFMVREGSTGLVRLEIKD* |
Ga0137399_113038462 | 3300012203 | Vadose Zone Soil | ERLWRYEQFFYPGDGWASGFMTRHGSTGLIRIEMKE* |
Ga0137374_102423983 | 3300012204 | Vadose Zone Soil | SKLEMLWRYEQYFYPSNGWASGFMTREGSTGLIQLNISP* |
Ga0137362_108383081 | 3300012205 | Vadose Zone Soil | RYEQYFYPEDRWTEAFMTRPGSTGLIRIDISNASR* |
Ga0137380_112328891 | 3300012206 | Vadose Zone Soil | TSGAKLEMAWRYEQYFYPGNGWASGFMTHEGSTGLIQLDIQP* |
Ga0137376_103713951 | 3300012208 | Vadose Zone Soil | LQMLWRYEQYFYPGNGWASGFMTREGSTGLIRLDIRP* |
Ga0137376_105287001 | 3300012208 | Vadose Zone Soil | LRWKKTTGATLDMIWRYEQFFYGQQLIPGNGWGNGFMTREGSTGLIRAEIKE* |
Ga0137376_105324302 | 3300012208 | Vadose Zone Soil | YMYYQLRWKKSSGPELEMLWRYEQYFYPGNGWASGFMVREGSTGLVRLEIKD* |
Ga0137376_117351081 | 3300012208 | Vadose Zone Soil | YQLRWKKSSGPELEMLWRYEQYFYPGNGWASGFMVREGSTGLVRLEIKD* |
Ga0137378_100316406 | 3300012210 | Vadose Zone Soil | YYRVLWKKSSGAKLEMLWRYEQYFYPGNDWTSGFMTHEGSTGLIQLDIRP* |
Ga0137378_111899801 | 3300012210 | Vadose Zone Soil | RHIYYEIRWKKASGADLQMLWHYEQFFYPGNGWGSGFMTHKGSTRLTRVKINE* |
Ga0137377_101319963 | 3300012211 | Vadose Zone Soil | EMLWRYEQYFYPCNGWASGFMTRESSTGLIRVEIKE* |
Ga0137377_113678671 | 3300012211 | Vadose Zone Soil | NLEMLWRYEQYFYPANGWGSGFMTREGSTGLIRVDIHL* |
Ga0137370_103971992 | 3300012285 | Vadose Zone Soil | FWRYEQYFYPADRWAKGFMTRPGSTGLIRIDISNASR* |
Ga0137370_109525181 | 3300012285 | Vadose Zone Soil | NSTKLDMLWRYEPYFYSADHWASGFMMREGSTGLIRVDISNGAR* |
Ga0137387_106520831 | 3300012349 | Vadose Zone Soil | LEMLWRYEQFFYPGKGWASGFMTREDSTGLIRAEIKE* |
Ga0137387_113147282 | 3300012349 | Vadose Zone Soil | AKLEMLWRYEQYFYPGDGWAGGFMTREGSTGLIRENIQP* |
Ga0137367_104259602 | 3300012353 | Vadose Zone Soil | GVKLEMLWRYEQYFYPGNGWASGFMTHEGSTGLIQLDISP* |
Ga0137366_105528342 | 3300012354 | Vadose Zone Soil | KLEMLWRYEQYFYPGNGWASGFMTRESSTGLIRVEIKE* |
Ga0137360_103047103 | 3300012361 | Vadose Zone Soil | MLWRYEQFLYPGNGWASGFMTRQGSTGLIRIEMKD* |
Ga0137360_108914512 | 3300012361 | Vadose Zone Soil | LWRYEQYFYPSDGWGSGFMTRVGSTGLIQVDIHP* |
Ga0137361_104045653 | 3300012362 | Vadose Zone Soil | LEMLWRYEQYFYPGNGWGSSFMTHERSTGLIRVDIRL* |
Ga0137361_117023701 | 3300012362 | Vadose Zone Soil | AQLQMLWRYEQYFYPGNGWASGFMTRQGSTGLIRLDIRP* |
Ga0137358_103866871 | 3300012582 | Vadose Zone Soil | LEMLWRYEQYYYAADGWASGLMTREGSTGLIRVDIQK* |
Ga0137397_109368533 | 3300012685 | Vadose Zone Soil | WRYEQYFYPDDRWTAAFMSRPGSTGLFGIDISNAAR* |
Ga0137397_111072592 | 3300012685 | Vadose Zone Soil | LWRYEQYFYPSDGWTGGNMTREGTTGLIKVEIRP* |
Ga0157301_101456171 | 3300012911 | Soil | MLWRYQQYFYPDNGWASGFMTYNGSTGLIQLDISP* |
Ga0137396_110712662 | 3300012918 | Vadose Zone Soil | EMLWRYEQYFYPGNGWASGFMTRQGSTGLIQVEIKN* |
Ga0137394_115394631 | 3300012922 | Vadose Zone Soil | MLWRYEQYFYPGNGWASGFMTREGSTGLIQVAINE* |
Ga0137359_111921471 | 3300012923 | Vadose Zone Soil | KLEMLWRYEQVFYPGNGWAGGFMTREGSTGLVRIDIKQ* |
Ga0137413_116316812 | 3300012924 | Vadose Zone Soil | RVHWKKSAGANLEMLWRYEQYFYPGNGWASGFMTRQGFTGLIRVEIKN* |
Ga0137419_105198861 | 3300012925 | Vadose Zone Soil | MLWRYEQYFYPDSGWANGFMTYKGSTGLIQLDIQP* |
Ga0137416_113639201 | 3300012927 | Vadose Zone Soil | RWKKASGANLEMLWRYEQFFYPGSGWASGFTKREGSTGLTRVKINE* |
Ga0137416_114728151 | 3300012927 | Vadose Zone Soil | MLWRYEQYFYPGNGWASGFMTRQGSTGLIQVEIKN* |
Ga0137404_102728813 | 3300012929 | Vadose Zone Soil | WKKPSGAKLEMLWRYEQYFYPDNGWVGGFMTDGSSTGLVQLDIHP* |
Ga0137407_119357061 | 3300012930 | Vadose Zone Soil | MLWRYEQYFYPEDRWTEAFMTRPGSTGLIRINISNTPR* |
Ga0162652_1000104493 | 3300012941 | Soil | LEMLWRYEQYLYPGNGWASGFMTRQGSTGLIQVEIKN* |
Ga0126375_111049911 | 3300012948 | Tropical Forest Soil | LWRYEQFFYPGNGWASEFMTREGSTGLVRVDIKQ* |
Ga0126375_117671662 | 3300012948 | Tropical Forest Soil | SGATLEMLWRYEQHFNQSNGWGSGFMTREGATGLIRIDIQL* |
Ga0164303_113985772 | 3300012957 | Soil | TYQKILWKKSSGASLQMLWRYDQFFYPGNGWTSSVMTREGSTGLIRVDMKE* |
Ga0164301_108082532 | 3300012960 | Soil | RWKKSSGATLEMLWRYEQYFYPGNGWASGFMTREGSTGLIQVEIKN* |
Ga0164302_107164251 | 3300012961 | Soil | RWKKSSGATLEMLWRYEQYFYPGNGWASGFMTREGSTGLMQVEIKN* |
Ga0126369_116877472 | 3300012971 | Tropical Forest Soil | RWKKSSGQTLKMLWRYEQFFYRGKGWAGGTMTRENSSGLVLLQIKE* |
Ga0134087_102160902 | 3300012977 | Grasslands Soil | GATLDMIWRYEQFFYGQQLIPGNGWGSGFMTREGSTGLIQVTIKE* |
Ga0164308_108237832 | 3300012985 | Soil | YYRVRWKKSSGATLEMLWRYEQYFYPGNGWASGFMTREGSTGLIQVEITN* |
Ga0164307_118435752 | 3300012987 | Soil | HLYYRVRWKKSAGTSLEMLWQYEQYFYPSNGWASGFMTRQGFTGLIQIEIKN* |
Ga0157374_123968102 | 3300013296 | Miscanthus Rhizosphere | PSPSLKRHPFQEIRWKKSTGPNLKMFWRYEQFFYTGSVWASGSMTREGSTGLIRIEIGP* |
Ga0134079_100168821 | 3300014166 | Grasslands Soil | KTTGAKLDMIWRYEQFFYGQQLIPDNGWGSGFMTHEGSTGLIQLDISP* |
Ga0134079_102019312 | 3300014166 | Grasslands Soil | YYQLRWKKSSGATLEMLWCYEQYLYPGNGWGSGFMTREGFTGLIQLDIRP* |
Ga0163163_109489821 | 3300014325 | Switchgrass Rhizosphere | GAKLHMLWRYEQFFYPGNGWTSGLITREGSTGLILVDIKD* |
Ga0173483_106988672 | 3300015077 | Soil | AKLEMLWRYQQYFYPDNGWASGFMTYNGSTGLIQLDISP* |
Ga0134072_103286051 | 3300015357 | Grasslands Soil | RHIYYQLRWKKSSGPELEMLWRYEQYFYPGNGWASGFMTREGSTGLIRVEIQP* |
Ga0132258_114089861 | 3300015371 | Arabidopsis Rhizosphere | DGGRLEMLWRYEQYFYENWGSGFMTRGGTTGLIRVDIRP* |
Ga0132256_1037645422 | 3300015372 | Arabidopsis Rhizosphere | HIYQEIRWKKSSGARLQMLWRYEQFFYPGNGWTSGFMTREGSTGLIRVDIKE* |
Ga0132257_1032261652 | 3300015373 | Arabidopsis Rhizosphere | HLYYRLLWKKSAGAKLEMLWRYEQYFYPANGWASGFMTRAGSTGLIQVAVKE* |
Ga0132255_1048865002 | 3300015374 | Arabidopsis Rhizosphere | MTGQKRHIYYEIMWKKSSGANLQMVWRYEQFFYPGNGWASGFMTRQGSTGLVRVEIK* |
Ga0182033_109537952 | 3300016319 | Soil | TYYEILWKKSSGANLRMLWRYQQFFPGNGWAGGLMTREGSTGLIRVEVKQ |
Ga0182032_114717862 | 3300016357 | Soil | YEILWKKSSGANLQMLWGYEQFFYPGNGWAGGFMTREGSTGLIRVEIKE |
Ga0182040_102166341 | 3300016387 | Soil | ILWKKSSGANLQMLWGYEQFFYPGNGWAGGFMTREGSTGLIRVEIKE |
Ga0134069_11309422 | 3300017654 | Grasslands Soil | SGAKLEMLWRYEQYFYPGNGWASGFMTHEGSTGLIQLDIRP |
Ga0134069_13431482 | 3300017654 | Grasslands Soil | WKKSSGANLQMLWRYEQFLYSGNGWAGEFMTREGSTGLIRAEIKE |
Ga0134074_13634172 | 3300017657 | Grasslands Soil | YYQLRWKKASGETLEMLWRYEQYFYPGNGWGSGFMTREGSTGLIRVDLHL |
Ga0163161_116061422 | 3300017792 | Switchgrass Rhizosphere | YQEIRWKKSSGAKLQMLWRYEQYFYPANGWGNGFMTKEGSTGLVEVDIRP |
Ga0184610_10365493 | 3300017997 | Groundwater Sediment | YYGLHWKKPSGATLEMLWRYEQYFYPANSWGSGFMTREGSTGLVEVDIRP |
Ga0184604_101769962 | 3300018000 | Groundwater Sediment | VWEKPDGGRLEMVWRYEQYFYENWASGFMTRAGTTGLIRVDIRP |
Ga0184620_100812372 | 3300018051 | Groundwater Sediment | KLEMLWRYEQYFYPANGWGSGFMTKEGSTGLVEVQIRP |
Ga0184619_102091922 | 3300018061 | Groundwater Sediment | HRYYQLIWNKPSGAKLEMLWRYEQYFYPSDGWGSGFMTREGSTGLIRVDIHP |
Ga0184618_100493961 | 3300018071 | Groundwater Sediment | RVLWKKPSGANLEMLWRYEQYFYPASGWGSGFMTREDSTGLIRVDIHL |
Ga0184609_100873971 | 3300018076 | Groundwater Sediment | RHVYYGLHWKKPSGATLKMLWRYEQYFYPANGWGSGFMTKEGSTGLVEVDIRP |
Ga0066655_112704032 | 3300018431 | Grasslands Soil | YGEMLEMLCRYEQYFYPGNGWGSGFMTREGSTGLIRVDLHL |
Ga0066667_122120771 | 3300018433 | Grasslands Soil | RMYYQLRWKKPSGATLEMLWSYEQYFYSSWGSGFMTREGSTGLIRVDIQLRKPAAPK |
Ga0190270_120654772 | 3300018469 | Soil | RLEMLWRYEQYFYENWASGFMTRAGTTGLIRVDIRP |
Ga0066669_103813043 | 3300018482 | Grasslands Soil | SGAKLEMLWRYEQYFYPGNGWASGFMTHEGSTGLIRLDIQP |
Ga0193748_10222621 | 3300019865 | Soil | SSGANLEMLWRYEQFLYPGNGWASGFMTRQGSAGLIRIKLKN |
Ga0193701_10165451 | 3300019875 | Soil | DYRLLWKKPSGAKLEMLWRYEQYFYPANGWASGFMTRTGSTGLIQVAIKE |
Ga0193725_10253833 | 3300019883 | Soil | MLWRYEQYFYPVNGWASGFMTHEGSTGLIQLDISP |
Ga0193725_11259541 | 3300019883 | Soil | MLWLYEQYFYPANGWASGFMTRAGSTGLIQVAIKE |
Ga0193727_10446513 | 3300019886 | Soil | YELRWKKPSGATLEMLWRYEQYFYPANGWGSGFMTREGSTGLVEVDIRP |
Ga0193711_10457882 | 3300019997 | Soil | SSGANLEMLWRYEQFFYPGNGWASGFMTRQGSTGLIRIEMKD |
Ga0193731_11605142 | 3300020001 | Soil | KLEMLWRYEQYFYPGDGWASGFMTREGSTGLIRVDIRP |
Ga0193755_11633673 | 3300020004 | Soil | QNGAKLEMLWRYEQYYYAGDRWASGLMTREGSTGLIRVDIQK |
Ga0193734_10343662 | 3300020015 | Soil | GANLEMLWRYEQFLYPGNGWASGFMTRQGSTGLIRIEMKD |
Ga0193721_10074381 | 3300020018 | Soil | ELHWKKPSGARLEMLWRYEQYFYPANGWGNGFMTKEESTGLVEVDIRP |
Ga0193733_11268532 | 3300020022 | Soil | MLWRYEQYFYSDNGWAGGFMTREGSTGLIKLDIRP |
Ga0179594_100267573 | 3300020170 | Vadose Zone Soil | KKPSGAKLEMLWRYEQYFYPDRGWASGFMTYKGSTGLIQLDIQP |
Ga0210403_114631601 | 3300020580 | Soil | WRYEQYFYPGNGWASGFMTREGSTGLIGVDISLGR |
Ga0210382_101018663 | 3300021080 | Groundwater Sediment | GAKLEMLWRYEQYFYPANGWGSGFMTKEGSTGLVEVQIRP |
Ga0210406_102656043 | 3300021168 | Soil | YYRLLWNKPSGAKLEMLWRYEQYFYPGNGWASGFMTREGSTGLIGVDISLGR |
Ga0193719_101654272 | 3300021344 | Soil | LEILWRYEQYFYPANGWASGFMTNAGSTGLIQVAIKE |
Ga0126371_102709731 | 3300021560 | Tropical Forest Soil | HTYYEILWKKSSGANLKMVWRYEQFFYPGNGWASGFMTHEGSTGLIRVEIKE |
Ga0126371_106751552 | 3300021560 | Tropical Forest Soil | MLWRYEQFFYRGKGWGSGFVTREGAAGLNQVEIKK |
Ga0222622_100619314 | 3300022756 | Groundwater Sediment | SGANLEMLWRYEQYFYPANGWGSGFMTREGSTGLIRVDIRR |
Ga0222622_113472612 | 3300022756 | Groundwater Sediment | KPSGARLEMLWRYEQYFYPANGWGNGFMTKEESTGLVEVDIRP |
Ga0193714_10563752 | 3300023058 | Soil | WKKSSGANLQMLWRYEQFFYPGNGWTSGFMTREGSTGLIRVDIKE |
Ga0247691_10711431 | 3300024222 | Soil | SAATLEMLWRYEQYFYPGNGWASGFMTRQGSTGLIRVDIKE |
Ga0207680_113594421 | 3300025903 | Switchgrass Rhizosphere | WEKPGGGRLDMLWRYEQYFYENWASGFMTRAGTTGLIRVDIRP |
Ga0207685_103202272 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MLWRYEQYFYPGNGWGSGFMTREGFTGLIQLDIRP |
Ga0207699_110586921 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | YRVQWKKSSGATLEMLWRYEQYFYPGNGWASGFMTRQGSTGLIQVEIKN |
Ga0207645_103459841 | 3300025907 | Miscanthus Rhizosphere | KRHTYQEIRWKKSSGANLKMLWRYDQFFYAGNGWASGSMTREGSTGLIRIEIEL |
Ga0207663_101300451 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | RVRWKKSSGATLEMLWRYEQYFYPGNGWASGFMTRQGSTGLIEVEIKN |
Ga0207646_108651021 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LWRYEQYFYPEDRWTEAFMTRPGSTGLIRIDISDASR |
Ga0207700_101151074 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | RYEQFFYGQQLIPGNGWGNGFMTREGSTGLIQVAIKQ |
Ga0207700_116262292 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | SSGANLEMLWRYEQYFYPGNGWASGFMTHQGSTGLIRVDIKE |
Ga0207664_102346311 | 3300025929 | Agricultural Soil | QNGAKLEMLWRYEQYFYSGDGWANGFMTREGSTGLIRVDIRL |
Ga0207701_116443621 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MLWRYEQYFYPANGWASGFMTRAGSTGLIQVAVKE |
Ga0207644_101358221 | 3300025931 | Switchgrass Rhizosphere | WKKSSGAKLQMLWRYEQFFYPGNGWTSGFMTREGSTGLIRVKVEE |
Ga0207690_117062071 | 3300025932 | Corn Rhizosphere | ATLEMLWRYEQYFYTTNGWGSGFMTKEGSTGLVEVDIRP |
Ga0207670_105773911 | 3300025936 | Switchgrass Rhizosphere | KLHMLWRYEQFFYPGNGWTSGLITREGSTGLILVDIKD |
Ga0207667_117114522 | 3300025949 | Corn Rhizosphere | ARLEMVWRYEQWFYEDWASGFMTTPGTTGLIRVDIRP |
Ga0207668_116299652 | 3300025972 | Switchgrass Rhizosphere | ATLKMLWRYEQYFYPTNGWGSGFMIHEGATGLVEVDIRPHTDK |
Ga0207640_108363261 | 3300025981 | Corn Rhizosphere | TYQKILWKKSSGASLQMLWRYDQFFYPGNGWTSSVMTREGSTGLIRVDIKE |
Ga0207658_108077001 | 3300025986 | Switchgrass Rhizosphere | QEIRWQKSSGAKLQMVWRYDQFFYPRNGWTSRFMTREGSTGLIRIDIKE |
Ga0207703_113219312 | 3300026035 | Switchgrass Rhizosphere | VYYQLHWKKPSGARLEMLWRYEQYFYPANGWGNGFMTKEGSTGLVEVDIRP |
Ga0207648_111036651 | 3300026089 | Miscanthus Rhizosphere | HLYYRLIWEKSGGARLEMVWRYEQYFYEDWASGFMTRAGTTGLIHVDIRP |
Ga0209055_10617291 | 3300026309 | Soil | GPKLEMLWRYEQYFYPGNGWASGFMTREGSTGLIRVEIQP |
Ga0209055_12314051 | 3300026309 | Soil | WKKRNSAKLDMIWRYEQYFYSTYGWASGFMTREGSTGLIRVDISNGGR |
Ga0209155_11199463 | 3300026316 | Soil | LYYQLTWKKQNGAKLDMLWRYEQYFYSTDGWASGFMTHEGSTGLIRVGISNGAR |
Ga0209801_10742701 | 3300026326 | Soil | LRWKKSSGATLEMLWRYEQYFYPRNGWGSGFMTREGSTGLIRLDIRP |
Ga0209801_13155682 | 3300026326 | Soil | MLWRYEQYFYPELGWGSGFMTREGSTGLIGVDISLGR |
Ga0209375_11092441 | 3300026329 | Soil | EMLWRYEQYFYPGNGWASGFMTHEGSTGLIRLDIQP |
Ga0209267_10341944 | 3300026331 | Soil | WKKSSGPKLEMLWRYEQYFYPGNGWASGFMTREGSTGLIRVEIQP |
Ga0209057_10790821 | 3300026342 | Soil | KPSGATLEMLWRYEQPFYDRWGSGFMTREGSTGLVRIDIRP |
Ga0257156_11267221 | 3300026498 | Soil | AKLEILWRYEQYFYSGGGWASGFMTHEGSTGLIRVDIRP |
Ga0209157_10579945 | 3300026537 | Soil | RLTWKKRNGAKLDMLWRYEQYFYSADGWASGFMMREGSTGLIRVDIPNGAR |
Ga0209157_11917592 | 3300026537 | Soil | WKRHMYYQLLWKKPSGATLEMLWRYEQPFYDRWGSGFMTREGSTGLVRIDIRP |
Ga0209376_14064591 | 3300026540 | Soil | EMLWRYEQYFYPEDRWTEAFMTRPGSTGLIRIDISNASR |
Ga0209805_11141151 | 3300026542 | Soil | MVWRYEQYFYPGDGWGSGFMTREGSTGLIQVDIHP |
Ga0209805_13605731 | 3300026542 | Soil | EMLWRYEQYFYPQDRWTEAFMTRPGSTGLIRIDISNAAR |
Ga0209156_101654011 | 3300026547 | Soil | IYYQLRWKKSSGATLEMLWRYEQYFYPRNGWGSGFMTREGSTGLIRLDIRP |
Ga0209156_103088551 | 3300026547 | Soil | EMLWRYEQYFYPGNGWASGFMTHEGSTGLIQLDIRP |
Ga0209161_101393173 | 3300026548 | Soil | LVWQKQNGSRLKMVWRYEQYFYDSWASGFMVRDGITGLIRAEIRP |
Ga0209474_103286732 | 3300026550 | Soil | LDMIWRYEQFFYGQQLIPGNGWGSGFMTREGSTGLIQVTIKE |
Ga0209577_103549262 | 3300026552 | Soil | GAKLEMLWRYEQYFYPELGWGSGFMTREGSTGLIGVDISLGR |
Ga0208475_10041823 | 3300027018 | Soil | AKLEMLWRYEQYFYPGNGWASGFMTHEGSTGLIQLDISP |
Ga0208475_10138461 | 3300027018 | Soil | YYRLLWKKPAGAKLEMLWRYEQYFYPGNGWASGFMTREGSTGLIQVVIKE |
Ga0208475_10191891 | 3300027018 | Soil | WKKPSGAKLEMLWRYEQYFYPGSGWASGFMTYKGSTGLIQLNISP |
Ga0209995_10860652 | 3300027471 | Arabidopsis Thaliana Rhizosphere | YYRLVWERPDGGRLEMLWRYEQYFYENWASGFMTRAGTTGLIRVDIRP |
Ga0209003_10148771 | 3300027576 | Forest Soil | EMLWRYEQFFYPRNGWVGGTMTRESSTGLVLVKIKQ |
Ga0209689_12755192 | 3300027748 | Soil | EMLWRYEQFFYPGNGWGSGFMTRESSTGLVRIDINQ |
Ga0209180_101010552 | 3300027846 | Vadose Zone Soil | WRYEQYFYPEDRWTEAFMTRPGSTGLIRINISISN |
Ga0137415_101303641 | 3300028536 | Vadose Zone Soil | KKPSGAKLEMLWRYEQYFYPGTGWASGFTTYKGSTGLIQLDINH |
Ga0307280_102542182 | 3300028768 | Soil | KRHIYYEIRWKKSSGANLEMLWRYEQFLYPGNGWASGFMTRHGSTGLIRIEMKD |
Ga0307282_102121081 | 3300028784 | Soil | KLEMLWRYEQYFYPANGWASGFMTRTGSTGLIQVAIKE |
Ga0307299_100077484 | 3300028793 | Soil | SGAKLEMLWRYEQYFYPANGWASGFMTRTGSTGLIQVAIKE |
Ga0307305_102681131 | 3300028807 | Soil | RVLWKKPSGVKLEILWRYEQYFYPDNGWVGGFMTNGSSTGLVQLDIHP |
Ga0307312_103382932 | 3300028828 | Soil | RYEQFFYGQQLIPGNGWASGFMTHEGSTGLIQLDISP |
Ga0307289_101056483 | 3300028875 | Soil | KKSSGATLEMLWRYEQYFYPGNGWASGFMTREGSTGLILVEIRN |
Ga0307278_104914051 | 3300028878 | Soil | KRHMYYQLLWKKPSGATLEMLWRYEQPFYESWGSGFMIREDSTGLIRVDIQP |
Ga0307308_100328054 | 3300028884 | Soil | MEMLWRYEQYFYPGNGWASGFMIREGSTGLIQLDIRP |
Ga0307308_100901833 | 3300028884 | Soil | YYRVLWKKPSGVKLEILWRYEQYFYPDNGWVGGFMANRSSTGLLQVDIHP |
Ga0075386_121014051 | 3300030916 | Soil | EMLWRYEQFFYPGNGWGSGFMTREGFTGLIRIEIKN |
Ga0170824_1049838612 | 3300031231 | Forest Soil | YRVHWKKSSGANLEMLWRYEQYFYPGNGWASGFVTHQGFTGLIQVEIKN |
Ga0170824_1098949611 | 3300031231 | Forest Soil | KPSGANLEMLWRYEQYFYPGNGWASGFMTRERSTGLTQVAIKQ |
Ga0170824_1195529251 | 3300031231 | Forest Soil | GAKLEMLWRYEQYFYSGDGWASGFMTREGSTGLIRVDIRP |
Ga0310813_121498601 | 3300031716 | Soil | STLKMVWRYEQYFYSPAWTSGFMTREGSTGLIDVQVSD |
Ga0307469_101139643 | 3300031720 | Hardwood Forest Soil | KSSGANLEMLWRYEQYFYPGNGWASGFMTRQGSTGLIRVEIKN |
Ga0318547_110423011 | 3300031781 | Soil | MTGQSPSWKRHTYYEILWKKSAGANLRMLWGDEQFFYPGNDWAGGLMTRKARRG |
Ga0307473_106905172 | 3300031820 | Hardwood Forest Soil | KKPSGAKLEMLWRYEQYFYPDNGWVGGLMANRSSTGLLHVDIHP |
Ga0310899_103532772 | 3300032017 | Soil | QEIRWKKSSGANLKMLWRYEQFFYAGNGWASGSMTQEGSTGLIRIEIEL |
Ga0307470_119037811 | 3300032174 | Hardwood Forest Soil | LYYRVRWKKSSGATLEMLWRYEQYFYPGNGWASGFMTRQGSTGLIEVEIKN |
Ga0307471_1017407122 | 3300032180 | Hardwood Forest Soil | LYYRVRWKKSSGATLEMLWRYEQYFYPGNGWANGFMTRQGATGLIRVEIKN |
Ga0306920_1007337743 | 3300032261 | Soil | IYYEILWKKSSGANLRMLWRYEQFFYPGNGWASGFMTREGSTGLIRVEIKQ |
Ga0310810_102414843 | 3300033412 | Soil | RHTYQKILWKKSSGASLQMLWRYDQFFYPGNGWTSSVMTREGSTGLIRVDIKE |
Ga0310810_113293102 | 3300033412 | Soil | KSSGSTLEMLWRYEQYFYPASGWGNTFMTREGSTGLIKIDIRL |
⦗Top⦘ |