Basic Information | |
---|---|
Family ID | F010331 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 305 |
Average Sequence Length | 47 residues |
Representative Sequence | GQKLYDGYHGVMLGVKSTTWAVSKKVGGWQTLAYTPMETNYEYVS |
Number of Associated Samples | 207 |
Number of Associated Scaffolds | 304 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.77 % |
% of genes near scaffold ends (potentially truncated) | 87.54 % |
% of genes from short scaffolds (< 2000 bps) | 82.30 % |
Associated GOLD sequencing projects | 194 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.19 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (86.885 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (12.131 % of family members) |
Environment Ontology (ENVO) | Unclassified (23.607 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (39.344 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.62% β-sheet: 0.00% Coil/Unstructured: 64.38% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.19 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 304 Family Scaffolds |
---|---|---|
PF01717 | Meth_synt_2 | 22.04 |
PF00496 | SBP_bac_5 | 20.07 |
PF00528 | BPD_transp_1 | 12.50 |
PF05977 | MFS_3 | 4.61 |
PF12973 | Cupin_7 | 3.95 |
PF07690 | MFS_1 | 1.32 |
PF03401 | TctC | 0.66 |
PF08450 | SGL | 0.66 |
PF07719 | TPR_2 | 0.66 |
PF00245 | Alk_phosphatase | 0.66 |
PF13231 | PMT_2 | 0.66 |
PF00005 | ABC_tran | 0.33 |
PF00355 | Rieske | 0.33 |
PF03372 | Exo_endo_phos | 0.33 |
PF04909 | Amidohydro_2 | 0.33 |
PF00158 | Sigma54_activat | 0.33 |
PF00691 | OmpA | 0.33 |
PF08352 | oligo_HPY | 0.33 |
PF00462 | Glutaredoxin | 0.33 |
PF00551 | Formyl_trans_N | 0.33 |
PF13374 | TPR_10 | 0.33 |
PF00361 | Proton_antipo_M | 0.33 |
PF02894 | GFO_IDH_MocA_C | 0.33 |
PF03471 | CorC_HlyC | 0.33 |
PF02129 | Peptidase_S15 | 0.33 |
PF02371 | Transposase_20 | 0.33 |
PF01402 | RHH_1 | 0.33 |
PF07940 | Hepar_II_III | 0.33 |
PF00892 | EamA | 0.33 |
PF00903 | Glyoxalase | 0.33 |
PF00107 | ADH_zinc_N | 0.33 |
PF13379 | NMT1_2 | 0.33 |
PF13847 | Methyltransf_31 | 0.33 |
PF05193 | Peptidase_M16_C | 0.33 |
PF13191 | AAA_16 | 0.33 |
COG ID | Name | Functional Category | % Frequency in 304 Family Scaffolds |
---|---|---|---|
COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 22.04 |
COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 4.61 |
COG1785 | Alkaline phosphatase | Inorganic ion transport and metabolism [P] | 0.66 |
COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.66 |
COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.66 |
COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.66 |
COG0673 | Predicted dehydrogenase | General function prediction only [R] | 0.33 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.33 |
COG5360 | Uncharacterized conserved protein, heparinase superfamily | General function prediction only [R] | 0.33 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 87.21 % |
Unclassified | root | N/A | 12.79 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300004268|Ga0066398_10066888 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 767 | Open in IMG/M |
3300004479|Ga0062595_100083945 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1624 | Open in IMG/M |
3300005174|Ga0066680_10929278 | Not Available | 514 | Open in IMG/M |
3300005180|Ga0066685_10085978 | All Organisms → cellular organisms → Bacteria | 2082 | Open in IMG/M |
3300005180|Ga0066685_10934402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 577 | Open in IMG/M |
3300005186|Ga0066676_10750149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 664 | Open in IMG/M |
3300005187|Ga0066675_11016657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 622 | Open in IMG/M |
3300005294|Ga0065705_10983910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 551 | Open in IMG/M |
3300005332|Ga0066388_100110923 | All Organisms → cellular organisms → Bacteria | 3238 | Open in IMG/M |
3300005332|Ga0066388_100312761 | All Organisms → cellular organisms → Bacteria | 2216 | Open in IMG/M |
3300005332|Ga0066388_101895269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_4_65_12 | 1064 | Open in IMG/M |
3300005332|Ga0066388_103297571 | Not Available | 825 | Open in IMG/M |
3300005332|Ga0066388_107237454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 558 | Open in IMG/M |
3300005332|Ga0066388_108427249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 514 | Open in IMG/M |
3300005345|Ga0070692_10031614 | All Organisms → cellular organisms → Bacteria | 2654 | Open in IMG/M |
3300005366|Ga0070659_101620489 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300005440|Ga0070705_100007025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5535 | Open in IMG/M |
3300005440|Ga0070705_100440793 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 975 | Open in IMG/M |
3300005445|Ga0070708_100221221 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1775 | Open in IMG/M |
3300005445|Ga0070708_101126662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum | 735 | Open in IMG/M |
3300005446|Ga0066686_10523222 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 807 | Open in IMG/M |
3300005467|Ga0070706_100051095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3814 | Open in IMG/M |
3300005467|Ga0070706_102065720 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 515 | Open in IMG/M |
3300005468|Ga0070707_101914965 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 560 | Open in IMG/M |
3300005536|Ga0070697_100402334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1188 | Open in IMG/M |
3300005536|Ga0070697_101444546 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 614 | Open in IMG/M |
3300005549|Ga0070704_100780483 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
3300005553|Ga0066695_10201696 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1248 | Open in IMG/M |
3300005555|Ga0066692_10090618 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1795 | Open in IMG/M |
3300005555|Ga0066692_10138374 | All Organisms → cellular organisms → Bacteria | 1486 | Open in IMG/M |
3300005555|Ga0066692_10378075 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 898 | Open in IMG/M |
3300005559|Ga0066700_10593650 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
3300005561|Ga0066699_10680322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 735 | Open in IMG/M |
3300005569|Ga0066705_10572166 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
3300005598|Ga0066706_10507316 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 960 | Open in IMG/M |
3300005713|Ga0066905_100777313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_4_65_12 | 829 | Open in IMG/M |
3300005713|Ga0066905_101053505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 720 | Open in IMG/M |
3300005713|Ga0066905_101105039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 704 | Open in IMG/M |
3300005764|Ga0066903_100235882 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2798 | Open in IMG/M |
3300005764|Ga0066903_100261012 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2688 | Open in IMG/M |
3300005764|Ga0066903_100332727 | Not Available | 2437 | Open in IMG/M |
3300005764|Ga0066903_101168097 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1426 | Open in IMG/M |
3300005764|Ga0066903_102244502 | Not Available | 1053 | Open in IMG/M |
3300005764|Ga0066903_105750289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 652 | Open in IMG/M |
3300005764|Ga0066903_107160505 | Not Available | 578 | Open in IMG/M |
3300005843|Ga0068860_102732516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 512 | Open in IMG/M |
3300006034|Ga0066656_11093016 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 512 | Open in IMG/M |
3300006196|Ga0075422_10367189 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 630 | Open in IMG/M |
3300006573|Ga0074055_11575708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1013 | Open in IMG/M |
3300006796|Ga0066665_11602658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 512 | Open in IMG/M |
3300006797|Ga0066659_10192133 | All Organisms → cellular organisms → Bacteria | 1487 | Open in IMG/M |
3300006797|Ga0066659_10261947 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1300 | Open in IMG/M |
3300006845|Ga0075421_101197019 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 847 | Open in IMG/M |
3300006853|Ga0075420_100928934 | Not Available | 749 | Open in IMG/M |
3300006871|Ga0075434_100408491 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1379 | Open in IMG/M |
3300006871|Ga0075434_101192457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_4_65_12 | 773 | Open in IMG/M |
3300006871|Ga0075434_101809163 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 617 | Open in IMG/M |
3300006871|Ga0075434_102648271 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 502 | Open in IMG/M |
3300006880|Ga0075429_101549386 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 576 | Open in IMG/M |
3300006903|Ga0075426_10197431 | All Organisms → cellular organisms → Bacteria | 1458 | Open in IMG/M |
3300006904|Ga0075424_101050652 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
3300006904|Ga0075424_101127991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_4_65_12 | 835 | Open in IMG/M |
3300007076|Ga0075435_100088735 | All Organisms → cellular organisms → Bacteria | 2549 | Open in IMG/M |
3300007076|Ga0075435_101780276 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 541 | Open in IMG/M |
3300007255|Ga0099791_10018951 | All Organisms → cellular organisms → Bacteria | 2945 | Open in IMG/M |
3300009012|Ga0066710_100044552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Immundisolibacterales → Immundisolibacteraceae → Immundisolibacter → Immundisolibacter cernigliae | 5403 | Open in IMG/M |
3300009012|Ga0066710_102787239 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 692 | Open in IMG/M |
3300009089|Ga0099828_10606429 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 985 | Open in IMG/M |
3300009089|Ga0099828_10656980 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
3300009089|Ga0099828_11625325 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 569 | Open in IMG/M |
3300009090|Ga0099827_10399449 | All Organisms → cellular organisms → Bacteria | 1175 | Open in IMG/M |
3300009093|Ga0105240_12289206 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 560 | Open in IMG/M |
3300009100|Ga0075418_10826997 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1000 | Open in IMG/M |
3300009137|Ga0066709_100204809 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2596 | Open in IMG/M |
3300009137|Ga0066709_103565801 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 565 | Open in IMG/M |
3300009143|Ga0099792_10699251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 656 | Open in IMG/M |
3300009147|Ga0114129_11816754 | Not Available | 741 | Open in IMG/M |
3300009162|Ga0075423_10182752 | All Organisms → cellular organisms → Bacteria | 2201 | Open in IMG/M |
3300009162|Ga0075423_10250854 | All Organisms → cellular organisms → Bacteria | 1854 | Open in IMG/M |
3300009162|Ga0075423_12140997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 607 | Open in IMG/M |
3300009177|Ga0105248_12807128 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 556 | Open in IMG/M |
3300009538|Ga0129287_10026864 | All Organisms → cellular organisms → Bacteria | 2502 | Open in IMG/M |
3300009538|Ga0129287_10215218 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 833 | Open in IMG/M |
3300009553|Ga0105249_13272877 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 521 | Open in IMG/M |
3300009792|Ga0126374_11495417 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Poribacteria → unclassified Candidatus Poribacteria → Candidatus Poribacteria bacterium | 554 | Open in IMG/M |
3300009795|Ga0105059_1021762 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 710 | Open in IMG/M |
3300009809|Ga0105089_1019350 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 910 | Open in IMG/M |
3300009810|Ga0105088_1021034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_4_65_12 | 1021 | Open in IMG/M |
3300009814|Ga0105082_1016870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_4_65_12 | 1082 | Open in IMG/M |
3300009814|Ga0105082_1034038 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 820 | Open in IMG/M |
3300009818|Ga0105072_1018970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1248 | Open in IMG/M |
3300009821|Ga0105064_1037616 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
3300009822|Ga0105066_1020638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1298 | Open in IMG/M |
3300010043|Ga0126380_11776426 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 557 | Open in IMG/M |
3300010043|Ga0126380_12252314 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 505 | Open in IMG/M |
3300010046|Ga0126384_11419343 | Not Available | 648 | Open in IMG/M |
3300010046|Ga0126384_11649039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 605 | Open in IMG/M |
3300010047|Ga0126382_10078830 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2051 | Open in IMG/M |
3300010047|Ga0126382_11133014 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 696 | Open in IMG/M |
3300010154|Ga0127503_10083257 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 520 | Open in IMG/M |
3300010301|Ga0134070_10111809 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 958 | Open in IMG/M |
3300010303|Ga0134082_10111697 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1087 | Open in IMG/M |
3300010320|Ga0134109_10147430 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 846 | Open in IMG/M |
3300010322|Ga0134084_10040076 | All Organisms → cellular organisms → Bacteria | 1345 | Open in IMG/M |
3300010358|Ga0126370_10608960 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
3300010358|Ga0126370_12039100 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 562 | Open in IMG/M |
3300010359|Ga0126376_10925060 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 865 | Open in IMG/M |
3300010360|Ga0126372_10526761 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
3300010360|Ga0126372_12617240 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 556 | Open in IMG/M |
3300010362|Ga0126377_11177120 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 837 | Open in IMG/M |
3300010362|Ga0126377_12596989 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 582 | Open in IMG/M |
3300010362|Ga0126377_13069950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 539 | Open in IMG/M |
3300010362|Ga0126377_13072437 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 539 | Open in IMG/M |
3300010366|Ga0126379_11080199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 908 | Open in IMG/M |
3300010366|Ga0126379_11142644 | Not Available | 885 | Open in IMG/M |
3300010376|Ga0126381_103809562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 589 | Open in IMG/M |
3300010398|Ga0126383_10661597 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1120 | Open in IMG/M |
3300010398|Ga0126383_10752591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_4_65_12 | 1055 | Open in IMG/M |
3300010398|Ga0126383_12360827 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300010398|Ga0126383_13027433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 549 | Open in IMG/M |
3300010398|Ga0126383_13395320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 520 | Open in IMG/M |
3300010399|Ga0134127_10071786 | All Organisms → cellular organisms → Bacteria | 2941 | Open in IMG/M |
3300010399|Ga0134127_10380272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1389 | Open in IMG/M |
3300010399|Ga0134127_11155897 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 840 | Open in IMG/M |
3300010399|Ga0134127_11934205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 667 | Open in IMG/M |
3300011269|Ga0137392_10181107 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1716 | Open in IMG/M |
3300011269|Ga0137392_11223672 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 609 | Open in IMG/M |
3300012081|Ga0154003_1053884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 689 | Open in IMG/M |
3300012096|Ga0137389_10575325 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
3300012189|Ga0137388_11387120 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300012189|Ga0137388_11387120 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300012198|Ga0137364_10778751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 722 | Open in IMG/M |
3300012198|Ga0137364_11139096 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 586 | Open in IMG/M |
3300012199|Ga0137383_10850926 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 666 | Open in IMG/M |
3300012204|Ga0137374_10126346 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2339 | Open in IMG/M |
3300012208|Ga0137376_10536032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_4_65_12 | 1015 | Open in IMG/M |
3300012208|Ga0137376_11404782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 589 | Open in IMG/M |
3300012209|Ga0137379_10305457 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1502 | Open in IMG/M |
3300012355|Ga0137369_10224457 | All Organisms → cellular organisms → Bacteria | 1437 | Open in IMG/M |
3300012358|Ga0137368_10192497 | All Organisms → cellular organisms → Bacteria | 1459 | Open in IMG/M |
3300012500|Ga0157314_1062770 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 502 | Open in IMG/M |
3300012532|Ga0137373_10947685 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
3300012685|Ga0137397_10534250 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 873 | Open in IMG/M |
3300012918|Ga0137396_10467777 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 935 | Open in IMG/M |
3300012925|Ga0137419_10590524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 891 | Open in IMG/M |
3300012925|Ga0137419_11277798 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 616 | Open in IMG/M |
3300012927|Ga0137416_10744015 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 864 | Open in IMG/M |
3300012930|Ga0137407_11949853 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 560 | Open in IMG/M |
3300012931|Ga0153915_11983054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 681 | Open in IMG/M |
3300012944|Ga0137410_10204067 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1532 | Open in IMG/M |
3300012944|Ga0137410_11213868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 650 | Open in IMG/M |
3300012944|Ga0137410_11544055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 580 | Open in IMG/M |
3300012948|Ga0126375_10454861 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 942 | Open in IMG/M |
3300012971|Ga0126369_10073631 | All Organisms → cellular organisms → Bacteria | 3006 | Open in IMG/M |
3300012971|Ga0126369_10571886 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1197 | Open in IMG/M |
3300012971|Ga0126369_12088613 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
3300012971|Ga0126369_12743112 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300013100|Ga0157373_10591032 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 808 | Open in IMG/M |
3300014324|Ga0075352_1292869 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 516 | Open in IMG/M |
3300014326|Ga0157380_11225009 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 795 | Open in IMG/M |
3300015053|Ga0137405_1071892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1293 | Open in IMG/M |
3300015053|Ga0137405_1132835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1488 | Open in IMG/M |
3300015262|Ga0182007_10402357 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300015358|Ga0134089_10113597 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1047 | Open in IMG/M |
3300015358|Ga0134089_10168991 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 870 | Open in IMG/M |
3300015358|Ga0134089_10574441 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 502 | Open in IMG/M |
3300015371|Ga0132258_10860642 | All Organisms → cellular organisms → Bacteria | 2288 | Open in IMG/M |
3300015374|Ga0132255_103424787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 675 | Open in IMG/M |
3300016270|Ga0182036_11713407 | Not Available | 531 | Open in IMG/M |
3300016387|Ga0182040_10430889 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1041 | Open in IMG/M |
3300016387|Ga0182040_11960487 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 503 | Open in IMG/M |
3300017656|Ga0134112_10280685 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 666 | Open in IMG/M |
3300017656|Ga0134112_10414838 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 558 | Open in IMG/M |
3300017659|Ga0134083_10173895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_4_65_12 | 880 | Open in IMG/M |
3300017792|Ga0163161_11061545 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 694 | Open in IMG/M |
3300018027|Ga0184605_10076849 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1452 | Open in IMG/M |
3300018028|Ga0184608_10173572 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
3300018031|Ga0184634_10042735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1846 | Open in IMG/M |
3300018052|Ga0184638_1164281 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 796 | Open in IMG/M |
3300018053|Ga0184626_10069581 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1483 | Open in IMG/M |
3300018056|Ga0184623_10038212 | All Organisms → cellular organisms → Bacteria | 2176 | Open in IMG/M |
3300018056|Ga0184623_10351554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 660 | Open in IMG/M |
3300018063|Ga0184637_10582500 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
3300018064|Ga0187773_11221023 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 506 | Open in IMG/M |
3300018074|Ga0184640_10449250 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 573 | Open in IMG/M |
3300018075|Ga0184632_10061566 | All Organisms → cellular organisms → Bacteria | 1628 | Open in IMG/M |
3300018075|Ga0184632_10197016 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 887 | Open in IMG/M |
3300018081|Ga0184625_10298463 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 842 | Open in IMG/M |
3300018422|Ga0190265_11823950 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
3300018433|Ga0066667_10147794 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1652 | Open in IMG/M |
3300018433|Ga0066667_10828160 | Not Available | 790 | Open in IMG/M |
3300018468|Ga0066662_10286346 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1374 | Open in IMG/M |
3300018468|Ga0066662_12854986 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 513 | Open in IMG/M |
3300018468|Ga0066662_12932597 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 507 | Open in IMG/M |
3300019458|Ga0187892_10486100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 571 | Open in IMG/M |
3300020063|Ga0180118_1336318 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
3300020170|Ga0179594_10012419 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2411 | Open in IMG/M |
3300020170|Ga0179594_10366053 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 547 | Open in IMG/M |
3300021560|Ga0126371_10575395 | All Organisms → cellular organisms → Bacteria | 1275 | Open in IMG/M |
3300022694|Ga0222623_10074635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1314 | Open in IMG/M |
3300025159|Ga0209619_10429162 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 672 | Open in IMG/M |
3300025311|Ga0209343_10123373 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2105 | Open in IMG/M |
3300025313|Ga0209431_10435850 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1007 | Open in IMG/M |
3300025922|Ga0207646_10849749 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 811 | Open in IMG/M |
3300025922|Ga0207646_11590642 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 564 | Open in IMG/M |
3300025930|Ga0207701_10950823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_4_65_12 | 718 | Open in IMG/M |
3300025935|Ga0207709_11651058 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 532 | Open in IMG/M |
3300025941|Ga0207711_10063461 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3189 | Open in IMG/M |
3300025941|Ga0207711_11859690 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300025961|Ga0207712_10588671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_4_65_12 | 961 | Open in IMG/M |
3300025972|Ga0207668_11585800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 591 | Open in IMG/M |
3300025981|Ga0207640_10553117 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
3300026089|Ga0207648_11237095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 701 | Open in IMG/M |
3300026313|Ga0209761_1047202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 2438 | Open in IMG/M |
3300026326|Ga0209801_1157831 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 951 | Open in IMG/M |
3300026343|Ga0209159_1043335 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2273 | Open in IMG/M |
3300026377|Ga0257171_1047493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 743 | Open in IMG/M |
3300026548|Ga0209161_10000782 | All Organisms → cellular organisms → Bacteria | 26005 | Open in IMG/M |
3300026548|Ga0209161_10205945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_4_65_12 | 1081 | Open in IMG/M |
3300027332|Ga0209861_1015746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1131 | Open in IMG/M |
3300027511|Ga0209843_1092030 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 513 | Open in IMG/M |
3300027654|Ga0209799_1039752 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1048 | Open in IMG/M |
3300027882|Ga0209590_10043598 | All Organisms → cellular organisms → Bacteria | 2458 | Open in IMG/M |
3300027903|Ga0209488_10532058 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 859 | Open in IMG/M |
3300027957|Ga0209857_1084835 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 533 | Open in IMG/M |
3300027961|Ga0209853_1061176 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1018 | Open in IMG/M |
(restricted) 3300027995|Ga0233418_10205597 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 651 | Open in IMG/M |
3300028380|Ga0268265_10625066 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
3300028380|Ga0268265_11943968 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300028587|Ga0247828_10123592 | Not Available | 1261 | Open in IMG/M |
3300028807|Ga0307305_10335774 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 686 | Open in IMG/M |
3300028819|Ga0307296_10179955 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
3300028828|Ga0307312_11156366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 512 | Open in IMG/M |
3300030990|Ga0308178_1125581 | Not Available | 569 | Open in IMG/M |
3300031097|Ga0308188_1032952 | Not Available | 541 | Open in IMG/M |
3300031170|Ga0307498_10190078 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
3300031184|Ga0307499_10034121 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
3300031474|Ga0170818_102847974 | Not Available | 914 | Open in IMG/M |
3300031546|Ga0318538_10116368 | All Organisms → Viruses → Predicted Viral | 1393 | Open in IMG/M |
3300031562|Ga0310886_10200458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_4_65_12 | 1088 | Open in IMG/M |
3300031564|Ga0318573_10034642 | All Organisms → cellular organisms → Bacteria | 2386 | Open in IMG/M |
3300031564|Ga0318573_10452161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_4_65_12 | 691 | Open in IMG/M |
3300031719|Ga0306917_10793269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_4_65_12 | 743 | Open in IMG/M |
3300031720|Ga0307469_10547699 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1024 | Open in IMG/M |
3300031720|Ga0307469_10639217 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 957 | Open in IMG/M |
3300031720|Ga0307469_11022387 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 773 | Open in IMG/M |
3300031720|Ga0307469_11563711 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300031720|Ga0307469_11633140 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 620 | Open in IMG/M |
3300031744|Ga0306918_10089462 | All Organisms → cellular organisms → Bacteria | 2164 | Open in IMG/M |
3300031778|Ga0318498_10040179 | All Organisms → cellular organisms → Bacteria | 2054 | Open in IMG/M |
3300031795|Ga0318557_10512816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 551 | Open in IMG/M |
3300031797|Ga0318550_10098119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1379 | Open in IMG/M |
3300031820|Ga0307473_10027164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2439 | Open in IMG/M |
3300031820|Ga0307473_10206697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1170 | Open in IMG/M |
3300031820|Ga0307473_10731009 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 698 | Open in IMG/M |
3300031820|Ga0307473_10829605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 662 | Open in IMG/M |
3300031820|Ga0307473_11023360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 604 | Open in IMG/M |
3300031858|Ga0310892_11206631 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 539 | Open in IMG/M |
3300031943|Ga0310885_10425300 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 712 | Open in IMG/M |
3300031943|Ga0310885_10902573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 506 | Open in IMG/M |
3300031944|Ga0310884_10553351 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300031949|Ga0214473_11606805 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 651 | Open in IMG/M |
3300032003|Ga0310897_10511510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 584 | Open in IMG/M |
3300032012|Ga0310902_10525688 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 775 | Open in IMG/M |
3300032041|Ga0318549_10487453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 555 | Open in IMG/M |
3300032064|Ga0318510_10183593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_4_65_12 | 839 | Open in IMG/M |
3300032122|Ga0310895_10429853 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 652 | Open in IMG/M |
3300032174|Ga0307470_10887376 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 699 | Open in IMG/M |
3300032180|Ga0307471_101838173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 756 | Open in IMG/M |
3300032180|Ga0307471_103435938 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 561 | Open in IMG/M |
3300032180|Ga0307471_104237798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 506 | Open in IMG/M |
3300032205|Ga0307472_101157098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 736 | Open in IMG/M |
3300032205|Ga0307472_101343812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 690 | Open in IMG/M |
3300032782|Ga0335082_10997014 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
3300032782|Ga0335082_11147165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 644 | Open in IMG/M |
3300032828|Ga0335080_11784177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 601 | Open in IMG/M |
3300033158|Ga0335077_10503802 | All Organisms → cellular organisms → Bacteria | 1280 | Open in IMG/M |
3300033233|Ga0334722_11334684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 501 | Open in IMG/M |
3300033290|Ga0318519_10406252 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 812 | Open in IMG/M |
3300033813|Ga0364928_0181969 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 524 | Open in IMG/M |
3300034155|Ga0370498_173828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 527 | Open in IMG/M |
3300034670|Ga0314795_013093 | Not Available | 1162 | Open in IMG/M |
3300034676|Ga0314801_141113 | Not Available | 576 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.13% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.15% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.85% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.56% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.23% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.57% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.92% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.93% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 3.93% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.61% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.28% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.28% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.95% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.64% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.64% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.31% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.31% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.98% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.98% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.66% |
Beach Aquifer Porewater | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater | 0.66% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.66% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.66% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.33% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.33% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.33% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.33% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.33% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.33% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.33% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.33% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.33% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.33% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.33% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.33% |
Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 0.33% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.33% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.33% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.33% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.33% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.33% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.33% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.33% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.33% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.33% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.33% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.33% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.33% |
Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.33% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009538 | Microbial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - H-2W | Environmental | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300009795 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_40_50 | Environmental | Open in IMG/M |
3300009809 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40 | Environmental | Open in IMG/M |
3300009810 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 | Environmental | Open in IMG/M |
3300009814 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 | Environmental | Open in IMG/M |
3300009818 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 | Environmental | Open in IMG/M |
3300009821 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 | Environmental | Open in IMG/M |
3300009822 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300012081 | Attine ant fungus gardens microbial communities from Florida, USA - TSFL087 MetaG | Host-Associated | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Host-Associated | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300014324 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1 | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
3300020063 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT730_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
3300025159 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 3 | Environmental | Open in IMG/M |
3300025311 | Groundwater microbial communities from Rifle, Colorado - Rifle CSP2_plank lowO2_0.2 (SPAdes) | Environmental | Open in IMG/M |
3300025313 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300027332 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300027511 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 (SPAdes) | Environmental | Open in IMG/M |
3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027957 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 (SPAdes) | Environmental | Open in IMG/M |
3300027961 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300027995 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_1_MG | Environmental | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300030990 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031097 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_183 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
3300033813 | Sediment microbial communities from East River floodplain, Colorado, United States - 30_j17 | Environmental | Open in IMG/M |
3300034155 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_17 | Environmental | Open in IMG/M |
3300034663 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034670 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034676 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPhiseqgaiiFebDRAFT_1007495992 | 3300000364 | Soil | LGTRALTWAXSKKVGXWXTLAYTVAETNYEYITPVG* |
Ga0066398_100668882 | 3300004268 | Tropical Forest Soil | DGYYGVMLGMKSITWATSRKVGGWQTLAYVPMETNYEYVSPAG* |
Ga0062595_1000839451 | 3300004479 | Soil | QALGQKLYDDYRGVMLGVRSLTWAVSKKVNSWQSLVYVPLENNYEYVS* |
Ga0066680_109292781 | 3300005174 | Soil | TKLTHDLGQKLYEQYHGVMLGMRSTTWAVSKKVGSWATLAYVPLENNYEYVTPAGR* |
Ga0066690_103118343 | 3300005177 | Soil | LDPEKRAGLTAALGQMMYEQYHGVMLGMKSTTWAVSKKVGRWPTLVYAPLENNYEYVTRAGV* |
Ga0066685_100859781 | 3300005180 | Soil | GQKLYDNYHGVMIGMKTVTWAVSKKVKAWDTLVYVPLENNYEYVS* |
Ga0066685_109344022 | 3300005180 | Soil | YDAHHGVMLGMKSITWAMSRKIGGWQSLAYVPMETNYEHVSPA* |
Ga0066676_107501492 | 3300005186 | Soil | VAKRANLTSALGQRLYDGYYGVMIGMKSITWAMTKKVGGWQSLAYVPLENNYEYVSPAG* |
Ga0066675_110166571 | 3300005187 | Soil | LGQRLYDGYHGVMLGIKSITWAVNKKVSGWQTLAYTPLETNYEYIS* |
Ga0065705_100531481 | 3300005294 | Switchgrass Rhizosphere | DAEKRATLQQEMGQKLYEQYHGVMLGMKSTTWALSKKVGAWSTLLSVPLENNYEYVTPV* |
Ga0065705_109839102 | 3300005294 | Switchgrass Rhizosphere | QKLYDGYHGVMLGMKSIAWAVSKKVGSWPTLAYVPAETNYELVSPAG* |
Ga0065707_105498182 | 3300005295 | Switchgrass Rhizosphere | LAELDVEKRATLQHEMGQKLYEQYHGVMLGMKSTTWALSKKVGAWSTLLSVPLENNYEYVTPA* |
Ga0066388_1001109234 | 3300005332 | Tropical Forest Soil | DGYHGVMLGTRAITWAVSKKVGAWQTLGYTVAENNYEYISAAG* |
Ga0066388_1003127614 | 3300005332 | Tropical Forest Soil | LGQKLYDQHHGVMLGVKSTTWAVTKKVGSWQTLNYVPMETNYEYVSATGAS* |
Ga0066388_1018952691 | 3300005332 | Tropical Forest Soil | LYDEYRGVMLGTRSLTWAVSKKVSAWQTLVYVPLENNYEYVS* |
Ga0066388_1032975711 | 3300005332 | Tropical Forest Soil | MGQKLYEQYHGVMLGMKSTTWALSKKVGAWSTLLSVPLENNYEYVTPV* |
Ga0066388_1072374542 | 3300005332 | Tropical Forest Soil | NPERRAKLTHDLGQKLYDNYHGVMLGVKTITWATSKKVTAWETLAYTPLETNYEYVS* |
Ga0066388_1084272491 | 3300005332 | Tropical Forest Soil | LGQKLYDGYHGVMLGMKSITWALSRQIGSWQSLAYVPLETNYEYVSPAG* |
Ga0070692_100316143 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | AKLTHDVGQKLYDGYHGVMLGVKSTTWAVSKKVGGWQTLAYTPMETNYEYVS* |
Ga0070659_1016204891 | 3300005366 | Corn Rhizosphere | GQKLYDGYHGVMLGMKSVTWALGKKVNAWSTLAYVPAETNYEHVS* |
Ga0070705_1000070251 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | LYDGYYGVMIGMKSITWAMTKKVGSWQSLAYVPLENNYEYVSPAS* |
Ga0070705_1004407932 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | GQKLYDGYHGVMLGVKSTTWAVSKKVGGWQTLAYTPMETNYEYVS* |
Ga0070700_1014809832 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | DAEKRATLQQEMGQKLYEQYHGVMLGMKSTTWALSKKVGAWSTLLSVPLENNYEYVMPV* |
Ga0070708_1002212211 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | AKMTHALGQKLYDNYHGVMLGMKTVTWAVSKKVSNWQTLVYVPLENNYEYVS* |
Ga0070708_1011266622 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | AKMTQALGQKLYDNYHGVMLGMKTVTWAVSKKVKAWDTLVYVPLENNYEYVS* |
Ga0066686_105232222 | 3300005446 | Soil | LGQKLYDGYYGVMLGMKSITWATTRKVGGWQSLAYVPLENNYEYVSPAG* |
Ga0066687_108872742 | 3300005454 | Soil | TELDPEKRAGLTSALGHMMYEQYHGVMLGMKSTTWAVSKKVGRWPTLVYAPLENNYE* |
Ga0070706_1000510951 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | HALGQKLYDNYHGVMLGMKTVTWAVSKKVKSWDTLVYVPLENNYEYVS* |
Ga0070706_1020657202 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | HALGQKLYDNYHGVMLGMKTVTWAVSKKVSNWQTLVYVPLENNYEYVS* |
Ga0070707_1019149651 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | LNAERRATLTHDLAQKLHDNYHGVMLGVKTITWATSKKVTAWETLAYTPLETNYEYVSSSRC* |
Ga0070697_1004023341 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | LGQKLYDNYHGVMLGMKNVTWAVSKKVKDWQTLAYVPLENNYEYIS* |
Ga0070697_1014445462 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | GQKLYDGYHGVMLGIKSITWAMSRKVGTWQTLAYVPLETNYESVTAAG* |
Ga0070704_1007804831 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | RDIGQKLYDGYHGVMLGTRALTWAVSKKVGSWQTLAYTVAETNYEYISPAG* |
Ga0066695_102016961 | 3300005553 | Soil | MTQALAQKLYDDYRGVMLGTRSVTWAVSKRVTSWQTLVYVPLENNYEYVS* |
Ga0066661_102414081 | 3300005554 | Soil | ILTELDPEKRAGLTSALGQTLYEQYHGVMLGMKSTTWAVSKKVGRWPTLVYAPLENNYEYVTRAGT* |
Ga0066692_100906182 | 3300005555 | Soil | YDDYRGVMLGTRSLTWAVTKKVSGWQTLVYVPLENNYEYVS* |
Ga0066692_101383741 | 3300005555 | Soil | EKRVRMTQTLGQKLYDAHHGIMLGMKSITWALSRKIGGWQSLAYVPMETNYEYVSP* |
Ga0066692_103780751 | 3300005555 | Soil | GMKSITWALSRKVGGWQSLAYVPLENNYEYVSPAS* |
Ga0066698_108123372 | 3300005558 | Soil | LTILTELDAEKRTTLQHEMGQRLYAQYHGVMLGMKATTWALSKKVGAWSTLLSVPLENNYEYVTPV* |
Ga0066700_105936501 | 3300005559 | Soil | LYEQYHGVMLGMKSTTWAVSKKVGRWPTLVYAPLENNYEYVTRAGV* |
Ga0066699_106803222 | 3300005561 | Soil | LGQKLYDGCYGVMLGMKSITWAMTRKVGGWPSLAYVPLENNYEYVSPAS* |
Ga0066705_105721661 | 3300005569 | Soil | YDGHHGVMLGMKSITWAMSRKVGGWPTLAYVAAETNYELVSPSG* |
Ga0066706_105073161 | 3300005598 | Soil | MLGMKSITWAMTRKVGGWQSLAYVPLENNYEYVSPAG* |
Ga0066905_1007773132 | 3300005713 | Tropical Forest Soil | QKLYDNYHGVMLGVKSITWAVTKKVNAWPTLVYVPLENNYEYVS* |
Ga0066905_1010535051 | 3300005713 | Tropical Forest Soil | LTHDLGQKLYDGYHGVMLGTKSITWAISRKVGSWSTLAYVPAETNYEYITPAT* |
Ga0066905_1011050392 | 3300005713 | Tropical Forest Soil | GYYGVMLGMKSITWATSRKVGGWQTLAYVPMETNYEYVSPAG* |
Ga0066903_1002358823 | 3300005764 | Tropical Forest Soil | NYHGVMLGMKNITWAVSKKVKEWQTLVYVPLENNYEYIS* |
Ga0066903_1002610121 | 3300005764 | Tropical Forest Soil | LTHDMGQRLYENYHGVMLGMKNVTWAVTRKVGAWQTLVYVPLENNYEYVSKSDV* |
Ga0066903_1003327271 | 3300005764 | Tropical Forest Soil | QHEMGQKLYEQYHGVMLGMKSTTWALSKKVGAWATLLSVPLENNYEYVTPV* |
Ga0066903_1011680972 | 3300005764 | Tropical Forest Soil | MKSTTWAVSQKVKSWQTLAYMPMETNCEYVSATG* |
Ga0066903_1019336571 | 3300005764 | Tropical Forest Soil | QAILAEIDPEKRAGLTSALGQTLYEQYHGVMLGMKSTTWAVSKKVGTWPTLVYAPLENNYEYVTRAGA* |
Ga0066903_1022445022 | 3300005764 | Tropical Forest Soil | GVMLGMKSTTWAVSKKVGRWPTLVYAPLENNYEYVTRVGA* |
Ga0066903_1057502891 | 3300005764 | Tropical Forest Soil | DLGQKLYDGYHGVMLGTKSITWAVSRKVGAWSTLAYVPAETNYEYVTPTS* |
Ga0066903_1071605051 | 3300005764 | Tropical Forest Soil | TLQHEMGQKLYEQYHGVMLGMKSTTWALSKKVGAWSTLLSVPLENNYEYVTPA* |
Ga0066903_1084186271 | 3300005764 | Tropical Forest Soil | KRATLQHEMGQKLYEQYHGVMLGMKATTWALSKKVGTWSTLLSVPLENNYEYVMPV* |
Ga0068860_1027325162 | 3300005843 | Switchgrass Rhizosphere | LSSALGQKLYDGYYGVMLGMKSITWATSKKVGGWQTLAYVPMETNYEYVSPAG* |
Ga0066656_110930162 | 3300006034 | Soil | RGVMLGTRSVTWAVSKRVTSWQTLVYVPLENNYEYVS* |
Ga0075422_103671892 | 3300006196 | Populus Rhizosphere | LAQRLYDDYRGVMLGMRSLTWAVSKKVNNWPTLVYVPLENNYEYVS* |
Ga0074055_115757081 | 3300006573 | Soil | RAKLTHDVGQKLYDGYHGVMLGMKSTTWAVSKRVGGWQTLAYTPMETNYEYVSSAG* |
Ga0066665_116026582 | 3300006796 | Soil | YHGVMLGMKSITWAVSRKVGSWPTLAYVPAETNYEYVTPGG* |
Ga0066659_101921333 | 3300006797 | Soil | ALGQKLYDAYHGVMLGTKSITWAMTKKVGGWQSLAYVPMETNYEYVSPGS* |
Ga0066659_102619472 | 3300006797 | Soil | DYRGVMLGTRSVTWAVSKRVTSWQTLVYVPLENNYEYVS* |
Ga0075421_1011970191 | 3300006845 | Populus Rhizosphere | TSALGQKLYDGYYGVMLGVKSITWAMTKKVGGWQSLAYVPLENNYEYISPAR* |
Ga0075421_1024051492 | 3300006845 | Populus Rhizosphere | AELDTEKRARLTSALGQQLYEQYSGVMLGMKSTTWALSKKVGSWTTLVYAPLENNYEYITRAGA* |
Ga0075420_1009289341 | 3300006853 | Populus Rhizosphere | GVMLGMKSTTWALSKKVGAWSTLLSVPLENNYEYVTPV* |
Ga0075434_1004084913 | 3300006871 | Populus Rhizosphere | GVMLGMKSITWAVSKKVGSWPTLAYVPAETNYELVSPTG* |
Ga0075434_1011924572 | 3300006871 | Populus Rhizosphere | GVMLGVRSITWAVSKKVNSWQTLVYVPLENNYEYVS* |
Ga0075434_1018091632 | 3300006871 | Populus Rhizosphere | YRGVMLGVRSITWAVSKKVTSWQTLVYVPLENNYEYVS* |
Ga0075434_1026482712 | 3300006871 | Populus Rhizosphere | LYDNYHGIMLGMKSITWALSRRVGGWQSLAYVPLENNYEYISPAS* |
Ga0075429_1015493861 | 3300006880 | Populus Rhizosphere | RDLGQKLYDNYHGVMLGVKTITWATSKKVTAWETLAYTPLETNYEYLS* |
Ga0075426_101974311 | 3300006903 | Populus Rhizosphere | VMLGVKSITWAMTKKVGGWQSLAYVPLENNYEYVSPAS* |
Ga0075424_1010506523 | 3300006904 | Populus Rhizosphere | RDLGQKLYDNYHGVMLGVKSISWAMSKKVTAWQSLAYTPLETNYEYLS* |
Ga0075424_1011279912 | 3300006904 | Populus Rhizosphere | GRLTQALGQKLYDDYRGVMLGVRSITWAVSKKVTSWQSLVYVPLENNYEYVS* |
Ga0075435_1000887354 | 3300007076 | Populus Rhizosphere | YGVMIGMKSITWAMTKKVGGWQSLAYVPLENNYEYVSPAS* |
Ga0075435_1017802761 | 3300007076 | Populus Rhizosphere | ALGQKLYDNYHGVMLGMKNVTWAVSKKVKEWQTLVYVPLENNYEYVS* |
Ga0099791_100189514 | 3300007255 | Vadose Zone Soil | RGQKLYDGHYGVMLGIKSITWALSKKVSAWQTLAYVPMETNYEYVSPAS* |
Ga0066710_1000445526 | 3300009012 | Grasslands Soil | REVDADRRARLTHALGQKLYDGYYGVMLGMKSITWAMTKKVGGWQTLAYVPMETNYEYVSPAS |
Ga0066710_1027872391 | 3300009012 | Grasslands Soil | MTQALGQKLYDEYRGVMLGMRSLTWAVSKKVSGWQTLVYVPLENNYEYVS |
Ga0099828_106064291 | 3300009089 | Vadose Zone Soil | QTLGQKLYDAHHGVMLGMKSITWALSRKIGGWQSLAYVPMETNYEYVSPS* |
Ga0099828_106569804 | 3300009089 | Vadose Zone Soil | YHGVMLGMKTVTWAVSKKVKSWDTLVYVPLENNYEYVS* |
Ga0099828_116253251 | 3300009089 | Vadose Zone Soil | KRTRMTHALGQKLYDAHHGVMLGVKSTTWAVTKKVTAWQTLIYVPLENNYEYVS* |
Ga0099827_103994492 | 3300009090 | Vadose Zone Soil | THDLGQKLYDGYHGVMLGMKSITWAMSRKVGGWPTLAYVPAETNYEHVTPAS* |
Ga0105240_122892062 | 3300009093 | Corn Rhizosphere | RVKLTSALGQKLYDGYHGTMLGMKSITWALSRKVGTWPTLAYVPAETNYDGITVGS* |
Ga0075418_108269971 | 3300009100 | Populus Rhizosphere | SLTSALGQKLYDGYYGVMIGMKSITWAMTKKVASWQSLAYVPLENNYEYISPGG* |
Ga0066709_1002048094 | 3300009137 | Grasslands Soil | VMIGIKSITWAMTKKVNAWPTLAYVPMETNYEFIS* |
Ga0066709_1035658011 | 3300009137 | Grasslands Soil | QEGSQWARRSYDLGQKLYDGYHGVMLGMKSTTWAVSKRVGGWQTLRYVPLENNYGYVS* |
Ga0099792_106992512 | 3300009143 | Vadose Zone Soil | ELDIEKRVRMTQALGQKLYDAHHGVMLGMKSITWALSRKIGGWQSLAYVPMETNYEYVSPA* |
Ga0114129_118167541 | 3300009147 | Populus Rhizosphere | HGVMLGMKSTTWALSKKVGGWSTLLSVPLENNYEYVMPV* |
Ga0075423_101827521 | 3300009162 | Populus Rhizosphere | RLTQALGQKLYDDYRGVMLGVRSITWAVSKKVTSWQTLVYVPLENNYEYVS* |
Ga0075423_102508543 | 3300009162 | Populus Rhizosphere | LYDGYYGVMLGMKSITWATSKKVGGWQTLAYVPMETNYEYVSPAG* |
Ga0075423_121409971 | 3300009162 | Populus Rhizosphere | GYYGVMLGVKSITWAMTKKVGGWQSLAYVPLENNYEYISPAR* |
Ga0105248_128071282 | 3300009177 | Switchgrass Rhizosphere | FDPDKRAKLTHDVGQKLYDGYHGVMLGMKSTTWAVSKKVGGWQTLAYTPMETNYEYVS* |
Ga0129287_100268642 | 3300009538 | Beach Aquifer Porewater | MQRELGTRLYEGYHGVMLGMKSITWALSRRVASWQTLAYAPMETNYEYIAPTG* |
Ga0129287_102152182 | 3300009538 | Beach Aquifer Porewater | MLGMKATTWAVGRKVGGWQTLAYTPMETNYEYVSAVG* |
Ga0105249_132728771 | 3300009553 | Switchgrass Rhizosphere | KELNPERRAKLTRDLGQKLYDNYHGVMLGVKTITWATSKKVTAWETLAYTPLETNYEYLS |
Ga0105252_105183801 | 3300009678 | Soil | GVMLGMKSITWATTKKVGAWQTLNYTVAETNYEYITPGT* |
Ga0126374_114954172 | 3300009792 | Tropical Forest Soil | YHGVMLGMKSTTWALSKKVGTWSTLLSVPLENNYEYVTAAG* |
Ga0105059_10217621 | 3300009795 | Groundwater Sand | LYDEYRGVMLGMRSLTWAVSKKVSGWQTLVYVPLENNYEYVS* |
Ga0105089_10193501 | 3300009809 | Groundwater Sand | QKLYDAHHGVMLGMKSITWAMSRKIGGWQSLAYVPMETNYEYVSPA* |
Ga0105088_10210341 | 3300009810 | Groundwater Sand | MLGMRSLTWAVSKKVNSWQTLVYVPLENNYEYVS* |
Ga0105082_10168702 | 3300009814 | Groundwater Sand | GEKRARMTQALGQKLYDEYRGVMLGMRSLTWAVSKKVNSWQTLVYVPLESNYEYVS* |
Ga0105082_10340382 | 3300009814 | Groundwater Sand | EKRTRMTQTLGQKLYDAHHGVMLGMKSITWALSRKVGGWQSLAYVPLETNYEYVSPAS* |
Ga0105072_10189701 | 3300009818 | Groundwater Sand | MLGMKSITWAMSRKVGSWQTLAYVPLETNYEHVSPAG* |
Ga0105064_10376162 | 3300009821 | Groundwater Sand | SQALGQKLYDDYRGVMLGIRSITWAMSRKVGAWQTLAFVPLETNYEHVSPAS* |
Ga0105066_10206382 | 3300009822 | Groundwater Sand | YDAHHGVMLGMKSITWAMSRKIGGWQSLAYVPMETNYEYVSPA* |
Ga0126380_103756062 | 3300010043 | Tropical Forest Soil | ATLQHEMGQKLYEQYHGVMLGMKVTIWALSKKVGIWSKLLSVPLENNYEYVMPV* |
Ga0126380_117764261 | 3300010043 | Tropical Forest Soil | QALGQRLYDEYRGVMLGMRSLTWAVSKKVTSWQTLVYVPLENNYEYVS* |
Ga0126380_122523141 | 3300010043 | Tropical Forest Soil | RGVMLGMRSLTRAVSKKVGSWQTLVYVPLENNYEYVS* |
Ga0126384_114193431 | 3300010046 | Tropical Forest Soil | QKLYEQYHGVMLGMKSTTWALSKKVGAWSTLLSVPLENNYEYVTPV* |
Ga0126384_116490391 | 3300010046 | Tropical Forest Soil | HALGQKLYDGYHGVMLGMKSITWALSRQVGSWQSLAYVPLETNYEYVSPAS* |
Ga0126382_100788301 | 3300010047 | Tropical Forest Soil | NYHGVMLGTRSLTWAVTKKVTAWQTLVYVPLENNYEYVS* |
Ga0126382_111330141 | 3300010047 | Tropical Forest Soil | KLYENYHGVMLGMKNITWAMTKKVGTWQTLVYVPLENNYEYVTKSDV* |
Ga0127503_100832571 | 3300010154 | Soil | LTQALGQKLYDDYRGVMLGVRSLTWAVSKKVNSWQSLVYVPLENNYEYVS* |
Ga0134070_101118092 | 3300010301 | Grasslands Soil | ALGQKLYDGYYGVMLGVKSVTWALSKKVGGWQSLAYVPLETNYEYVSPAG* |
Ga0134082_101116972 | 3300010303 | Grasslands Soil | IGMKSITWAMTKKVGGWQSLAYVPLENNYEYVSPAG* |
Ga0134109_101474301 | 3300010320 | Grasslands Soil | HGVMLGMKSITWALSRQVGSWQSLAYVPLENNYEYITPAS* |
Ga0134084_100400761 | 3300010322 | Grasslands Soil | LGQKLYDGYHGVMLGMKSITWAVRRKVGAWTTLAYVPAETNYEYVTSSG* |
Ga0126370_106089601 | 3300010358 | Tropical Forest Soil | IDTAAKELNPERRAKLTHDLGQKLYDNYHGVMLGVKTVTWATSKKVNAWEMLAYTPLETNYEYIS* |
Ga0126370_120391002 | 3300010358 | Tropical Forest Soil | ALGQKLYDDYRSVMLGVRSITWAVSKKVTSWQTLVYVPLENNYEYVS* |
Ga0126376_109250603 | 3300010359 | Tropical Forest Soil | LNPERRAKLTRDLGQKLYDKYHGVMLGVKTVTWATSKKVTAWETLAYTPLETNYEYLS* |
Ga0126376_109603032 | 3300010359 | Tropical Forest Soil | LYDKELQAILAELDPAKRAGLTSALGQTLYEQYHGVMLGMKSTTWAVSKKVGRWPTLVYAPLENNYEYVTRVGA* |
Ga0126372_105267611 | 3300010360 | Tropical Forest Soil | KLYDGYHGVMLGMKSVTWALSRRVGAWPTLAYVPAETNYEYVTPPA* |
Ga0126372_126172403 | 3300010360 | Tropical Forest Soil | LGMKSTTWAVSKKVASWQSLAYTPMETNYEYVSPAG* |
Ga0126377_111771201 | 3300010362 | Tropical Forest Soil | RAKLTHDMGQKLYENYHGVMLGMKNVTWAMTKKVGTWQTLVYVPLENNYEYVTKSDV* |
Ga0126377_125592972 | 3300010362 | Tropical Forest Soil | LDPERRAGLTAALGQRLYEQYHGVMLGMKSTTWAVSKKVGRWPTLVYAPLENNYEYITRAGA* |
Ga0126377_125969892 | 3300010362 | Tropical Forest Soil | ARMTHALAQRLYDEYRGVMLGMRSLTWAVSKKVTSWPTLVYVPLENNYEYVS* |
Ga0126377_130699502 | 3300010362 | Tropical Forest Soil | AYHGVMLGTKSVTWALSRKVGGWQTLAYVPMETNYEYVSAAG* |
Ga0126377_130724371 | 3300010362 | Tropical Forest Soil | QRLYEAYHGVMLGMKTMSWALSKKVGSWQSLASCPLETNYEYVTAAG* |
Ga0126379_110801991 | 3300010366 | Tropical Forest Soil | QKLYEQYHGVMLGMKATTWALSKKVGAWSTLLSVPLENNYEYVMPV* |
Ga0126379_111426441 | 3300010366 | Tropical Forest Soil | MGGVMLGMKSTTWALSKKVGAWSTLLSVPLENNYEYVMPV* |
Ga0126381_1038095622 | 3300010376 | Tropical Forest Soil | DNYHGVMLGVKTITWATSKKVSAWETLAYTPLETNYEYIS* |
Ga0126383_106615972 | 3300010398 | Tropical Forest Soil | YEAYHGVMLGMKTMSWALSKKVGSWQSLAYCPLETNYEHVTAAG* |
Ga0126383_107525912 | 3300010398 | Tropical Forest Soil | YRGVMLGVRSLTWAVSKKVTGWQTLVYVPLENNYEYVS* |
Ga0126383_123608271 | 3300010398 | Tropical Forest Soil | EMGQKLYDQYHGVMLGMKTITWALSKKVSAWQTLVYVPLENNYEYVS* |
Ga0126383_130274332 | 3300010398 | Tropical Forest Soil | LGQKLYDGYHGVMLGMKSITWALSRQVGSWQSLAYVPLETNYEYVSPAS* |
Ga0126383_133953202 | 3300010398 | Tropical Forest Soil | ALGQKLYDGYHGVMLGMKSITWALSRQVGSWQSLAYVPLETNYEYVSPAS* |
Ga0134127_100717861 | 3300010399 | Terrestrial Soil | MLGMKSITWALSKKVGTWPTLAYVPAETNYDAITVGS* |
Ga0134127_103802722 | 3300010399 | Terrestrial Soil | MLGVRSLTWAVSKKVNSWQSLVYVPLENNYEYVS* |
Ga0134127_111558971 | 3300010399 | Terrestrial Soil | PDKRAKLTHDLGQKLYDGYHGVMLGVKSTTWAVSKKVGGWQTLAYTPMETNYEYVSSAG* |
Ga0134127_119342052 | 3300010399 | Terrestrial Soil | AKRAGLTSALGQKLYDGYYGVMLGVKSITWAMTKKVGGWQSLAYVPLENNYEYVSPAS* |
Ga0137392_101811073 | 3300011269 | Vadose Zone Soil | MTQAVGQKLYDGYHGVMLGVKSTSWAVTKKVAGWQTLLYVPLENNYEYVS* |
Ga0137392_112236721 | 3300011269 | Vadose Zone Soil | RARMTQAVGQKLYDGYHGVMLGVKSTSWAVTKKVAGWQTLLYVPLENNYEYVS* |
Ga0154003_10538842 | 3300012081 | Attine Ant Fungus Gardens | KLTRDLGQKLYDGYHGVMLGMKSITWAVSKKVGVWPTLAYVPAETNYELITPAG* |
Ga0137389_105753251 | 3300012096 | Vadose Zone Soil | GYYGVMLGMKSLTWAVSKKVGVWPTLAVPAETNYELIAPAG* |
Ga0137388_113871201 | 3300012189 | Vadose Zone Soil | DAHHGVMLGVKSTTWAVTKKVTAWQSLIYVPLENNYEYVS* |
Ga0137388_113871203 | 3300012189 | Vadose Zone Soil | LAQKLYDDYRGVMLGTRSVTWAVSKRVNSWQTLVYVPLENNYEYVS* |
Ga0137364_107787512 | 3300012198 | Vadose Zone Soil | MLGMKSITWAVSRKVGAWTTLAYVPAETNYESVTPAG* |
Ga0137364_111390962 | 3300012198 | Vadose Zone Soil | KMTQALAQKLYDDYRGVMLGTRSVTWAVSKRVTSWQTLVYVPLENNYEYVS* |
Ga0137383_108509261 | 3300012199 | Vadose Zone Soil | DYRGVMLGMRSLTWAVSKKVSSWQTLVYVPLENNYEYVS* |
Ga0137374_101263462 | 3300012204 | Vadose Zone Soil | HALGQKLYDNYHGVMLGMKTVTWAVSKKVKSWETLVYVPLENNYEYVS* |
Ga0137376_105360321 | 3300012208 | Vadose Zone Soil | TQALGQKLYDDYRGVMLGVRSITWAVSKKVNSWQTLVYVPLENNYEYVS* |
Ga0137376_114047822 | 3300012208 | Vadose Zone Soil | YGVMLGMKSITWAMTRKVGGWQSLAYVPLENNYEYVSPAS* |
Ga0137379_103054573 | 3300012209 | Vadose Zone Soil | LTHDLGQKLYDGYHGVMLGMKSITWAVSRKVGAWTTLAYVPAETNYESVTPNP* |
Ga0137369_102244571 | 3300012355 | Vadose Zone Soil | QKLYDAHHGVMLGMKSITWALSRKVGGWQSLAYVPMETNYEHVSPA* |
Ga0137368_101924972 | 3300012358 | Vadose Zone Soil | YEQYHGVMLGMKSTTWAVSKKVGNWSTLLSVPLENNYEYITPAG* |
Ga0137360_106093601 | 3300012361 | Vadose Zone Soil | TLLAELDAEKRATLQHEMGQKLYEQYHGVMLGMKSTTWALSKKVGAWSTLLSVPLENNYEYVTPV* |
Ga0157314_10627702 | 3300012500 | Arabidopsis Rhizosphere | MLGVKTITWATSKKVTAWETLAYTPLETNYEYLS* |
Ga0137373_109476853 | 3300012532 | Vadose Zone Soil | VMLGVKSITWAMSRKVGGWQSLAYVPMETNYEHVS* |
Ga0137397_105342502 | 3300012685 | Vadose Zone Soil | GQKLYDDYRGVMLGMRSLTWAVSKKVNAWQTLVYVPLENNYEYVS* |
Ga0137396_104677772 | 3300012918 | Vadose Zone Soil | MLGVKSVTWALSKKVGGWQSLAYVPLETNYEYVSPAG* |
Ga0137419_105905242 | 3300012925 | Vadose Zone Soil | YEQYHGVMLGMKSTTWALSKKVGAWSTLLSVPLENNYEYVTPV* |
Ga0137419_112777981 | 3300012925 | Vadose Zone Soil | RMTQALGQKLYDDYRGVMLGMRSLTWAVSKKVNAWQTLVYVPLENNYEYVS* |
Ga0137416_107440151 | 3300012927 | Vadose Zone Soil | KLYDGYHGVMLGMKSITWAVTRKVGAWTTLAYVPAETNYESVTPAG* |
Ga0137407_119498532 | 3300012930 | Vadose Zone Soil | VLGQKLYDGYYGVMLGVKSVTWALSKKVGSWQSLAYVPLETNYEYVSPAG* |
Ga0153915_119830542 | 3300012931 | Freshwater Wetlands | GQKLYANYHGVMLGMKSLTWVTTKRVGTWPTLAYTVAETNYEYIAAGG* |
Ga0137410_102040673 | 3300012944 | Vadose Zone Soil | VMLGVKSVTWALSKKVGGWQSLAYVPLETNYEYVSPAG* |
Ga0137410_112138681 | 3300012944 | Vadose Zone Soil | GQKLYDGYHGVMRGMKSLTWALSKKVGAWPTLAYVPAETNYELIAPAS* |
Ga0137410_115440551 | 3300012944 | Vadose Zone Soil | MKSITWAMTRKVGGWQSLAYVPLENNYEYVSPAS* |
Ga0126375_104548611 | 3300012948 | Tropical Forest Soil | KLHDDYRGVMLGMRSVTWAVTKKVSAWRTLVYVPLENNYEYVS* |
Ga0126369_100736311 | 3300012971 | Tropical Forest Soil | DAERRARMSHDLGQRLYEAYHGVMLGMKTMSWALSKKVGSWQSLAYCPLETNYEYVTAAG |
Ga0126369_105718861 | 3300012971 | Tropical Forest Soil | GVMLGMKSTTWALSKKVGAWATLLSVPLENNKKKVTPV* |
Ga0126369_120886133 | 3300012971 | Tropical Forest Soil | YDNYHGVMLGVKTVTWATSKKVTAWDTLAYTPLETNYEYLS* |
Ga0126369_127431121 | 3300012971 | Tropical Forest Soil | LGQKMYDNYHGVMLGMKTVTWAVNKKVKAWDTLVYVPLENNYEYVS* |
Ga0126369_134532502 | 3300012971 | Tropical Forest Soil | LAELDAEKRATLQQEMGQKLYEQYHGVMLGMKATTWALSKKVGTWSTLLSVPLENNYEYVMPV* |
Ga0157373_105910321 | 3300013100 | Corn Rhizosphere | THDMGQKLYENYHGVMLGMKNVTWAMTKKVGTWQTLVYVPLENNYEYVTKSDV* |
Ga0075352_12928691 | 3300014324 | Natural And Restored Wetlands | TKLTHDLGQKLYDNYHGVMLGVKTITWATSKKVTAWETLAYTPLETNYEYVS* |
Ga0157380_112250091 | 3300014326 | Switchgrass Rhizosphere | MLGVKSTTWAVSKKVGGWQTLAYTPMETNYEYVS* |
Ga0137405_10718921 | 3300015053 | Vadose Zone Soil | YDGYYGVMLGVKSITWAMTRKVGGWQSLAYVPLENNYEYVSPAS* |
Ga0137405_11328351 | 3300015053 | Vadose Zone Soil | LTSALGQKLYDGYYGVMLGVKSITWAMTRKVGGWQSLAYVPLENNYEYVSPAS* |
Ga0182007_104023572 | 3300015262 | Rhizosphere | AQLTHALGQKLYDGYHGVMLGMKSITWALGKKVGTWSTLAYVPAETNYDYVTAGT* |
Ga0134089_101135972 | 3300015358 | Grasslands Soil | YHGVMLGTRSVTWAVTKRVTAWQTLVYVPLDNNYEYVS* |
Ga0134089_101689911 | 3300015358 | Grasslands Soil | YGVMLGVKSVTWALSKKVGGWQSLAYVPLETNYEYVSPAG* |
Ga0134089_104199692 | 3300015358 | Grasslands Soil | LAELDAEKRITLQHEMAQKLYEQYHGVMLGMKSTTWALSKKVGTWSTLLSVPLENNYEYVTPVG* |
Ga0134089_105744411 | 3300015358 | Grasslands Soil | ARMTQALGQRLYDEHRGVMLGVRSLTWAVSKKVSGWQTLVYVPLENNYEYVS* |
Ga0132258_108606421 | 3300015371 | Arabidopsis Rhizosphere | VERRAKLTSALGQKLYDGYYGVMLGVKSITWAMTKKVGGWQSLAYVPLENNYEYVSPAS* |
Ga0132255_1034247871 | 3300015374 | Arabidopsis Rhizosphere | KLTSALGQKLYDGYHGTMLGMKSITWALSRKVGTWPTLAYVPAETNYDGITVGS* |
Ga0182036_117134071 | 3300016270 | Soil | QKLYEQYHGVMLGMKSTTWALSKKVGAWSTLLSVPLENNYEYVTPV |
Ga0182040_104308891 | 3300016387 | Soil | NYHGVMLGMKSITWAVSRRVGGWQSLAYVPLENNYEYISPAS |
Ga0182040_119604871 | 3300016387 | Soil | KLYDDYRGVMLGVRSLTWAVSKKVNAWQTLVYVPLENNYEYVS |
Ga0134112_102806852 | 3300017656 | Grasslands Soil | VMLGTRSLTWAVTKKVTAWQTLVYVPLENNYEYVS |
Ga0134112_104148382 | 3300017656 | Grasslands Soil | YDGYHGVMLGMKSTTWALGRKVSAWQTLVSVPLENNYEYVS |
Ga0134083_101738952 | 3300017659 | Grasslands Soil | YDEHRGVMLGVRSLTWAVSKKVSGWQTLVYVPLENNYEYVS |
Ga0163161_110615451 | 3300017792 | Switchgrass Rhizosphere | MKNVTWAVTKKVGTWQTLVYVPLENNYEYIAKSEV |
Ga0184605_100768494 | 3300018027 | Groundwater Sediment | DMGQKLYDNYHGVMLGVKSATWALSKKVKSWDTLVYVPLENNYEYVHSAS |
Ga0184608_101735722 | 3300018028 | Groundwater Sediment | THDMGQKLYDNYHGVMLGVKSTTWALSKKVKSWDTLVYVPLENNYEYVHSAS |
Ga0184634_100427353 | 3300018031 | Groundwater Sediment | KLYDDYRGVMIGIKSITWALSKKVTAWETLAYVPLETNYEYVS |
Ga0184638_11642812 | 3300018052 | Groundwater Sediment | LGMKSITWAMSRKIGGWQSLAYVPMETNYEYVSPAS |
Ga0184626_100695811 | 3300018053 | Groundwater Sediment | RGVMLGMRSLTWAVSKQVNSWQTLVYVPLENNYEYVS |
Ga0184623_100382122 | 3300018056 | Groundwater Sediment | VMLGVKSTTWALSKKVKSWDTLVYVPLENNYEYVHSAS |
Ga0184623_103515542 | 3300018056 | Groundwater Sediment | AHHGVMLGMKSITWAMSRKIGGWQSLAYVPMETNYEYVSPAS |
Ga0184637_105825001 | 3300018063 | Groundwater Sediment | KMTHDLGQKLYENYHGVMLGMKNVTWAVSKKVGEWQTLIYVPLENNYEYISAAAR |
Ga0187773_112210231 | 3300018064 | Tropical Peatland | GYHGVMLGMKSITWALSKRVAGWQTLAYVPAETNYEYVSSAG |
Ga0184640_104492501 | 3300018074 | Groundwater Sediment | DMGQKLYDNYHGVMLGVKSTTWALSKKVKSWDTLVYVPLENNYEYVHSAS |
Ga0184632_100615661 | 3300018075 | Groundwater Sediment | LGQKLYDDHRGVMLGIRSITWAMSRKVGGWQTLAFVPLETNYEYVSPAS |
Ga0184632_101970161 | 3300018075 | Groundwater Sediment | DAHHGVMLGMKSITWAMSRKIGGWQSLAYVPMETNYEYVSPAS |
Ga0184625_102984631 | 3300018081 | Groundwater Sediment | TQALGQKLYDGYYGVMLGMKSITWAMTRKVGGWQTLAYVPLETNYEYVSPAS |
Ga0190265_118239501 | 3300018422 | Soil | GQKMYDGYHGVMLGMKTLTWAVSKKVTKWDTLAFVPAETNYETIA |
Ga0066667_101477941 | 3300018433 | Grasslands Soil | RGVMLGTRSVTWAVSKRVTSWQTLVYVPLENNYEYVS |
Ga0066667_108281601 | 3300018433 | Grasslands Soil | YEQYHGVMLGMNSTTWALSKKVGAWSTLLSVPLENNYEYVTPV |
Ga0066662_102863461 | 3300018468 | Grasslands Soil | MLGMKSITWAVSRKVGSWPTLAYVPAETNYEYVTPGG |
Ga0066662_128549861 | 3300018468 | Grasslands Soil | EKRVRMTQTLGQKLYDAHHGIMLGMKSITWALSRKIGGWQSLAYVPMETNYEYVSP |
Ga0066662_129325971 | 3300018468 | Grasslands Soil | MLGMKSITWAVTRKVGAWTTLAYVPAETNYESVTPNP |
Ga0187892_104861001 | 3300019458 | Bio-Ooze | RTMGQKLYDQYPAVMLGVKSTTWAVSKQVGSWQTLVYVPLENNYEYVGG |
Ga0193725_11056492 | 3300019883 | Soil | HGVMLGTRALTWALSKKVGPWPTLAYTVAETNYEYITPAG |
Ga0180118_13363182 | 3300020063 | Groundwater Sediment | VDAILGQLDVDKRTRMTQALGQKLYDQHHGVMLGVKSTTWAVTRKVGGWQTLNYVPMETNYEYVSAAGSS |
Ga0179594_100124194 | 3300020170 | Vadose Zone Soil | DDSRGVMLGMRSLTWAVSMKVTSWQTLVSVPLENNYEYVS |
Ga0179594_103660532 | 3300020170 | Vadose Zone Soil | QKLYDDYRGVMLGTRSVTWAVSKRVTSWQTLVYVPLENNYEYVS |
Ga0126371_105753951 | 3300021560 | Tropical Forest Soil | LGQKLYDNYHGVMLGVKTVTWATSKKVNAWETLAYTPLETNYEYIS |
Ga0222623_100746352 | 3300022694 | Groundwater Sediment | DTEKRARMTQALGQKLYDAHHGVMLGMKSITWAMSRKVGGWQTLAYVPMETNYEYVSPAS |
Ga0209619_104291622 | 3300025159 | Soil | RAMGQKLYDGYHGVMLGMKSTTWAVSKKVGSWQSLAYTPMETNYEYVSASG |
Ga0209343_101233733 | 3300025311 | Groundwater | DGERRAKLTRDIGQKLYDGYHGVMLGMKSITWALSKRVGGWQTLAYVPMETNYEYVS |
Ga0209431_104358501 | 3300025313 | Soil | RLYDNYHGVMLGMKNVTWAVSKKVGSWQTLVYVPLENNYEYVSAAG |
Ga0207646_108497491 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | YDGYHGVMLGMKSITWAVSKKVGSWPTLAYVPAETNYELVAPVG |
Ga0207646_115906421 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | KELNAERRATLTHDLAQKLHDNYHGVMLGVKTITWATSKKVTAWETLAYTPLETNYEYVSSSRC |
Ga0207701_109508232 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | YRGVMLGMRSLTWAVSKKVNNWPTLVYVPLENNYEYVS |
Ga0207709_116510581 | 3300025935 | Miscanthus Rhizosphere | EFDIERRAKLTQALGQKLYDGYHGVMLGMKSVTWALGKKVNAWSTLAYVPAETNYEHVS |
Ga0207711_100634614 | 3300025941 | Switchgrass Rhizosphere | VMLGMKSTTWAVSKKVGGWQTLAYTPMETNYEYVSS |
Ga0207711_118596901 | 3300025941 | Switchgrass Rhizosphere | HGVMLGMKSTTWAVSKKVGGWQTLAYTPMETNYEYVS |
Ga0207712_105886712 | 3300025961 | Switchgrass Rhizosphere | ALGQKLYDDYRGVMLGVRSITWAVSKKVNSWQTLVYVPLENNYEYVS |
Ga0207668_115858001 | 3300025972 | Switchgrass Rhizosphere | DSDRRAKLSSALGQKLYDGYYGVMLGMKSITWATSKKVGGWQTLAYVPMETNYEYVSPAG |
Ga0207640_105531172 | 3300025981 | Corn Rhizosphere | DGERRSKLTQVLGQKLYDGYHGVMLGMKSVTWALGKKVTAWPTLAYVPAETNYEHVS |
Ga0207708_115619182 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | GTRALTWAVSKKVGSWQTLAYTVAETNYEYISPAG |
Ga0207648_112370951 | 3300026089 | Miscanthus Rhizosphere | HGTMLGMKSITWALSRKIGTWPTLAYVPAETNYDGITVGS |
Ga0209761_10472021 | 3300026313 | Grasslands Soil | EHRGVMLGVRSLTWAVSKKVSGWQTLVYVPLENNYEYVS |
Ga0209801_11578312 | 3300026326 | Soil | VLGQKLYDGYYGVMLGVKSVTWALSKKVGGWQSLAHVPLETNYEYVSPAG |
Ga0209159_10433352 | 3300026343 | Soil | KLYDDYRGVMLGTRSVTWAVSKRVTSWQTLVYVPLENNYEYVS |
Ga0257171_10474932 | 3300026377 | Soil | LGQKLYDGYYGVMLGMKSITWAMTKKVGGWQSLAYVPLENNYEYVSPAS |
Ga0209161_1000078223 | 3300026548 | Soil | MTQGLGQKLYDDCRGVMLGMRSLTWAVSKKVNAWQTLVYVPLENNYEYVS |
Ga0209161_102059452 | 3300026548 | Soil | ALAQRLYDDYRGVMLGMRSLTWAVSKKVSSWQTLVYVPLENNYEYVS |
Ga0209861_10157462 | 3300027332 | Groundwater Sand | MLGMKSITWAMSRKIGGWQSLAYVPMETNYEYVSPA |
Ga0209843_10920301 | 3300027511 | Groundwater Sand | SQALGQKLYDDYRGVMLGIRSITWAMSRKVGAWQTLAFVPLETNYEHVSPAS |
Ga0209799_10397521 | 3300027654 | Tropical Forest Soil | HGVTLGMKSITWALSRQVGGWQSLAYVPLETNYEYVSPAS |
Ga0209590_100435984 | 3300027882 | Vadose Zone Soil | LYEQYHGVMLGMKSTTWALSKKVGTWSTLLSVPLENNYEYVTPVG |
Ga0209488_105320582 | 3300027903 | Vadose Zone Soil | AHHGVMLGMKSITWAMSRKIGGWQSLAYVPMETNYEYVSPA |
Ga0209857_10848352 | 3300027957 | Groundwater Sand | KRARMTQVLGQKLYDDYRGVMLGMRSLTWAVSKQVHSWQTLVYVPLENNYEYVS |
Ga0209853_10611761 | 3300027961 | Groundwater Sand | LDAEKRTRMTQTLGQKLYDAHHGVMLGMKSITWAMSRKVGGWQSLAYVPLETNYEYVSPA |
(restricted) Ga0233418_102055972 | 3300027995 | Sediment | GQKLYDDYRGVMVGVRSITWAMSRKVGGWQTLAFVPMETNYEHVSAAS |
Ga0268265_106250662 | 3300028380 | Switchgrass Rhizosphere | VMLGMKSVTWALGKKVNAWSTLAYVPAETNYEHVS |
Ga0268265_119439682 | 3300028380 | Switchgrass Rhizosphere | YDGYHGVMLGMKSTTWAVSKKVGGWQTLAYTPMETNYEYVS |
Ga0247828_101235922 | 3300028587 | Soil | YHGVMLGMKSTTWALSKKVGGWSTLLSVPLENNYEYVMPV |
Ga0307305_103357741 | 3300028807 | Soil | GVMLGVKSTTWALSKKVKSWDTLVYVPLENNYEYVHSAS |
Ga0307296_101799553 | 3300028819 | Soil | GQKLYDGYHGVMLGMKALTWALGKRVNTWSPLAYVPAETNYDSVS |
Ga0307312_111563662 | 3300028828 | Soil | EKRARMTQALGQKLYDAHHGVMLGMKSITWAMSRKVGGWQSLAYVPMETNYEYVSPAS |
Ga0308178_11255812 | 3300030990 | Soil | QKLYEQYHGVMLGMKSTTWALSKKVGSWSTLLSVPLENNYEYVTPV |
Ga0308188_10329521 | 3300031097 | Soil | LGMKSTTWALSKKVGAWSTLLSVPLENNYEYVTPV |
Ga0307498_101900782 | 3300031170 | Soil | IGQKLYDGYHGVMLGTRALTWAVSKKVGPWPTLGYTVAETNYEYIAPAG |
Ga0307499_100341211 | 3300031184 | Soil | MLGMKSITWALSKKVGTWPTLAYVPAETNYDAITVGS |
Ga0170818_1028479742 | 3300031474 | Forest Soil | LPHLGAAEQKLYEQYHGVMLGMKSTTWALSKKVGAWSTLLSVPLENNYEYVTPV |
Ga0318538_101163682 | 3300031546 | Soil | RMTQALAQKLYDDYRGVMLGVRSLTWAVSKKVTSWQTLVYVPLENNYEYVS |
Ga0310886_102004582 | 3300031562 | Soil | DKRGRLTQALGQKLYDDYRGVMLGVRSITWAVSKKVNSWQTLVYVPLENNYEYVS |
Ga0318573_100346423 | 3300031564 | Soil | TQALAQKLYDDYRGVMLGVRSLTWAVSKKVTSWQTLVYVPLENNYEYVS |
Ga0318573_104521612 | 3300031564 | Soil | VMLGVRSITWAVSKKVNSWQTLVYVPLENNYEYVS |
Ga0306917_107932691 | 3300031719 | Soil | QKLYDDYRGVMLGVRSITWAVSKKVNSWQTLVYVPLENNYEYVS |
Ga0307469_105476991 | 3300031720 | Hardwood Forest Soil | DKRAKMTQALAQKLYENYHGVMLGTRSVTWAVSKRVTSWQTLVYVPLENNYEYVS |
Ga0307469_106392171 | 3300031720 | Hardwood Forest Soil | GQKLYENYHGVMLGMKNVTWAVTRKVGTWQTLVYVPLENNYEYIAKSEV |
Ga0307469_110223872 | 3300031720 | Hardwood Forest Soil | LYDGYYGVMLGVKSVTWALSKKVGGWQSLAYVPLETNYEYVSPAG |
Ga0307469_115637111 | 3300031720 | Hardwood Forest Soil | HGVMLGVKTVTWATSKKVTAWETLAYTPLETNYEYVS |
Ga0307469_116331401 | 3300031720 | Hardwood Forest Soil | VGQKLYDGYHGVMLGMKSTTWAVSKKVAGWQTLAYTPMETNYEYVSAGS |
Ga0307468_1002534131 | 3300031740 | Hardwood Forest Soil | TDKRAKLTHDMGQKLYENYHGVMLGMKNVTWAMTKKVGTWQTLVYVPLENNYEYVTKSDV |
Ga0306918_100894623 | 3300031744 | Soil | QKLYDDYRGVMLGVRSLTWAVSKKVTSWQTLVYVPLENNYEYVS |
Ga0318498_100401794 | 3300031778 | Soil | ARLTQALGQKLYDNYHGVMLGMKSITWAVSRRVGGWQSLAYVPLENNYEYISPAS |
Ga0318557_105128161 | 3300031795 | Soil | GQKLYDNYHGVMLGMKSITWAVSRRVGGWQSLAYVPLENNYEYVSPAS |
Ga0318550_100981191 | 3300031797 | Soil | GQKLYDGYYGVMLGMKSITWAMTKKVGGWQSLAYVPLENNYEYISPAS |
Ga0307473_100271641 | 3300031820 | Hardwood Forest Soil | GMKSITWATSRKVGGWQTLAYVPMETNYEYVSPAG |
Ga0307473_102066972 | 3300031820 | Hardwood Forest Soil | EFDLDKRVRLTQALGQKLYEGYYGVMLGMKSVTWAVSRKVGGWQTLAYVPLETNYEYVSPAS |
Ga0307473_107310092 | 3300031820 | Hardwood Forest Soil | ARMTHALGQKLYDEYRGVMLGMRSLTWAVSKKVNSWPTLVSVPLENNYEYVS |
Ga0307473_108296052 | 3300031820 | Hardwood Forest Soil | DPERRAKLTATLGQKLYDGHHGVMLGMKSITWALSKKVGTWPTLAYVPAETNYDGITVGS |
Ga0307473_110233602 | 3300031820 | Hardwood Forest Soil | KLYDGYYGVMIGMKSITWAMTKKVGGWQSLAYVPLENNYEYVSPAG |
Ga0310892_112066312 | 3300031858 | Soil | GVMLGMKNVTWAMTKKVGTWQTLVYVPLENNYEYVTKSDV |
Ga0310885_104253002 | 3300031943 | Soil | LGVKSITWAMTKKVGGWQSLAYVPLENNYEYISPAS |
Ga0310885_109025731 | 3300031943 | Soil | LTAGLGQKLYDNYHGVMLGMKSITWALSRKVGTWPTLAYVPAETNYDGITAGS |
Ga0310884_105533512 | 3300031944 | Soil | DIERRAKLTHALGQKLYDGYHGVMLGMKSVTWALGKKVNAWSTLAYVPAETNYEHVS |
Ga0214473_116068052 | 3300031949 | Soil | YHGVMLGMKSTTWAVSKKVGSWQSLAYTPMETNYEYVSASG |
Ga0310897_105115101 | 3300032003 | Soil | AKRAGLTSALGQKLYDGYYGVMLGVKSITWAMTKKVGGWQSLAYVPLENNYEYVSPAS |
Ga0310902_105256881 | 3300032012 | Soil | VMLGVKSITWAMTKKVGGWQSLAYVPLENNYEYISPAS |
Ga0318549_104874532 | 3300032041 | Soil | VERRAKLTSALGQKLYDGYYGVMLGMKSITWAMTKKVGGWQSLAYVPLENNYEYVSPAS |
Ga0318510_101835931 | 3300032064 | Soil | MTQALAQKLYDDYRGVMLGVRSITWAVSKKVNSWQTLVYVPLENNYEYVS |
Ga0310895_104298531 | 3300032122 | Soil | QAMGQTLYDNYHGVMLGMKNVTWAVTKKVGTWQTLVYVPLENNYEYIAKSEV |
Ga0307470_108873762 | 3300032174 | Hardwood Forest Soil | ATHALAQRLYDEYRGVMLGMRSLTWAVSKKVNSWPTLVYVPLENNYEYVS |
Ga0307471_1018381731 | 3300032180 | Hardwood Forest Soil | LGQKLYDGYFGVMLGMKSITWATSRKVGGWQTLAYVPMETNYEYVIPAG |
Ga0307471_1034359382 | 3300032180 | Hardwood Forest Soil | VMLGMKNVTWAVSKKVAGWQTLVYVPLENNYEYVS |
Ga0307471_1042377982 | 3300032180 | Hardwood Forest Soil | GYHGVMLGMKSLTWAVSKKVGAWPTLAYVPAETNYELIAPAG |
Ga0307472_1011570981 | 3300032205 | Hardwood Forest Soil | LTSALGQKLYDGYYGVMIGMKSITWAMTKKVGSWQSLAYVPLENNYEYVSPAS |
Ga0307472_1013438121 | 3300032205 | Hardwood Forest Soil | EFDPDKRTRLTRELGQKLYDGYHGVMLGMKSVTWALGRRVGTWPTLAYVPAETNYEYVTPPG |
Ga0335082_109970141 | 3300032782 | Soil | LGMKSTTWAVSKKVGSWQTLAYTPMETNYEYVSASG |
Ga0335082_111471652 | 3300032782 | Soil | DLGQKLYDNYHGVMLGVKSVSWATSKKVNSWQTLAYTPLETNYEYIS |
Ga0335080_117841772 | 3300032828 | Soil | LTASLGQKLYDGYHGIMLGMKSITWAMSRRVGTWPTLAYVPAETNYDGITVGS |
Ga0335077_105038021 | 3300033158 | Soil | ASLGQKLYDGYHGIMLGMKSITWAMSRRVGTWPTLAYVPAETNYDGITVGS |
Ga0334722_113346842 | 3300033233 | Sediment | TDRRAKLTHDLGQKLYDGYHGVMIGIKSITWALSKKVNAWQTLAYVPLETNYEHVS |
Ga0318519_104062522 | 3300033290 | Soil | GYYGVMLGMKSITWAMTKKVGGWQSLAYVPLENNYEYVSPAS |
Ga0364928_0181969_2_139 | 3300033813 | Sediment | GQKLYDEYRGVMLGMRSLTWAVSKKVSGWQTLVYVPLENNYEYVS |
Ga0370498_173828_1_135 | 3300034155 | Untreated Peat Soil | LYDGYHGVMLGTRALTWAVSKKVGTWPTLAYTVAETNYEYIHAG |
Ga0314784_006490_1345_1515 | 3300034663 | Soil | KRATLQQEMGQKLYEQYHGVMLGMKSTTWALSKKVGAWSTLLSVPLENNYEYVMPV |
Ga0314795_013093_1040_1150 | 3300034670 | Soil | MLGMKSTTWALSKKVGDWSTLLSVPLENNYEYVKPV |
Ga0314801_141113_27_137 | 3300034676 | Soil | MLGMKSTTWALSKKVGDWSTLLSVPLENNYEYVMPV |
⦗Top⦘ |