| Basic Information | |
|---|---|
| Family ID | F010131 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 308 |
| Average Sequence Length | 47 residues |
| Representative Sequence | KVVELWGKRGAMDMVAVMNTYAVSGFFAIAVDEHPAEGKPALPAVK |
| Number of Associated Samples | 248 |
| Number of Associated Scaffolds | 308 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.97 % |
| % of genes near scaffold ends (potentially truncated) | 97.40 % |
| % of genes from short scaffolds (< 2000 bps) | 92.21 % |
| Associated GOLD sequencing projects | 230 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (82.143 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (8.442 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.390 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (46.104 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 29.73% β-sheet: 0.00% Coil/Unstructured: 70.27% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 308 Family Scaffolds |
|---|---|---|
| PF00753 | Lactamase_B | 10.06 |
| PF13360 | PQQ_2 | 5.19 |
| PF02771 | Acyl-CoA_dh_N | 2.92 |
| PF13442 | Cytochrome_CBB3 | 2.92 |
| PF13378 | MR_MLE_C | 2.27 |
| PF01845 | CcdB | 1.95 |
| PF07995 | GSDH | 1.95 |
| PF12796 | Ank_2 | 1.30 |
| PF13857 | Ank_5 | 0.97 |
| PF13460 | NAD_binding_10 | 0.97 |
| PF16980 | CitMHS_2 | 0.97 |
| PF04402 | SIMPL | 0.65 |
| PF07519 | Tannase | 0.65 |
| PF02746 | MR_MLE_N | 0.65 |
| PF08439 | Peptidase_M3_N | 0.65 |
| PF13531 | SBP_bac_11 | 0.65 |
| PF08309 | LVIVD | 0.65 |
| PF03781 | FGE-sulfatase | 0.65 |
| PF13709 | DUF4159 | 0.32 |
| PF12740 | Chlorophyllase2 | 0.32 |
| PF12681 | Glyoxalase_2 | 0.32 |
| PF01367 | 5_3_exonuc | 0.32 |
| PF13533 | Biotin_lipoyl_2 | 0.32 |
| PF05559 | DUF763 | 0.32 |
| PF07676 | PD40 | 0.32 |
| PF07589 | PEP-CTERM | 0.32 |
| PF01261 | AP_endonuc_2 | 0.32 |
| PF01894 | UPF0047 | 0.32 |
| PF01808 | AICARFT_IMPCHas | 0.32 |
| PF09980 | DUF2214 | 0.32 |
| PF01833 | TIG | 0.32 |
| PF02789 | Peptidase_M17_N | 0.32 |
| PF12543 | DUF3738 | 0.32 |
| PF01345 | DUF11 | 0.32 |
| PF00069 | Pkinase | 0.32 |
| PF02687 | FtsX | 0.32 |
| PF08241 | Methyltransf_11 | 0.32 |
| PF12704 | MacB_PCD | 0.32 |
| PF03972 | MmgE_PrpD | 0.32 |
| PF00202 | Aminotran_3 | 0.32 |
| PF00171 | Aldedh | 0.32 |
| PF10576 | EndIII_4Fe-2S | 0.32 |
| PF12867 | DinB_2 | 0.32 |
| PF07040 | DUF1326 | 0.32 |
| PF01906 | YbjQ_1 | 0.32 |
| PF13419 | HAD_2 | 0.32 |
| PF00561 | Abhydrolase_1 | 0.32 |
| PF02410 | RsfS | 0.32 |
| PF02585 | PIG-L | 0.32 |
| PF04307 | YdjM | 0.32 |
| PF02627 | CMD | 0.32 |
| PF13091 | PLDc_2 | 0.32 |
| PF03724 | META | 0.32 |
| PF11746 | DUF3303 | 0.32 |
| PF13637 | Ank_4 | 0.32 |
| PF13426 | PAS_9 | 0.32 |
| PF06736 | TMEM175 | 0.32 |
| PF10637 | Ofd1_CTDD | 0.32 |
| PF08281 | Sigma70_r4_2 | 0.32 |
| PF02239 | Cytochrom_D1 | 0.32 |
| PF01019 | G_glu_transpept | 0.32 |
| PF01741 | MscL | 0.32 |
| PF02803 | Thiolase_C | 0.32 |
| PF12833 | HTH_18 | 0.32 |
| PF11253 | DUF3052 | 0.32 |
| PF03544 | TonB_C | 0.32 |
| PF00135 | COesterase | 0.32 |
| PF05199 | GMC_oxred_C | 0.32 |
| PF02371 | Transposase_20 | 0.32 |
| PF00012 | HSP70 | 0.32 |
| PF13090 | PP_kinase_C | 0.32 |
| PF08450 | SGL | 0.32 |
| PF17185 | NlpE_C | 0.32 |
| PF00067 | p450 | 0.32 |
| PF07969 | Amidohydro_3 | 0.32 |
| PF00144 | Beta-lactamase | 0.32 |
| COG ID | Name | Functional Category | % Frequency in 308 Family Scaffolds |
|---|---|---|---|
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 2.92 |
| COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 1.95 |
| COG4948 | L-alanine-DL-glutamate epimerase or related enzyme of enolase superfamily | Cell wall/membrane/envelope biogenesis [M] | 1.30 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 1.30 |
| COG5276 | Uncharacterized secreted protein, contains LVIVD repeats, choice-of-anchor domain | Function unknown [S] | 0.65 |
| COG3471 | Predicted secreted (periplasmic) protein | Function unknown [S] | 0.65 |
| COG2968 | Uncharacterized conserved protein YggE, contains kinase-interacting SIMPL domain | Function unknown [S] | 0.65 |
| COG2859 | Outer membrane channel-forming protein BP26/OMP28, SIMPL family | Cell wall/membrane/envelope biogenesis [M] | 0.65 |
| COG1164 | Oligoendopeptidase F | Amino acid transport and metabolism [E] | 0.65 |
| COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 0.65 |
| COG3187 | Heat shock protein HslJ | Posttranslational modification, protein turnover, chaperones [O] | 0.32 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.32 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.32 |
| COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 0.32 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.32 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.32 |
| COG1988 | Membrane-bound metal-dependent hydrolase YbcI, DUF457 family | General function prediction only [R] | 0.32 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.32 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.32 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.32 |
| COG3548 | Uncharacterized membrane protein | Function unknown [S] | 0.32 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.32 |
| COG5588 | Uncharacterized conserved protein, DUF1326 domain | Function unknown [S] | 0.32 |
| COG0799 | Ribosomal silencing factor RsfS, regulates association of 30S and 50S subunits | Translation, ribosomal structure and biogenesis [J] | 0.32 |
| COG0138 | AICAR transformylase/IMP cyclohydrolase PurH | Nucleotide transport and metabolism [F] | 0.32 |
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.32 |
| COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 0.32 |
| COG0260 | Leucyl aminopeptidase | Amino acid transport and metabolism [E] | 0.32 |
| COG0393 | Uncharacterized pentameric protein YbjQ, UPF0145 family | Function unknown [S] | 0.32 |
| COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 0.32 |
| COG0432 | Thiamin phosphate synthase YjbQ, UPF0047 family | Coenzyme transport and metabolism [H] | 0.32 |
| COG0443 | Molecular chaperone DnaK (HSP70) | Posttranslational modification, protein turnover, chaperones [O] | 0.32 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.32 |
| COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 0.32 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.32 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.32 |
| COG1415 | Uncharacterized conserved protein, DUF763 domain | Function unknown [S] | 0.32 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.32 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.32 |
| COG1970 | Large-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.32 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.32 |
| COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 0.32 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 82.47 % |
| Unclassified | root | N/A | 17.53 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2035918006|FACEMD_F1OL2UU01EH697 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 2124908009|FWIRA_GRAM18402GPDFU | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 2170459012|GOYVCMS01BH4D7 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 2170459016|G1P06HT02IRPOQ | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c0396660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 542 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c0546289 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 547 | Open in IMG/M |
| 3300000559|F14TC_100615911 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300000881|JGI10215J12807_1290955 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1138 | Open in IMG/M |
| 3300000956|JGI10216J12902_122487542 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300001849|RCM26_1190294 | Not Available | 566 | Open in IMG/M |
| 3300003267|soilL1_10034153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 1694 | Open in IMG/M |
| 3300003319|soilL2_10071914 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1380 | Open in IMG/M |
| 3300003991|Ga0055461_10193421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 549 | Open in IMG/M |
| 3300004022|Ga0055432_10029442 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1207 | Open in IMG/M |
| 3300004024|Ga0055436_10287921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 529 | Open in IMG/M |
| 3300004058|Ga0055498_10110074 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 567 | Open in IMG/M |
| 3300004114|Ga0062593_100455382 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
| 3300004157|Ga0062590_103012693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 505 | Open in IMG/M |
| 3300004479|Ga0062595_100024479 | All Organisms → cellular organisms → Bacteria | 2361 | Open in IMG/M |
| 3300004643|Ga0062591_100017701 | All Organisms → cellular organisms → Bacteria | 3350 | Open in IMG/M |
| 3300004643|Ga0062591_101096159 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300005331|Ga0070670_102225177 | Not Available | 505 | Open in IMG/M |
| 3300005332|Ga0066388_102058586 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1025 | Open in IMG/M |
| 3300005333|Ga0070677_10119007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1190 | Open in IMG/M |
| 3300005335|Ga0070666_10125104 | All Organisms → cellular organisms → Bacteria | 1784 | Open in IMG/M |
| 3300005336|Ga0070680_100072834 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2824 | Open in IMG/M |
| 3300005336|Ga0070680_100877521 | Not Available | 774 | Open in IMG/M |
| 3300005337|Ga0070682_101087876 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
| 3300005340|Ga0070689_100203710 | All Organisms → cellular organisms → Bacteria | 1617 | Open in IMG/M |
| 3300005340|Ga0070689_100816295 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300005365|Ga0070688_100589852 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 849 | Open in IMG/M |
| 3300005456|Ga0070678_100951209 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300005530|Ga0070679_101971137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 533 | Open in IMG/M |
| 3300005535|Ga0070684_100678797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 960 | Open in IMG/M |
| 3300005538|Ga0070731_10102617 | All Organisms → cellular organisms → Bacteria | 1894 | Open in IMG/M |
| 3300005538|Ga0070731_10229608 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1232 | Open in IMG/M |
| 3300005544|Ga0070686_100414066 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1028 | Open in IMG/M |
| 3300005544|Ga0070686_101495618 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 569 | Open in IMG/M |
| 3300005544|Ga0070686_101702807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 535 | Open in IMG/M |
| 3300005547|Ga0070693_101188629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 585 | Open in IMG/M |
| 3300005548|Ga0070665_102078545 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
| 3300005564|Ga0070664_100880609 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300005578|Ga0068854_101423348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 627 | Open in IMG/M |
| 3300005614|Ga0068856_101070039 | Not Available | 824 | Open in IMG/M |
| 3300005617|Ga0068859_102748562 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300005718|Ga0068866_10239555 | All Organisms → cellular organisms → Bacteria | 1104 | Open in IMG/M |
| 3300005719|Ga0068861_100873459 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 850 | Open in IMG/M |
| 3300005764|Ga0066903_106723993 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 598 | Open in IMG/M |
| 3300005764|Ga0066903_107750921 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 552 | Open in IMG/M |
| 3300005836|Ga0074470_10640775 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300005840|Ga0068870_10145024 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1393 | Open in IMG/M |
| 3300005840|Ga0068870_11047816 | Not Available | 584 | Open in IMG/M |
| 3300005841|Ga0068863_101719272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 637 | Open in IMG/M |
| 3300005842|Ga0068858_100985402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 826 | Open in IMG/M |
| 3300005844|Ga0068862_100076208 | Not Available | 2902 | Open in IMG/M |
| 3300005844|Ga0068862_102333245 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
| 3300006052|Ga0075029_101131269 | Not Available | 545 | Open in IMG/M |
| 3300006163|Ga0070715_10578537 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300006176|Ga0070765_101157036 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 731 | Open in IMG/M |
| 3300006196|Ga0075422_10065289 | All Organisms → cellular organisms → Bacteria | 1345 | Open in IMG/M |
| 3300006237|Ga0097621_100116267 | All Organisms → cellular organisms → Bacteria | 2265 | Open in IMG/M |
| 3300006358|Ga0068871_100053932 | All Organisms → cellular organisms → Bacteria | 3260 | Open in IMG/M |
| 3300006358|Ga0068871_100680479 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 941 | Open in IMG/M |
| 3300006577|Ga0074050_11473994 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
| 3300006755|Ga0079222_11517757 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300006844|Ga0075428_100183484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 2264 | Open in IMG/M |
| 3300006853|Ga0075420_101471664 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 584 | Open in IMG/M |
| 3300006854|Ga0075425_102349741 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300006854|Ga0075425_102566982 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300006876|Ga0079217_11422129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 543 | Open in IMG/M |
| 3300006903|Ga0075426_10417357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 991 | Open in IMG/M |
| 3300006903|Ga0075426_11314866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300006914|Ga0075436_101540166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 505 | Open in IMG/M |
| 3300006954|Ga0079219_12460988 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300007004|Ga0079218_12096348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 651 | Open in IMG/M |
| 3300007562|Ga0102915_1279091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 540 | Open in IMG/M |
| 3300007603|Ga0102921_1081261 | All Organisms → cellular organisms → Bacteria | 1182 | Open in IMG/M |
| 3300007992|Ga0105748_10233874 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 769 | Open in IMG/M |
| 3300009012|Ga0066710_104705172 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300009053|Ga0105095_10292913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 894 | Open in IMG/M |
| 3300009056|Ga0102860_1076055 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 920 | Open in IMG/M |
| 3300009094|Ga0111539_12162289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 646 | Open in IMG/M |
| 3300009094|Ga0111539_13429462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 509 | Open in IMG/M |
| 3300009098|Ga0105245_12021251 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 630 | Open in IMG/M |
| 3300009100|Ga0075418_10768877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1040 | Open in IMG/M |
| 3300009101|Ga0105247_10933337 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 673 | Open in IMG/M |
| 3300009148|Ga0105243_10534943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea basaltis | 1117 | Open in IMG/M |
| 3300009162|Ga0075423_10067608 | All Organisms → cellular organisms → Bacteria | 3707 | Open in IMG/M |
| 3300009176|Ga0105242_10461309 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1200 | Open in IMG/M |
| 3300009176|Ga0105242_11926503 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300009176|Ga0105242_12562198 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 559 | Open in IMG/M |
| 3300009176|Ga0105242_13124352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 513 | Open in IMG/M |
| 3300009177|Ga0105248_10282536 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1869 | Open in IMG/M |
| 3300009177|Ga0105248_12307104 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
| 3300009527|Ga0114942_1284778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 628 | Open in IMG/M |
| 3300009553|Ga0105249_12866417 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
| 3300010047|Ga0126382_11373116 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
| 3300010166|Ga0126306_10553731 | Not Available | 913 | Open in IMG/M |
| 3300010359|Ga0126376_10724650 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 960 | Open in IMG/M |
| 3300010359|Ga0126376_11346072 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300010360|Ga0126372_10418036 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1230 | Open in IMG/M |
| 3300010362|Ga0126377_10880573 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300010362|Ga0126377_10916018 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 940 | Open in IMG/M |
| 3300010397|Ga0134124_11217227 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 774 | Open in IMG/M |
| 3300010398|Ga0126383_11558691 | Not Available | 750 | Open in IMG/M |
| 3300010398|Ga0126383_11619504 | Not Available | 737 | Open in IMG/M |
| 3300010399|Ga0134127_10480110 | All Organisms → cellular organisms → Bacteria | 1250 | Open in IMG/M |
| 3300010400|Ga0134122_10953695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 836 | Open in IMG/M |
| 3300010401|Ga0134121_10088878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 2579 | Open in IMG/M |
| 3300010412|Ga0136852_10470432 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1221 | Open in IMG/M |
| 3300012172|Ga0137320_1083889 | Not Available | 678 | Open in IMG/M |
| 3300012173|Ga0137327_1044866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 964 | Open in IMG/M |
| 3300012212|Ga0150985_113345116 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
| 3300012212|Ga0150985_120195274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 560 | Open in IMG/M |
| 3300012285|Ga0137370_10858859 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
| 3300012514|Ga0157330_1022994 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 727 | Open in IMG/M |
| 3300012891|Ga0157305_10294166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 506 | Open in IMG/M |
| 3300012893|Ga0157284_10040798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 1017 | Open in IMG/M |
| 3300012902|Ga0157291_10076014 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300012915|Ga0157302_10355776 | Not Available | 589 | Open in IMG/M |
| 3300012971|Ga0126369_13078724 | Not Available | 546 | Open in IMG/M |
| 3300012985|Ga0164308_11792888 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300012986|Ga0164304_11174835 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
| 3300013096|Ga0157307_1021798 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
| 3300013296|Ga0157374_11464765 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 706 | Open in IMG/M |
| 3300013297|Ga0157378_11040029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 854 | Open in IMG/M |
| 3300013306|Ga0163162_10134845 | All Organisms → cellular organisms → Bacteria | 2579 | Open in IMG/M |
| 3300013306|Ga0163162_12339575 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
| 3300014269|Ga0075302_1082974 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 697 | Open in IMG/M |
| 3300014307|Ga0075304_1017246 | All Organisms → cellular organisms → Bacteria | 1468 | Open in IMG/M |
| 3300014321|Ga0075353_1152628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 584 | Open in IMG/M |
| 3300014325|Ga0163163_10525204 | Not Available | 1246 | Open in IMG/M |
| 3300014325|Ga0163163_11571162 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 719 | Open in IMG/M |
| 3300014325|Ga0163163_13103300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 518 | Open in IMG/M |
| 3300014326|Ga0157380_10247951 | Not Available | 1610 | Open in IMG/M |
| 3300014745|Ga0157377_10699375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 736 | Open in IMG/M |
| 3300014881|Ga0180094_1037646 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1003 | Open in IMG/M |
| 3300014969|Ga0157376_12066576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 608 | Open in IMG/M |
| 3300015200|Ga0173480_11210372 | Not Available | 511 | Open in IMG/M |
| 3300015256|Ga0180073_1095274 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 640 | Open in IMG/M |
| 3300015371|Ga0132258_12659214 | Not Available | 1249 | Open in IMG/M |
| 3300015371|Ga0132258_13794447 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1029 | Open in IMG/M |
| 3300015373|Ga0132257_100473185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 1533 | Open in IMG/M |
| 3300015373|Ga0132257_101099833 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
| 3300015373|Ga0132257_103915642 | Not Available | 542 | Open in IMG/M |
| 3300015374|Ga0132255_100555735 | All Organisms → cellular organisms → Bacteria | 1692 | Open in IMG/M |
| 3300015374|Ga0132255_103271692 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 690 | Open in IMG/M |
| 3300016319|Ga0182033_11446853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 619 | Open in IMG/M |
| 3300016387|Ga0182040_11979575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 500 | Open in IMG/M |
| 3300016422|Ga0182039_11402271 | Not Available | 635 | Open in IMG/M |
| 3300016445|Ga0182038_10121144 | All Organisms → cellular organisms → Bacteria | 1943 | Open in IMG/M |
| 3300016445|Ga0182038_11900469 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300016737|Ga0182047_1474041 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 893 | Open in IMG/M |
| 3300017792|Ga0163161_10047057 | All Organisms → cellular organisms → Bacteria | 3114 | Open in IMG/M |
| 3300017792|Ga0163161_11771855 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300017927|Ga0187824_10374058 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300017936|Ga0187821_10369387 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300017955|Ga0187817_10127208 | All Organisms → cellular organisms → Bacteria | 1613 | Open in IMG/M |
| 3300017965|Ga0190266_10088346 | Not Available | 1236 | Open in IMG/M |
| 3300017965|Ga0190266_11072756 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300017966|Ga0187776_10480735 | Not Available | 846 | Open in IMG/M |
| 3300017969|Ga0181585_10089734 | Not Available | 2324 | Open in IMG/M |
| 3300018036|Ga0181600_10155200 | All Organisms → cellular organisms → Bacteria | 1268 | Open in IMG/M |
| 3300018055|Ga0184616_10064189 | Not Available | 1255 | Open in IMG/M |
| 3300018073|Ga0184624_10127277 | Not Available | 1107 | Open in IMG/M |
| 3300018416|Ga0181553_10017892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 5345 | Open in IMG/M |
| 3300018423|Ga0181593_10024282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 5239 | Open in IMG/M |
| 3300018432|Ga0190275_12752708 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 568 | Open in IMG/M |
| 3300018469|Ga0190270_10083065 | All Organisms → cellular organisms → Bacteria | 2384 | Open in IMG/M |
| 3300018476|Ga0190274_12359973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 629 | Open in IMG/M |
| 3300018476|Ga0190274_12897597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 575 | Open in IMG/M |
| 3300018476|Ga0190274_13816280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 510 | Open in IMG/M |
| 3300018481|Ga0190271_11232310 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → Chlorobia → Chlorobiales → Chlorobiaceae → Chlorobium/Pelodictyon group → Chlorobium → Chlorobium limicola → Chlorobium limicola DSM 245 | 870 | Open in IMG/M |
| 3300018481|Ga0190271_13399615 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300019262|Ga0182066_1662979 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300019361|Ga0173482_10520596 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300019362|Ga0173479_10190744 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300020052|Ga0181554_1256185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 679 | Open in IMG/M |
| 3300020184|Ga0181573_10006971 | All Organisms → cellular organisms → Bacteria | 9061 | Open in IMG/M |
| 3300020583|Ga0210401_10195372 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1881 | Open in IMG/M |
| 3300021178|Ga0210408_11249784 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 565 | Open in IMG/M |
| 3300021181|Ga0210388_10082947 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 2722 | Open in IMG/M |
| 3300021384|Ga0213876_10178090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 1131 | Open in IMG/M |
| 3300021404|Ga0210389_10589443 | Not Available | 874 | Open in IMG/M |
| 3300021404|Ga0210389_10721981 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 780 | Open in IMG/M |
| 3300021406|Ga0210386_11444980 | Not Available | 575 | Open in IMG/M |
| 3300021433|Ga0210391_10680295 | Not Available | 807 | Open in IMG/M |
| 3300021477|Ga0210398_10161473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae | 1824 | Open in IMG/M |
| 3300022756|Ga0222622_10697542 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300022906|Ga0247766_1025432 | All Organisms → cellular organisms → Bacteria | 1442 | Open in IMG/M |
| 3300022917|Ga0247777_1287356 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 525 | Open in IMG/M |
| 3300022934|Ga0255781_10187499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1029 | Open in IMG/M |
| 3300023102|Ga0247754_1178296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 533 | Open in IMG/M |
| 3300024550|Ga0255266_1114180 | Not Available | 622 | Open in IMG/M |
| 3300024557|Ga0255283_1086798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 673 | Open in IMG/M |
| 3300025165|Ga0209108_10563026 | Not Available | 538 | Open in IMG/M |
| 3300025861|Ga0209605_1259611 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 630 | Open in IMG/M |
| 3300025900|Ga0207710_10483435 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 641 | Open in IMG/M |
| 3300025901|Ga0207688_10446874 | Not Available | 805 | Open in IMG/M |
| 3300025903|Ga0207680_10573933 | Not Available | 806 | Open in IMG/M |
| 3300025903|Ga0207680_11008192 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
| 3300025903|Ga0207680_11378825 | Not Available | 500 | Open in IMG/M |
| 3300025907|Ga0207645_10462023 | Not Available | 857 | Open in IMG/M |
| 3300025909|Ga0207705_10820311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 722 | Open in IMG/M |
| 3300025911|Ga0207654_10209532 | All Organisms → cellular organisms → Bacteria | 1287 | Open in IMG/M |
| 3300025911|Ga0207654_11181620 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300025917|Ga0207660_10555935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 933 | Open in IMG/M |
| 3300025918|Ga0207662_11206458 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 538 | Open in IMG/M |
| 3300025918|Ga0207662_11327489 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300025920|Ga0207649_11449066 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300025923|Ga0207681_10265919 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1344 | Open in IMG/M |
| 3300025923|Ga0207681_10801192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 787 | Open in IMG/M |
| 3300025925|Ga0207650_10309293 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1292 | Open in IMG/M |
| 3300025927|Ga0207687_10160867 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1723 | Open in IMG/M |
| 3300025927|Ga0207687_11182492 | Not Available | 657 | Open in IMG/M |
| 3300025928|Ga0207700_11689787 | Not Available | 558 | Open in IMG/M |
| 3300025929|Ga0207664_10930869 | Not Available | 780 | Open in IMG/M |
| 3300025931|Ga0207644_10198199 | All Organisms → cellular organisms → Bacteria | 1583 | Open in IMG/M |
| 3300025933|Ga0207706_10194757 | All Organisms → cellular organisms → Bacteria | 1778 | Open in IMG/M |
| 3300025936|Ga0207670_10019006 | All Organisms → cellular organisms → Bacteria | 4188 | Open in IMG/M |
| 3300025936|Ga0207670_10353482 | All Organisms → cellular organisms → Bacteria | 1164 | Open in IMG/M |
| 3300025937|Ga0207669_11918094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 506 | Open in IMG/M |
| 3300025938|Ga0207704_11211064 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 644 | Open in IMG/M |
| 3300025940|Ga0207691_10073593 | All Organisms → cellular organisms → Bacteria | 3082 | Open in IMG/M |
| 3300025940|Ga0207691_11391875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 577 | Open in IMG/M |
| 3300025945|Ga0207679_10299275 | All Organisms → cellular organisms → Bacteria | 1386 | Open in IMG/M |
| 3300025960|Ga0207651_10436009 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
| 3300025960|Ga0207651_10459289 | Not Available | 1094 | Open in IMG/M |
| 3300025960|Ga0207651_11134078 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 701 | Open in IMG/M |
| 3300025972|Ga0207668_10666747 | Not Available | 912 | Open in IMG/M |
| 3300025986|Ga0207658_11839501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 552 | Open in IMG/M |
| 3300026023|Ga0207677_11277769 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
| 3300026035|Ga0207703_10324080 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1412 | Open in IMG/M |
| 3300026041|Ga0207639_10601993 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1014 | Open in IMG/M |
| 3300026067|Ga0207678_10017038 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6380 | Open in IMG/M |
| 3300026075|Ga0207708_10208837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 1560 | Open in IMG/M |
| 3300026075|Ga0207708_11454306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 602 | Open in IMG/M |
| 3300026078|Ga0207702_10258971 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1637 | Open in IMG/M |
| 3300026078|Ga0207702_12493940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 504 | Open in IMG/M |
| 3300026088|Ga0207641_12157527 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae | 558 | Open in IMG/M |
| 3300026088|Ga0207641_12298476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 539 | Open in IMG/M |
| 3300026089|Ga0207648_11365705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 666 | Open in IMG/M |
| 3300026089|Ga0207648_11814111 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300026095|Ga0207676_11934544 | Not Available | 588 | Open in IMG/M |
| 3300026118|Ga0207675_100194380 | All Organisms → cellular organisms → Bacteria | 1947 | Open in IMG/M |
| 3300027395|Ga0209996_1059779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 584 | Open in IMG/M |
| 3300027787|Ga0209074_10178809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 783 | Open in IMG/M |
| 3300027869|Ga0209579_10249561 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300027874|Ga0209465_10526998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 589 | Open in IMG/M |
| 3300027880|Ga0209481_10010819 | All Organisms → cellular organisms → Bacteria | 3929 | Open in IMG/M |
| 3300027880|Ga0209481_10193631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1014 | Open in IMG/M |
| 3300027884|Ga0209275_10324071 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 859 | Open in IMG/M |
| 3300027884|Ga0209275_10794669 | Not Available | 546 | Open in IMG/M |
| 3300027895|Ga0209624_10246640 | Not Available | 1187 | Open in IMG/M |
| 3300027905|Ga0209415_10901823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 601 | Open in IMG/M |
| 3300027907|Ga0207428_10293518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1204 | Open in IMG/M |
| 3300028380|Ga0268265_10766158 | Not Available | 938 | Open in IMG/M |
| 3300028380|Ga0268265_11039213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 811 | Open in IMG/M |
| 3300028381|Ga0268264_11392863 | Not Available | 712 | Open in IMG/M |
| 3300028803|Ga0307281_10294743 | Not Available | 604 | Open in IMG/M |
| 3300028906|Ga0308309_10284585 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1394 | Open in IMG/M |
| 3300030058|Ga0302179_10034402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 2346 | Open in IMG/M |
| 3300030399|Ga0311353_11120932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 653 | Open in IMG/M |
| 3300030618|Ga0311354_11796571 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 533 | Open in IMG/M |
| 3300031226|Ga0307497_10637129 | Not Available | 543 | Open in IMG/M |
| 3300031231|Ga0170824_117596912 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300031238|Ga0265332_10171957 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 904 | Open in IMG/M |
| 3300031455|Ga0307505_10311854 | Not Available | 739 | Open in IMG/M |
| 3300031538|Ga0310888_10356077 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300031538|Ga0310888_10533301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 706 | Open in IMG/M |
| 3300031546|Ga0318538_10277290 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 902 | Open in IMG/M |
| 3300031681|Ga0318572_10906079 | Not Available | 524 | Open in IMG/M |
| 3300031708|Ga0310686_102816641 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300031708|Ga0310686_116108265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 816 | Open in IMG/M |
| 3300031740|Ga0307468_102234779 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300031847|Ga0310907_10425638 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. KM1 | 697 | Open in IMG/M |
| 3300031847|Ga0310907_10702034 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300031854|Ga0310904_11402453 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300031858|Ga0310892_10047476 | Not Available | 2108 | Open in IMG/M |
| 3300031858|Ga0310892_10222047 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
| 3300031879|Ga0306919_11384104 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300031892|Ga0310893_10578723 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300031908|Ga0310900_10693943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 814 | Open in IMG/M |
| 3300031908|Ga0310900_10889543 | Not Available | 726 | Open in IMG/M |
| 3300031938|Ga0308175_101563390 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300031943|Ga0310885_10726575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 560 | Open in IMG/M |
| 3300031947|Ga0310909_10854965 | Not Available | 749 | Open in IMG/M |
| 3300031996|Ga0308176_11875884 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 640 | Open in IMG/M |
| 3300032000|Ga0310903_10639743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
| 3300032000|Ga0310903_10774374 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300032005|Ga0307411_11554751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 609 | Open in IMG/M |
| 3300032012|Ga0310902_10487955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 801 | Open in IMG/M |
| 3300032075|Ga0310890_11722934 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 520 | Open in IMG/M |
| 3300032179|Ga0310889_10079089 | Not Available | 1355 | Open in IMG/M |
| 3300032179|Ga0310889_10586640 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
| 3300032211|Ga0310896_10304283 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300032515|Ga0348332_10433525 | All Organisms → cellular organisms → Bacteria | 3801 | Open in IMG/M |
| 3300032892|Ga0335081_10752749 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1172 | Open in IMG/M |
| 3300032898|Ga0335072_10490337 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1278 | Open in IMG/M |
| 3300032955|Ga0335076_10852511 | Not Available | 793 | Open in IMG/M |
| 3300033412|Ga0310810_10244439 | All Organisms → cellular organisms → Bacteria | 1980 | Open in IMG/M |
| 3300033417|Ga0214471_10232505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 1510 | Open in IMG/M |
| 3300033432|Ga0326729_1070213 | Not Available | 534 | Open in IMG/M |
| 3300033486|Ga0316624_10560769 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 987 | Open in IMG/M |
| 3300033500|Ga0326730_1014244 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1711 | Open in IMG/M |
| 3300034090|Ga0326723_0456998 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300034116|Ga0335068_0547044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 529 | Open in IMG/M |
| 3300034151|Ga0364935_0039548 | Not Available | 1349 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 6.49% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.57% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 3.25% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 2.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.60% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.27% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.95% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.95% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.62% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.62% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.62% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.62% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.62% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.30% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.30% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.30% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.30% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.30% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.30% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.30% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.30% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.65% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.65% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.65% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.65% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.65% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.32% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.32% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.32% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.32% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.32% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.32% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.32% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.32% |
| Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 0.32% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.32% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.32% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.32% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.32% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.32% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.32% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.32% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.32% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.32% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.32% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.32% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.32% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.32% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.32% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.32% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.32% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.32% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.32% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.32% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.32% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.32% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.32% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.97% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.97% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.97% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.97% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.97% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2035918006 | Soil microbial communities from sample at FACE Site 1 Maryland Estuary CO2+ | Environmental | Open in IMG/M |
| 2124908009 | Soil microbial communities from sample at FACE Site Metagenome WIR_Amb2 | Environmental | Open in IMG/M |
| 2170459012 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO1O1 lysis Rhizosphere grass | Environmental | Open in IMG/M |
| 2170459016 | Litter degradation ZMR2 | Engineered | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000881 | Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001849 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM26, ROCA_DNA190_2.0um_MCP-N_C_2b | Environmental | Open in IMG/M |
| 3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300003991 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300004022 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300004024 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 | Environmental | Open in IMG/M |
| 3300004058 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007562 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02 | Environmental | Open in IMG/M |
| 3300007603 | Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009056 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009527 | Groundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Lower Cold Creek | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010412 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_10 | Environmental | Open in IMG/M |
| 3300012172 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT366_2 | Environmental | Open in IMG/M |
| 3300012173 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT517_2 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012514 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.old.130510 | Environmental | Open in IMG/M |
| 3300012891 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2 | Environmental | Open in IMG/M |
| 3300012893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1 | Environmental | Open in IMG/M |
| 3300012902 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013096 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014269 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D1 | Environmental | Open in IMG/M |
| 3300014307 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLA_D1 | Environmental | Open in IMG/M |
| 3300014321 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014881 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_1Da | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015256 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT333_16_10D | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300016737 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011506CT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017969 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018036 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018055 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coex | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018423 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019262 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101412AT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300020052 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011503CT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020184 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101409BT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300022906 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L223-509R-6 | Environmental | Open in IMG/M |
| 3300022917 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L154-409C-5 | Environmental | Open in IMG/M |
| 3300022934 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG | Environmental | Open in IMG/M |
| 3300023102 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S184-509B-5 | Environmental | Open in IMG/M |
| 3300024550 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024557 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025165 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1 | Environmental | Open in IMG/M |
| 3300025861 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC035_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Host-Associated | Open in IMG/M |
| 3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
| 3300033432 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF6AY SIP fraction | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| 3300033500 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF7AN SIP fraction | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| 3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
| 3300034151 | Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FACEMDE_1333920 | 2035918006 | Soil | DLVAVMSTYAVSGFYAIAVDEHMPAGQPTLERTAK |
| FWIRA_03716780 | 2124908009 | Soil | ELWGKRGTMDMVAAMNTYAVSGFFAIAVDEHSAEGKPELPAVK |
| N56_01010820 | 2170459012 | Grass Soil | MDMVAVMNTYAVSGYFAIAVDERSPEGKPQLPAVK |
| 2ZMR_00617250 | 2170459016 | Switchgrass, Maize And Mischanthus Litter | MDMVAAMTTYAVSGYFAIAVDEHAAEGKPELPAVK |
| ICChiseqgaiiDRAFT_03966601 | 3300000033 | Soil | MLHDNKMDSQTFAKAAQLFGRRGAMDLVAVMSTYAVSGFYAIAVDEHMPPGRQDLESAPRP* |
| ICChiseqgaiiDRAFT_05462892 | 3300000033 | Soil | RMSSDTFAKAAQLYGKKGALDLVAVMSTYAVSGFYAIAVDEHPAAGQPTLPK* |
| F14TC_1006159111 | 3300000559 | Soil | VVELFGQRGAMDIVAVMNTYAVSGFYAIAVDEHPPSGKPSLPSK* |
| JGI10215J12807_12909553 | 3300000881 | Soil | GRRGAMDVVAVMSTYAVSGLFAIAVDEHMPPGRADLEPAAR* |
| JGI10216J12902_1224875421 | 3300000956 | Soil | ISIPRISATFAKAVEQLGQRGAMDLVAVMNTHAVSGFYAIAVDEHAPANRPSLEPLK* |
| RCM26_11902941 | 3300001849 | Marine Plankton | TFKKAVHFWGKRGVMDMVAVMNTYAVSGYFAIAVDEQAAAGKTPLPAVK* |
| soilL1_100341531 | 3300003267 | Sugarcane Root And Bulk Soil | LFGEKGAMDLVAVMSTYAVSGFYATAVDEHMPAGRPDLERAARK* |
| soilL2_100719141 | 3300003319 | Sugarcane Root And Bulk Soil | TDKKVDSATFAKLSEIYGKKGAMDVVAVMITYADSGFYGIAVNEQPAAGKQPL* |
| Ga0055461_101934212 | 3300003991 | Natural And Restored Wetlands | AVIRFGRELLRDRKMSSATFAKAKEPYGAHGAMDLVAVMSTYAVSGFFAIAVDEHVEPRMPR* |
| Ga0055432_100294422 | 3300004022 | Natural And Restored Wetlands | FHDKEVESATFAKAVELWGKRGTMDMVAVMNTYAVSGHFAIAVHELSPEHAQR* |
| Ga0055436_102879212 | 3300004024 | Natural And Restored Wetlands | ATFAKVVELFGQRGAMDLVAVMNTYAVSGFYAIAVDEQPAAGKTALEPLK* |
| Ga0055498_101100743 | 3300004058 | Natural And Restored Wetlands | AKAKELYGAKGAMDLVAVMSTYAVSGFYAIAVDEHPAPGAKTLPK* |
| Ga0062593_1004553822 | 3300004114 | Soil | KVDSATFAKVAQLLGRRGAMDLVAVMNTYAVSGFYALAVDEHMPPGRADLR* |
| Ga0062590_1030126932 | 3300004157 | Soil | FGKKGAMDLVAVMSTYAVSGFYAIAVDEHMPPGRQDLESVPRQ* |
| Ga0062595_1000244793 | 3300004479 | Soil | AKATQLFGRRGAMDMVAVMSTYAVSGFFAIAADEHMPPGRPDFESVSR* |
| Ga0062591_1000177013 | 3300004643 | Soil | AVQLFGKKGAMDLVAVMSTYAVSGFYATAVDEHMPAGRPDLERPARQ* |
| Ga0062591_1010961592 | 3300004643 | Soil | RFGRQMLSDKKMDAATFARVAQLFGQRGAMDMVAVMNTYAVSGFYAIAVDEHMPPGRPDLR* |
| Ga0070670_1022251772 | 3300005331 | Switchgrass Rhizosphere | AKAKELYGDHGAMDLVAVMSTYAVSGFYAIAVDQHMPAGQPMLPPAH* |
| Ga0066388_1020585862 | 3300005332 | Tropical Forest Soil | DSATFAKAVQFFGQRGVMDLVAVMNTYAVSGFYAIAVDEQPAAGGRALPKSK* |
| Ga0070677_101190073 | 3300005333 | Miscanthus Rhizosphere | KVVELFGRKGAMDMVAVMNTYAVSGFYAIAVDERPPAGRPDLLAAPVR* |
| Ga0070666_101251045 | 3300005335 | Switchgrass Rhizosphere | LFGKKGAMDLVAVMSTYAVSGFYAIAVDEHMPPGRQDLESAPRQ* |
| Ga0070680_1000728344 | 3300005336 | Corn Rhizosphere | LNDRKMSSATFAKAKQLYGAKGAMDLVAVMSTYAVSGFYAIAVDEHAASGQPTLPK* |
| Ga0070680_1008775211 | 3300005336 | Corn Rhizosphere | FGRRGAMDMVAVMNTYAVSGFYAIAVDEHPAAGQPTLPPVAAH* |
| Ga0070682_1010878762 | 3300005337 | Corn Rhizosphere | TFAKVVELYGQRGAMDVVAVMNTYAVSGFYAIAVDEHPQAGKPALERTK* |
| Ga0070689_1002037101 | 3300005340 | Switchgrass Rhizosphere | VVELWGKRGAMDMVAVMNTYAVSGFFAIAVDEHAAEGKAALPAVK* |
| Ga0070689_1008162952 | 3300005340 | Switchgrass Rhizosphere | LFGKKGAMDLVAVMSTYAVSGFYATAVDEHMPAGRPDLERPAR* |
| Ga0070688_1005898521 | 3300005365 | Switchgrass Rhizosphere | VDSAVFAKAVELWGKRGTMDMVGVMNTYAVSGYFAIAVDERSPEGRPELPVIK* |
| Ga0070678_1009512091 | 3300005456 | Miscanthus Rhizosphere | KAAQLFGKKGAMDLVAVMSTYAVSGFYAIAVDEHMPPGRQDLESAPRQ* |
| Ga0070679_1019711372 | 3300005530 | Corn Rhizosphere | AKQLYGAKGAMDLVAVMSTYAVSGFYAIAVDEHAASGQPTLPK* |
| Ga0070684_1006787972 | 3300005535 | Corn Rhizosphere | DSATYAKVVELYGKKGAMDIVAVMITYADSGFYGIAVNEQPAPGKSPL* |
| Ga0070731_101026174 | 3300005538 | Surface Soil | MIDMVAAMNTYAVSGYFAIAVDEHSPEGKPELPPMK* |
| Ga0070731_102296082 | 3300005538 | Surface Soil | KAVELWGKRGTMDLVAVMNTYAVSGFFAIAVDEHTPEGKSELPAVK* |
| Ga0070686_1004140662 | 3300005544 | Switchgrass Rhizosphere | ATFAKVVELWGKRGAMDMVAVMNTYAVSGFFAIAVDEHAAEGKPELPAVK* |
| Ga0070686_1014956182 | 3300005544 | Switchgrass Rhizosphere | ATFAKVVELWGKRGAMDMVAVMNTYAVSGFFAIAVDEHPAEGKAALPAVK* |
| Ga0070686_1017028071 | 3300005544 | Switchgrass Rhizosphere | ATFAKAAQLFGKKGAMDLVAVMSTYAVSGFYAIAVDEHMPPGRQDLESAPRQ* |
| Ga0070693_1011886291 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | TFAKIVEVYGRRGAMDMVAVMNTYAVSGFYAIAVDEQPAPGKSPL* |
| Ga0070665_1020785451 | 3300005548 | Switchgrass Rhizosphere | MDMVAVMNTYAISGYFAIAVDERSPEGKPELPAVK* |
| Ga0070664_1008806091 | 3300005564 | Corn Rhizosphere | SQLFGKKGAMDLVAVMSTYAVSGFYAIAVDEHMPPGRQDLESAPRQ* |
| Ga0068854_1014233481 | 3300005578 | Corn Rhizosphere | QLYGAKGAMDLVAVMSTYAVSGFYAIAVDEHAAPGQPTLPK* |
| Ga0068856_1010700391 | 3300005614 | Corn Rhizosphere | WGKRGAMDMVAVMNTYAVSGYFAIAVDEHSPEGKPELPAIK* |
| Ga0068859_1027485621 | 3300005617 | Switchgrass Rhizosphere | YTDRKVDSATFAKIVELYGQRGAMDMVAVMNTYAVSGFYGIAVDEHAQAGKTSLRK* |
| Ga0068866_102395551 | 3300005718 | Miscanthus Rhizosphere | QLFHDNKMDAATFAKAVQLFGKKGAMDLVAVMSTYAVSGFYATAVDEHMPAGRPDLERAARP* |
| Ga0068861_1008734592 | 3300005719 | Switchgrass Rhizosphere | ATFAKAVELFGRRGAMDLVAVMNTYAASGFYAIAVNEQAAAGKPPL* |
| Ga0066903_1067239931 | 3300005764 | Tropical Forest Soil | KAVQLFGQRGVMDMVAVMNTYAVSGFYAIAVDEHAPAGKTALEPIKQK* |
| Ga0066903_1077509212 | 3300005764 | Tropical Forest Soil | FHDKKVDSATFGKAVELWGKRGTMDVVAVMNTYAVSGYFAIAVNERAPEGKVDLSAIK* |
| Ga0074470_106407753 | 3300005836 | Sediment (Intertidal) | RGAMDMVSAMSTYAVSGFFAIAVDEQPAAGAAALPK* |
| Ga0068870_101450241 | 3300005840 | Miscanthus Rhizosphere | RQMFRDKKMEPATFAKVVELFGRKGAMDMVAVMNTYAVSGFFAIAVDERAPEGRLDLLSSPIH* |
| Ga0068870_110478161 | 3300005840 | Miscanthus Rhizosphere | HGAMDLVAVMSTYAVSGFYAIAVDQHMPAGQPMLPPAH* |
| Ga0068863_1017192721 | 3300005841 | Switchgrass Rhizosphere | VELFGRRGAMDMVAVMSTYAVSGFFAIAVDERMPAGRPELVRVPQ* |
| Ga0068858_1009854021 | 3300005842 | Switchgrass Rhizosphere | KAVELFGRRGTMDMVAVMNTYAVSGFFAIAVDEHMPAGRPDLK* |
| Ga0068862_1000762081 | 3300005844 | Switchgrass Rhizosphere | KAVQLFGKKGAMDLVAVMSTYAVSGFYATAVDEHMPAGRPDLERGARP* |
| Ga0068862_1023332453 | 3300005844 | Switchgrass Rhizosphere | MDLVAVMSTYAVSGFYATAVDERMPSGRPDLERTPR* |
| Ga0075029_1011312691 | 3300006052 | Watersheds | DMVAVMSTYAVSGYFVIAVDERSPEGKPELPTVK* |
| Ga0070715_105785374 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | AKIVELFGKRGAMDMVAVMNTYAVSGFYAIAVDEQAAPGKPSF* |
| Ga0070765_1011570362 | 3300006176 | Soil | ELWGKRGAMDMVAAMNTYAVSGFFAIAVDEHSAEGKPELPAVK* |
| Ga0075422_100652894 | 3300006196 | Populus Rhizosphere | KGTMDLVAVMSTYAVSGFYAIAVDEHPAAGQKTLPPVAAH* |
| Ga0097621_1001162674 | 3300006237 | Miscanthus Rhizosphere | ATFAKAVQLFGRKGAMDMVAVMNTYAVSGFFAIAVDERAPEGRLDLLSSPIH* |
| Ga0068871_1000539321 | 3300006358 | Miscanthus Rhizosphere | AVELWGKRGTMDMVAVMNTYAVSGYFAIAVDERSPEGKPVLPAVK* |
| Ga0068871_1006804791 | 3300006358 | Miscanthus Rhizosphere | MDMVAVMNTYAVSGFFGIAVNEQAAVGKTSLEKK* |
| Ga0074050_114739941 | 3300006577 | Soil | ELFGRRGAMDMVAVMNTYAVSGFFAIAVDEHMPAGQPDLKPDLK* |
| Ga0079222_115177572 | 3300006755 | Agricultural Soil | TFAKAVALWGKRATMDMVAVMNTYAVSGFFAIAVDEHPAEGKPALPAVK* |
| Ga0075428_1001834841 | 3300006844 | Populus Rhizosphere | FAKAVELLTQRGVMDMVAVMNTYAVSGFYAIAVDEQPPVNKAGLERLNR* |
| Ga0075420_1014716642 | 3300006853 | Populus Rhizosphere | VGRRGAMDMVAVMNTYAVSGFYAVAVDEHMAPGRPDLQPLR* |
| Ga0075425_1023497412 | 3300006854 | Populus Rhizosphere | FAKAVEVLGKRGVMDMVAVMNTYAVSGFYAIAVDEHMPPGRPELTRAAR* |
| Ga0075425_1025669821 | 3300006854 | Populus Rhizosphere | QLFGQRGAMDLVAVMNTYAVSGFYAIAVDEQPAPGRPALERNK* |
| Ga0079217_114221292 | 3300006876 | Agricultural Soil | GRKGAMDMVAVMNTYAVSGFYAIAVDERAPEGRLDLLSSPVH* |
| Ga0075426_104173571 | 3300006903 | Populus Rhizosphere | LYGAKGTMDLVAVMSTYAVSGFYAIAVDEHAPAGKPSLPSLK* |
| Ga0075426_113148662 | 3300006903 | Populus Rhizosphere | SATFAKAVELFGQRGTMDLVAVMNTYAVSGFYAIAVDEHPPAGKPALERTK* |
| Ga0075436_1015401662 | 3300006914 | Populus Rhizosphere | LYTDRKVDSATFAKAVELLTQRGVMDMVAVMNTYAVSGFYAIAVDEQPPVNKAGLERLNR |
| Ga0079219_124609881 | 3300006954 | Agricultural Soil | KAVELLNQRGVMDMVAVMNTYAVSGFYAIAVDEHPPAGKTALETLK* |
| Ga0079218_120963482 | 3300007004 | Agricultural Soil | AAQLFGKKGAMDLVAVMSTYAVSGFYAIAVDEHMPPGRQDLESAPRQ* |
| Ga0102915_12790911 | 3300007562 | Estuarine | KGAMDLVAVMSTYAVSGFYAIAVDEHVPADKPQLPR* |
| Ga0102921_10812611 | 3300007603 | Estuarine | MSSATFAKAKQLFGDKGAMDLVAVMSTYAVSGFYAIAVDEHVPADKPQLPR* |
| Ga0105748_102338741 | 3300007992 | Estuary Water | RELLRDSKMSSATFAKGAMDLVAVMSTYAVSGFYAIAVDEHVPADQPQLPR* |
| Ga0066710_1047051721 | 3300009012 | Grasslands Soil | RRGAMDLVAVMNTYAASGFYAIAVNEQPAAGKPPL |
| Ga0105095_102929131 | 3300009053 | Freshwater Sediment | GKRGAMDLVAVMSTYAVSGFYAIAVDEHMPPGRPDLQPLKR* |
| Ga0102860_10760551 | 3300009056 | Estuarine | KMSSATFAKAKELFGDKGAMDLVAVMSTYAVSGFYAIAVDEHVPADQPQLPR* |
| Ga0111539_121622892 | 3300009094 | Populus Rhizosphere | VELFGRKGAMDMVAVMNTYAVSGFYAIAVDERAPEGRLDLLSAPVH* |
| Ga0111539_134294622 | 3300009094 | Populus Rhizosphere | VELLGQRGAMDLVAVMNTYAVSGFYAIAVDEQPAPGRTALERLK* |
| Ga0105245_120212512 | 3300009098 | Miscanthus Rhizosphere | DKKVDAATFAKAVQLWGKRGAMDMVAVMNTYAVSGFFAIAVDEHSGEGKPELPVAK* |
| Ga0075418_107688772 | 3300009100 | Populus Rhizosphere | VELLTQRGVMDMVAVMNTYAVSGFYAIAVDEQPPVNKAGLERLNR* |
| Ga0105247_109333371 | 3300009101 | Switchgrass Rhizosphere | TFAKAVELWGKRGTMDMVAAMNTYAVSGFFAIAVDEHSAQGKPELPPVK* |
| Ga0105243_105349432 | 3300009148 | Miscanthus Rhizosphere | HDNRMESETFAKAAQLFGKKGAMDLVAVMSTYAVSGFYATAVDERMPSGRPDLERTPR* |
| Ga0075423_100676085 | 3300009162 | Populus Rhizosphere | GDKGAMDLVAVMSTYAVSGFYAIAVDEHMPAGRPTLPR* |
| Ga0105242_104613091 | 3300009176 | Miscanthus Rhizosphere | LNDKKVDSATFAKVVELWGKRGAMDMVAVMNTYAVSGFFAIAVDEHPAEGKAALPAVK* |
| Ga0105242_119265032 | 3300009176 | Miscanthus Rhizosphere | LWGKRGAMDMVAVMNTYAVSGFFAIAVDEHAAEGKAALPAVK* |
| Ga0105242_125621981 | 3300009176 | Miscanthus Rhizosphere | ELFGQRGTIDLVAVMNTYAVSGFFAIAVDEHAPAGKPSF* |
| Ga0105242_131243521 | 3300009176 | Miscanthus Rhizosphere | MDSGTFAKAAQLFGKKGAMDLVAVMSTYAVSGFYAIAVDEHMPPGRQDLESAPRQ* |
| Ga0105248_102825363 | 3300009177 | Switchgrass Rhizosphere | DSATFAKVVELWGKRGAMDMVAVMNTYAVSGFFAIAVDEHPAEGKAALPAVK* |
| Ga0105248_123071042 | 3300009177 | Switchgrass Rhizosphere | ATFAKVVELWGKRGAMDMVAVMNTYAVSGFFAIAVDEHSAEGKPQLPATK* |
| Ga0114942_12847782 | 3300009527 | Groundwater | EMSSATFAKSVELFGERGAMDLVAVMMTYAVSGYYAIAVDEHPPGQTLLAPLP* |
| Ga0105249_128664171 | 3300009553 | Switchgrass Rhizosphere | FAKVVELWGKRGAMDMVAVMNTYAVSGFFAIAVDEHAAEGKAALPAAK* |
| Ga0126382_113731162 | 3300010047 | Tropical Forest Soil | VQFFGQRGVMDLVAVMNTYAVSGFYAIAVDEQPAAGQTGLQGTK* |
| Ga0126306_105537311 | 3300010166 | Serpentine Soil | TFAKVVELFGRKGAMDMVAVMNTYAVSGFYAIAVDERAPDGRLDLLSSPVH* |
| Ga0126376_107246501 | 3300010359 | Tropical Forest Soil | LLNDKKVDSAAFAKIVELWGKRGAMDMVAVMNTYAVSGFFAIAVDEHSAEGKPELPAVK* |
| Ga0126376_113460721 | 3300010359 | Tropical Forest Soil | QRGAMDILAIMNTYAVSGFYAIAVDEQPPAGKPPLGRAR* |
| Ga0126372_104180362 | 3300010360 | Tropical Forest Soil | TFAKIVELFGKRGAMDMVAVMNTYAVSGFFGIAVDEQAAPGKPSF* |
| Ga0126377_108805733 | 3300010362 | Tropical Forest Soil | DSATFAKAVQFFGQRGVTDLVAVMNTYAVSGFYAIAVDEQPAAGGRALPKSK* |
| Ga0126377_109160181 | 3300010362 | Tropical Forest Soil | TFAKASQLFGRRGAMDMVAVMSTYAVSGFFAIAVDEHMPPGRLDLESVTR* |
| Ga0134124_112172271 | 3300010397 | Terrestrial Soil | AMDLVAVMSTYAVSGFYATAVDEHMPAGRVDLDRPSRTQ* |
| Ga0126383_115586912 | 3300010398 | Tropical Forest Soil | GQRGVMDMVAVMNTYAVSGFYAIAVDEQPAPGKPALERSK* |
| Ga0126383_116195041 | 3300010398 | Tropical Forest Soil | ATFAKIVELYGKRGAMDMVAVMNTYAASGFFAIAVDEQPAPGKSPL* |
| Ga0134127_104801101 | 3300010399 | Terrestrial Soil | KMDSATFARAVELFGRRGAMDLVAVMTTYAASGFYAIAVNEQAAPGKPPL* |
| Ga0134122_109536951 | 3300010400 | Terrestrial Soil | VAKLYGNKGAMDVVAVMSTYAVSGFYAIAVDEHAPAGKTSLTK* |
| Ga0134121_100888781 | 3300010401 | Terrestrial Soil | KVVELWGKRGAMDMVAVMNTYAVSGFFAIAVDEHPAEGKPALPAVK* |
| Ga0136852_104704321 | 3300010412 | Mangrove Sediment | RSMRSGTFADAVRHFGEHGAMDLVAVMSTYAVSGFYAIAVNEHPPGEEILAPLAR* |
| Ga0137320_10838892 | 3300012172 | Soil | VELFGQHGAMDLVAVMSTYAVSGFYAIAVDEHMPAGQPTLH* |
| Ga0137327_10448661 | 3300012173 | Soil | TFAKAVELFGQRGTMDLVAVMNTYAVSGFYAIVVDEHPPAGKPALSQSK* |
| Ga0150985_1133451161 | 3300012212 | Avena Fatua Rhizosphere | VELWGKRGTMDMVAVMNTYAVSGYFAIAVDERSPEGRPELPAVK* |
| Ga0150985_1201952742 | 3300012212 | Avena Fatua Rhizosphere | YAKVVEAFGKRGAMDLVAVMITYADSGFYGIAVDEQPAQGKQPL* |
| Ga0137370_108588591 | 3300012285 | Vadose Zone Soil | MVAVMNTYAVSGFFAIAVDEHMPAGRPEFERVPR* |
| Ga0157330_10229942 | 3300012514 | Soil | AVMSTYAVSGFYATAVDEHMPAGRVDLDRPSRSQ* |
| Ga0157305_102941661 | 3300012891 | Soil | QMFRDKKMEPATFAKVVELFGRKGAMDMVAVMNTYAVSGFFAIAVDEHAPAGKPSF* |
| Ga0157284_100407982 | 3300012893 | Soil | GAMDIVAVMNTYAVSGFYAIAVDEQPAAGKPTLRSK* |
| Ga0157291_100760141 | 3300012902 | Soil | KMDSATFAKVKEFWGARGAMDMVAVMNTYAVSGFYAIAVDERAPAGRLDLLSAPVR* |
| Ga0157302_103557762 | 3300012915 | Soil | ATFAKAKELYGDHGAMDLVAVMSTYAVSGFYAIAVDEHMPAGQPMLPPAH* |
| Ga0126369_130787241 | 3300012971 | Tropical Forest Soil | GAMDLVAVMSTYAVSGFYAIAVDEHPPAGKPALPTLKK* |
| Ga0164308_117928882 | 3300012985 | Soil | SATFAKAVELWGKRGTMDMVAAMSTYAVSGFFAIAVDEHPAEGKPALPAVK* |
| Ga0164304_111748351 | 3300012986 | Soil | MDMVAVMNTYAISGYFAIAVDEHPAEGKPALPAVK* |
| Ga0157307_10217981 | 3300013096 | Soil | AQAAQLFGKKGAMDLVAVMSTYAVSGFYAIAVDEHMPPGRQDLESAPRQ* |
| Ga0157374_114647651 | 3300013296 | Miscanthus Rhizosphere | KRGTMDMVAAMNTYAVSGFFAIAVDEHSAEGKPELPAVK* |
| Ga0157378_110400291 | 3300013297 | Miscanthus Rhizosphere | SATFAKAVQLLGQRGVMDMVAVMNTYAVSGFFGIAVDEHAAAGKPQF* |
| Ga0163162_101348451 | 3300013306 | Switchgrass Rhizosphere | NDKKVDSATFAKVVELWGKRGAMDMVAVMNTYAVSGFFAIAVDEHAAEGKAALPAVK* |
| Ga0163162_123395751 | 3300013306 | Switchgrass Rhizosphere | KIVELYGQRGAMDMVAVMNTYAVSGFFGIAVNEQAAVGKTSLEKK* |
| Ga0075302_10829742 | 3300014269 | Natural And Restored Wetlands | RKMSSATFAKAKELYGDHGAMDLVAVMGTYAVSGFFAIAVDEHAPPGKPSF* |
| Ga0075304_10172461 | 3300014307 | Natural And Restored Wetlands | HFGEHGAMDLVAVMSTYAVSGFYAIAVDEHPPGAELLEPIAH* |
| Ga0075353_11526281 | 3300014321 | Natural And Restored Wetlands | KGALDVVAVMSTYAVSGFYAIAVDEHAPAGKSSLPSLSK* |
| Ga0163163_105252041 | 3300014325 | Switchgrass Rhizosphere | TFGKAVQLFGKKGAMDLVAVMSTYAVSGFYATAVDEHMPAGRPDLERGARP* |
| Ga0163163_115711621 | 3300014325 | Switchgrass Rhizosphere | TFAKAVELFGRRGTMDMVAVMNTYAVSGLFAIAVDEHMPAGRPDLK* |
| Ga0163163_131033002 | 3300014325 | Switchgrass Rhizosphere | REMFRDKKMAPATFAKAVGLFGRKGTMDMVAVMNTYAVSGFYAIAVDERAPAGRLDLLSAPVR* |
| Ga0157380_102479511 | 3300014326 | Switchgrass Rhizosphere | TFAKAKQLFGDKGAMDLVAVMSTYAVRGFYAIAVDEHPAAGQPTLPTVAAH* |
| Ga0157377_106993752 | 3300014745 | Miscanthus Rhizosphere | MDIVAVMNTYAVSGFYAIAVDEQPQAGKPTLRSK* |
| Ga0180094_10376461 | 3300014881 | Soil | MDLVAVMMTYAVSGFYAIAVDEHPPGQTLLEPLP* |
| Ga0157376_120665761 | 3300014969 | Miscanthus Rhizosphere | TFAKVVEAFGRNGAMNVVAVMNTYAVSGFYAIAVDERAAAGKLDLASK* |
| Ga0173480_112103721 | 3300015200 | Soil | TFAKAKELYGDHGAMDLVAVMSTYAVSGFYAIAVDQHMPAGQPMLPPAH* |
| Ga0180073_10952741 | 3300015256 | Soil | FGRELLDDRTMNSATFAKAKQLFGDKGAMDLVAVMSTYAVSGFYAIAVDEHMPAGRPDL* |
| Ga0132258_126592141 | 3300015371 | Arabidopsis Rhizosphere | RELIGDRKMSSATFAKAVHLYGKNGAMDLVAVMSTYAVSGFYAIAVDEHPPAGKPALPALKK* |
| Ga0132258_137944471 | 3300015371 | Arabidopsis Rhizosphere | KMVQLFGQRGAMNVVAVMNTYAVSGFYALAVDEHMPPGRPDLR* |
| Ga0132257_1004731853 | 3300015373 | Arabidopsis Rhizosphere | KLDSATFAKAVELLTQRSVMDMVAVMNTYAVSGFYAIAVDEQPPANKAGLERLNR* |
| Ga0132257_1010998332 | 3300015373 | Arabidopsis Rhizosphere | FGRRGAMDMVAVMNTYAVSGFFAIAVDEHMPPGRADLH* |
| Ga0132257_1039156421 | 3300015373 | Arabidopsis Rhizosphere | MDSATFAKVVELFGRRGAMDMVAVMNTYAVSGFFAIAVDEHSAPGRAEF* |
| Ga0132255_1005557351 | 3300015374 | Arabidopsis Rhizosphere | KKVDSATFAKVVELYGQRGAMDIVAVMNTYAVSGFYGIAVDEQAAAGKTPLEPLKK* |
| Ga0132255_1032716922 | 3300015374 | Arabidopsis Rhizosphere | MYSDRKIDSATFAKAVEQLGQRGVMDLVTVMDTYAVSGFYAIAVDERAPA |
| Ga0182033_114468532 | 3300016319 | Soil | PTFAKAVELFGQRGVMDIVAVMNTYAVSGFYAIAVDEHPAAGKPALERLK |
| Ga0182040_119795751 | 3300016387 | Soil | AVEFFGQRGVMDMVALMNTYAVSGFYAIAVDEHPPAGRPALERTK |
| Ga0182039_114022711 | 3300016422 | Soil | MDIVAVMNTYAVSGFYGIAVDEQAAAGKTPLERLK |
| Ga0182038_101211442 | 3300016445 | Soil | MDMVAVMNTYAVSGYFAIAVDERSPEGRPELPAAK |
| Ga0182038_119004691 | 3300016445 | Soil | RQLFTDKKVDRATFAKIVDFYGKRGAMDLVAVMNTYAVSGFYAIAVDEQAGAGKPAL |
| Ga0182047_14740412 | 3300016737 | Salt Marsh | FANVQELFGDAGAMDLVAIMVTYIASGYYAIAVDEHMANGQNLE |
| Ga0163161_100470574 | 3300017792 | Switchgrass Rhizosphere | RGAMDMVAVMNTYAVSGFFGIAVNEQAAVGKTSLEKK |
| Ga0163161_117718552 | 3300017792 | Switchgrass Rhizosphere | SAAFAKAVQLFGKKGAMDLVAVMSTYAVSGFYATAVDEHMPAGRPDLERPARP |
| Ga0187824_103740581 | 3300017927 | Freshwater Sediment | KKVDSTTFAKIAELWGKRGAMDMVAVMNTYAVSGFFAIAVDEHSAEGKPELPAVK |
| Ga0187821_103693871 | 3300017936 | Freshwater Sediment | WGKRGAMDMVAAMSTYAVSGFFAIAVDEHAAEGKPELPAVK |
| Ga0187817_101272081 | 3300017955 | Freshwater Sediment | GKRGAMDMVAAMNTYAVSGFFAIAVDEHAAEGKPELPPVK |
| Ga0190266_100883462 | 3300017965 | Soil | MSSSKFKKAKQLLGDKGAMDLVAVMSTYAVSGFYAIAVDEHPAAGQPTLPPVAPH |
| Ga0190266_110727562 | 3300017965 | Soil | TFAKAVEAFGRRGAMDLVAVMTTYAASGFYAIAVDEHMPPGRPDLTPVN |
| Ga0187776_104807352 | 3300017966 | Tropical Peatland | AMDLVAVMSTYAVSGFYAIAVDEHMPAGKPTLPPLAK |
| Ga0181585_100897341 | 3300017969 | Salt Marsh | KDRKVDSATFANVQELFGDAGAMDLVAIMVTYIASGFYAIAVDEHMANGQNLE |
| Ga0181600_101552001 | 3300018036 | Salt Marsh | RKVDSATFANVQELFGDDGAMDLVAIMVTYIASGYYAIAVDEHMANGQNLE |
| Ga0184616_100641891 | 3300018055 | Groundwater Sediment | AVEAFGRRGAMDLVAVMTTYAASGFYAIAVDEHMPPGRPDLTPVN |
| Ga0184624_101272772 | 3300018073 | Groundwater Sediment | GAMDLVAVMSTYAVSGFYAIAVDEHMPAGQPMLPPAH |
| Ga0181553_100178921 | 3300018416 | Salt Marsh | AVDSVTFAKAVDYFGKKGVMDIVAVMNTYAVSGFFAATVDERVPADEIDLK |
| Ga0181593_100242821 | 3300018423 | Salt Marsh | KKGVMDIVAVMNTYAVSGFFAATVDERVPADEIDLK |
| Ga0190275_127527081 | 3300018432 | Soil | KMSSATFAKAKELCGAKGTMDLVAVMSTYAVSGFYAIAVDEHMAPGQPMLPAMAAH |
| Ga0190270_100830651 | 3300018469 | Soil | GTMDLVAVMNTYAVSGFYAIAVDERAPAGRLDLLSAPVH |
| Ga0190274_123599732 | 3300018476 | Soil | FRDKKMEPATFAKVVELFGRKGAMDMVAVMNTYAVSGFFAIAVDERAPEGRLDLLSSPIH |
| Ga0190274_128975971 | 3300018476 | Soil | VELFGKKGAMDMVAVMVTYAASGFYAIAVDEHMPAGRPDLIPVN |
| Ga0190274_138162801 | 3300018476 | Soil | TFAKAVQLFGKKGAMDLVAVMSTYAVSGFYAIAVDEHMPPGRQDLESAPRQ |
| Ga0190271_112323101 | 3300018481 | Soil | LFGRKGAMDMVAVMNTYAVSGFYAIAVDERPPAGRLDLLAAPVR |
| Ga0190271_133996151 | 3300018481 | Soil | GAMDMVAVMNTYAVSGFYAIAVDERPPAGRPDLLAAPVR |
| Ga0182066_16629791 | 3300019262 | Salt Marsh | LFGDAGAMDLVAIMVTYIASGFYAIAVDEHMANGQNLE |
| Ga0173482_105205962 | 3300019361 | Soil | GRKGTMDLVAVMNTYAVSGFYAIAVDERAPAGRLDLLSAPVR |
| Ga0173479_101907441 | 3300019362 | Soil | TFAKAAQLFGKKGAMDLVAVMSTYAVSGFYAIAVDEHMPPGRQDLESAPRQ |
| Ga0181554_12561852 | 3300020052 | Salt Marsh | VDSVTFAKAVDYFGKKGVMDIVAVMNTYAVSGFFAATVDERVPADEIDLK |
| Ga0181573_1000697110 | 3300020184 | Salt Marsh | VDSATFANVQELFGDAGAMDLVAIMVTYIASGYYAIAVDEHMANGQNLE |
| Ga0210401_101953722 | 3300020583 | Soil | TTFAKAVELWGKRGAMDMVAVMSTYAVSGYFAIAVDERSPEGKPELPPLK |
| Ga0210408_112497841 | 3300021178 | Soil | ATFAKAVELWGKRGTMDMVAAMNTYAVSGFFAIAVDEHSAEGKPELPAVK |
| Ga0210388_100829471 | 3300021181 | Soil | MDMVAAMSTYAVSGFFAIAVDERSPEGKPELPPLK |
| Ga0213876_101780901 | 3300021384 | Plant Roots | FAKVQEIYGKKGAMDIVAVMITYADSGFYGIAVNEQPAAGKKPL |
| Ga0210389_105894431 | 3300021404 | Soil | AVDMVSVMTTYAVSGYFAIAVDERSPEGKPELPAVK |
| Ga0210389_107219811 | 3300021404 | Soil | DSATFSKAVEFWSKRGAMDMVSVMTTYAVSGYFAIAVDERSPEGKPELPPIK |
| Ga0210386_114449801 | 3300021406 | Soil | TFAKAVELWGKRGAMDMVAVMSTYAVSGYFAIAVDERSPEGKPELPAIK |
| Ga0210391_106802951 | 3300021433 | Soil | KAVDLWGKRGTMDMVAVMNTYAVSGYFAIAVNEQSPEGKPELPGVK |
| Ga0210398_101614734 | 3300021477 | Soil | ATFAKSVDPWGKRGTMDMVAAMNTYAVSGYFAIAVDEHSPEGKPELPPTK |
| Ga0222622_106975422 | 3300022756 | Groundwater Sediment | KELYGDHGAMDLVAVMSTYAVSGFYAIAVDQHMPAGQPMLPPAH |
| Ga0247766_10254323 | 3300022906 | Plant Litter | TFAKAVELFGRKGTMDLVAVMNTYAVSGFYAIAVDERAPAGRLDLLSAPVR |
| Ga0247777_12873562 | 3300022917 | Plant Litter | EKGTMDLVAVMSTYAVSGFYAIAVDEHAPAGKPSF |
| Ga0255781_101874992 | 3300022934 | Salt Marsh | GKAVDYFGKKGVMDIVAVMNTYAVSGFFAATVDERVPADEIDLK |
| Ga0247754_11782961 | 3300023102 | Soil | ATFAKAVELFGRKGTMDLVAVMNTYAVSGFYAIAVDERAPAGRLDLLSAPVR |
| Ga0255266_11141802 | 3300024550 | Freshwater | AAAKQLFGAAGTMDLVAVMNTYAVSGFFAIAVDEQPAEGSVALP |
| Ga0255283_10867981 | 3300024557 | Freshwater | FGHELFDDRKVSAATFAAAKQLFGAAGTMDLVAVMNTYAVSGFFAIAVDEQPAEGSVALP |
| Ga0209108_105630262 | 3300025165 | Soil | ELLDDRKMSSATFAKAKQLFGDKGAMDLVAVMSTYAVSGFYAIAVDEHLPAGQPTLPR |
| Ga0209605_12596111 | 3300025861 | Anaerobic Digestor Sludge | GATGAMDIVAVMSTYAVSGFYAIAVDEHPGGKKLEPLPRH |
| Ga0207710_104834351 | 3300025900 | Switchgrass Rhizosphere | RGTMDMVAAMNTYAVSGFFAIAVDEHSAQGKPELPPVK |
| Ga0207688_104468741 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | LVAVMSTYAVSGFYAIAVDEHMPPGRQDLESAPRQ |
| Ga0207680_105739331 | 3300025903 | Switchgrass Rhizosphere | AKVAELFGKKGAMDMAAVMNTYAVSGFFAIAVDERAPEGRTDLLSSPIH |
| Ga0207680_110081921 | 3300025903 | Switchgrass Rhizosphere | AKAVELWGKRGTMDMVAVMNTYAVSGYFAIAVDERSPEGKPELPAVK |
| Ga0207680_113788251 | 3300025903 | Switchgrass Rhizosphere | GKNGAMDLVAVMSTYAVSGFYAIAVDEHPPAGKPALPALKK |
| Ga0207645_104620231 | 3300025907 | Miscanthus Rhizosphere | VELWGKRGAMDMVAVMNTYAVSGFFAIAVDEQAAEGKTALPAAK |
| Ga0207705_108203111 | 3300025909 | Corn Rhizosphere | GTMDMVAVMNTYAVSGYFAIAVDERSPEGKPELPAVK |
| Ga0207654_102095322 | 3300025911 | Corn Rhizosphere | AKAVELWSKRGTMDMVAVMNTYAVSGYFAIAVDEHSPEGKPELPAVK |
| Ga0207654_111816202 | 3300025911 | Corn Rhizosphere | NDKKVDSATFAKVVELWGKRGAMDMVAVMNTYAVSGFFAIAVDERSAEGRPELPAVK |
| Ga0207660_105559352 | 3300025917 | Corn Rhizosphere | RQLFHDNKMDAATFAKAVQLFGKKGAMDLVAVMSTYAVSGFYATAVDEHMPAGRPDLERAARP |
| Ga0207662_112064581 | 3300025918 | Switchgrass Rhizosphere | KVDSATFAKVVELWGKRGAMDMVAVMNTYAVSGFFAIAVDEHAAEGKAALPAVK |
| Ga0207662_113274891 | 3300025918 | Switchgrass Rhizosphere | TFAKIVELYGQRGAMDIVAVMNTYAVSGFYAIAVDEQPAAGKPTLRSK |
| Ga0207649_114490662 | 3300025920 | Corn Rhizosphere | GKRGAMDMVAAMNTYAVSGFFAIAVDEHSAEGKPELPAVK |
| Ga0207681_102659193 | 3300025923 | Switchgrass Rhizosphere | AKATQLFGRRGAMDMVAVMSTYAVSGFFAIAADEHMPPGRPDLESVNR |
| Ga0207681_108011921 | 3300025923 | Switchgrass Rhizosphere | SAVFAEAVELWGKRGTMDMVAVMNTYAVSGYFAIAVDERSPEGRPELPMIK |
| Ga0207650_103092931 | 3300025925 | Switchgrass Rhizosphere | DRKMSSATFAKAVQLYGKNGAMDLVAVMSTYAVSGFYAIAVDEHPPAGTPSLPRLGK |
| Ga0207687_101608672 | 3300025927 | Miscanthus Rhizosphere | TFAKAVQLYGKNGAMDLVAVMSTYAVSGFYAIAVDEHPPAGKPSLPRLGK |
| Ga0207687_111824922 | 3300025927 | Miscanthus Rhizosphere | RELIGDRKMSSATFAKAEQLYGKNGAMDLVAVMSTYAVSGFYAIAVDEHPPAGKPALPALKK |
| Ga0207700_116897871 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | AKAVQLFGQRGTMDILAIMNTYAVSGFYAIAVDEQPAAGKSPLGRAK |
| Ga0207664_109308693 | 3300025929 | Agricultural Soil | TMDILAIMNTYAVSGFYAIAVDEQPAAGKSPLGRAK |
| Ga0207644_101981994 | 3300025931 | Switchgrass Rhizosphere | GRKGAMDMVAVMNTYAVSGFYAIAVDEHMPPGRQDLR |
| Ga0207706_101947571 | 3300025933 | Corn Rhizosphere | KKGAMDLVAVMSTYAVSGFYAIAVDEHMPPGRQDLESAPRQ |
| Ga0207670_100190065 | 3300025936 | Switchgrass Rhizosphere | GRQMFRDKKMEPATFAKVAELFGKKGAMDMVAVMNTYAVSGFFAIAVDERAPEGRLDLLSSPIH |
| Ga0207670_103534823 | 3300025936 | Switchgrass Rhizosphere | ATFAKASQLFGKKGAMDLVAVMSTYAVSGFYAIAVDEHMPPGRQDLESAPRQ |
| Ga0207669_119180941 | 3300025937 | Miscanthus Rhizosphere | TFAKAVELFGRKGTMDLVAVMNTYAVSGFFAIAVDERAAAGRLDLLSSPVH |
| Ga0207704_112110641 | 3300025938 | Miscanthus Rhizosphere | AKVVELWGKRGAMDMVAVMNTYAVSGFFAIAVDEHAAEGKAALPAAK |
| Ga0207691_100735931 | 3300025940 | Miscanthus Rhizosphere | AMDMVAVMNTYAVSGFFAIAVDERAPEGRLDLLSSPIH |
| Ga0207691_113918751 | 3300025940 | Miscanthus Rhizosphere | AKAVELWGKRGTMDMVAVMNTYAVSGYFAIAVDERSPEGRPELPVIK |
| Ga0207679_102992751 | 3300025945 | Corn Rhizosphere | KKVDSATVEKVVELWGKRGAMDIVAVMNTYAVSGFFAIAVDEHAAEGKAALPAVK |
| Ga0207651_104360091 | 3300025960 | Switchgrass Rhizosphere | GAMDLVAVMSTYAVSGFYAIAVDEHMPPGRQDLESAPRQ |
| Ga0207651_104592892 | 3300025960 | Switchgrass Rhizosphere | MDLVAVMSTYAVSGFYATAVDEHMPAGRPDLERAARP |
| Ga0207651_111340782 | 3300025960 | Switchgrass Rhizosphere | ATFAKAVELFGRRGTMDMVAVMNTYAVSGFFAIAVDEHMPAGQSDLK |
| Ga0207668_106667471 | 3300025972 | Switchgrass Rhizosphere | DMVAVMNTYAVSGFFAIAVDERAPDGRLDLLSSPIR |
| Ga0207658_118395012 | 3300025986 | Switchgrass Rhizosphere | FAKVAELFGKKGAMDMVAVMNTYAVSGFFAIAVDERAPEGRLDLLSSPIH |
| Ga0207677_112777692 | 3300026023 | Miscanthus Rhizosphere | AKVVELWGKRGAMDMVAVMNTYAVSGYFAIAVDERSPEGKPELPAVK |
| Ga0207703_103240802 | 3300026035 | Switchgrass Rhizosphere | TFAKAVELFGRRGVMDMVAVMSTYAVSGFFAIAVDEHLPAGRPELVTR |
| Ga0207639_106019932 | 3300026041 | Corn Rhizosphere | FAKVVELWGKRGAMDMVAVMNTYAVSGFFAIAVDERSAEGRPELPAVK |
| Ga0207678_100170388 | 3300026067 | Corn Rhizosphere | LFGKKGAMDMVALMNTYAVSGFFAIAVDERAPEGRLDLLSSPVH |
| Ga0207708_102088372 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MEPATFAKVVELFGRKGAMDMVAVMNTYAVSGFFAIAVDERAPEGRLDLLSSPVH |
| Ga0207708_114543062 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MDLVAVMSTYAVSGFYAIAVDEHMPPGRQDLESAPRQ |
| Ga0207702_102589711 | 3300026078 | Corn Rhizosphere | AMDMVAVMNTYAVSGFFAIAVDEHSGEGKPELPVAK |
| Ga0207702_124939402 | 3300026078 | Corn Rhizosphere | TFAKAVELWGKRGAMDMVAVMNTYAVSGYFAIAVDEHSPEGKPELPAIK |
| Ga0207641_121575272 | 3300026088 | Switchgrass Rhizosphere | QRGVMDMVAVMNTYAVSGFYGIAVDEQAAAGKTPLEKIK |
| Ga0207641_122984761 | 3300026088 | Switchgrass Rhizosphere | KAVELWGKRGTMDMVAVMNTYAISGFFAIAVDEHAAEGKAALPAVK |
| Ga0207648_113657051 | 3300026089 | Miscanthus Rhizosphere | SATFAKVVELWGKRGAMDMVAVMNTYAVSGFFAIAVDEQAAEGKTALPAAK |
| Ga0207648_118141112 | 3300026089 | Miscanthus Rhizosphere | RFGRQMLTDKKMDAATFAKAAQLFGRKGAMDLVAVMNTYAVSGFYAIAVDERMPPGRQDL |
| Ga0207676_119345441 | 3300026095 | Switchgrass Rhizosphere | AMDMAAVMNTYAVSGFFAIAVDERAPEGRTDLLSSPIH |
| Ga0207675_1001943803 | 3300026118 | Switchgrass Rhizosphere | GVMDMVAVMNTYAVSGFYAIAVDEHMPPGRPELARPAR |
| Ga0209996_10597791 | 3300027395 | Arabidopsis Thaliana Rhizosphere | AKGAMDLVAVMSTYAVSGFYAIAVDEHAAPGQPTLPR |
| Ga0209074_101788091 | 3300027787 | Agricultural Soil | LWGKRGAMDIVAVMSTYAVSGFFAIAVDEHPAEGKAELPAVK |
| Ga0209579_102495611 | 3300027869 | Surface Soil | MIDMVAAMNTYAVSGYFAIAVDEHSPEGKPELPPMK |
| Ga0209465_105269981 | 3300027874 | Tropical Forest Soil | VFTDKKVSPDAFAKVVEFYGKRGAMDLVAVMVTYADSGFYGIAVDEQPAAGKSPL |
| Ga0209481_100108191 | 3300027880 | Populus Rhizosphere | KMDPQTFAKAAQLFGRRGAMDLVAVMSTYAVSGFYATAVDEHMPPGRPDLDR |
| Ga0209481_101936314 | 3300027880 | Populus Rhizosphere | TMDLVAVMSTYAVSGFYAIAVDEHPAAGQKTLPPVAAH |
| Ga0209275_103240711 | 3300027884 | Soil | RGTMDMVAVMSAYAVSGYFAIAVDERSPEGKPELPAVK |
| Ga0209275_107946691 | 3300027884 | Soil | RGTMDMVAVMSTYAVSGYFAIAVDERSPEGKPELPAVK |
| Ga0209624_102466401 | 3300027895 | Forest Soil | ATFAKAVEFWGKPGTMDIVSVMATYAVSGYFAIAVDERSAEGKPELPLVK |
| Ga0209415_109018231 | 3300027905 | Peatlands Soil | KAVDLWGKRGTMDMVAAMNTYAVSGYFAIAVDEHSPEGKPELPPMK |
| Ga0207428_102935181 | 3300027907 | Populus Rhizosphere | FAKAKELYGAKGTMDLVAVMSTYAVSGFYAIAVDEHPAAGQKTLPPVAAH |
| Ga0268265_107661581 | 3300028380 | Switchgrass Rhizosphere | MDMVAVMNTYAVSGFYAIAVDERAPEGRLDLLSSPVH |
| Ga0268265_110392131 | 3300028380 | Switchgrass Rhizosphere | MDLVAVMSTYAVSGFYATAVDERMPSGRPDLERTPR |
| Ga0268264_113928631 | 3300028381 | Switchgrass Rhizosphere | FRDKKMEPATFAKVVELFGRKGAMDMVAVMNTYAVSGFFAIAVDERAPEGRTDLLSSPVH |
| Ga0307281_102947432 | 3300028803 | Soil | KAVGLFGQHGAMDLVAVMSTYAISGFYAIAVDEHMPTGQPMLEPRAK |
| Ga0308309_102845852 | 3300028906 | Soil | FAKVAELWGKRGAMDMVAAMNTYAVSGFFAIAVDEHSAEGKPELPAVK |
| Ga0302179_100344023 | 3300030058 | Palsa | WGKRGAMDMVAVMTTYAVSGYFAIAVDERSPEGKPELPPVK |
| Ga0311353_111209323 | 3300030399 | Palsa | KRGTMDMVAVMNTYAVSGYFAIAVNERSPEGKPELPAVK |
| Ga0311354_117965712 | 3300030618 | Palsa | KRGTMDMVAVMNTYAVSGYFAIAVNERSPEGKPELPAMK |
| Ga0307497_106371291 | 3300031226 | Soil | FGRKGAMDMAAVMNTYAVSGFFAIAVDERAPEGRLDLLSSPIH |
| Ga0170824_1175969122 | 3300031231 | Forest Soil | ATFAKIVELFGKRGAMDMVAVMNTYAVSGFFGIAVDEHAAPGKPSF |
| Ga0265332_101719572 | 3300031238 | Rhizosphere | SATFAKAVEFFGKRGAMDMVAVMNTYAVSGFFAIAVDEHAAAGKPPL |
| Ga0307505_103118541 | 3300031455 | Soil | AKQLFGDKGAMDLVAVMSTYAVSGFYAIAVDEHLPAGQSTLPR |
| Ga0310888_103560771 | 3300031538 | Soil | KAVQLFGKKGAMDLVAVMSTYAVSGFYATAVDEHMPAGRPDLERAARP |
| Ga0310888_105333012 | 3300031538 | Soil | AKAKELYGAKGTMDLVAVMSTYAVSGFYAIAVDEHPAAGQPTLPPVAAH |
| Ga0318538_102772901 | 3300031546 | Soil | KKVDSATFAKVVEFYGKRGAMDMVAVMNTYAVSGFYGIAVDEHAAPGKPSL |
| Ga0318572_109060792 | 3300031681 | Soil | GKKGAMDLVAVMSTYAVSGFYAIAVDEHPPAGKSALPTLKK |
| Ga0310686_1028166411 | 3300031708 | Soil | RGTMDMVAVMSAYVVSGYFAIAVDERSPEGKPELPPVK |
| Ga0310686_1161082652 | 3300031708 | Soil | MFHDRKVDSSTFAKAVELWSKRGTMDMVAVMSTYAVSGYFAIAVDERSPDGKPELPPVK |
| Ga0307468_1022347792 | 3300031740 | Hardwood Forest Soil | FTDKKVDSATYAKIVEIYGKKGAMDLVAVMITYADSGFYGIAVNEQPAPGKPAL |
| Ga0310907_104256382 | 3300031847 | Soil | VGQRGAMDIVAVMNTYAVSGFYAIAVDEQPPAGKPALEQSK |
| Ga0310907_107020341 | 3300031847 | Soil | GAMDLVAVMSTYAVSGFYATAVDEHMPAGRPDLERAARP |
| Ga0310904_114024531 | 3300031854 | Soil | FGPRGAMDMVAVMNTYAVSGFYAIAVDEHMAPGRPDLR |
| Ga0310892_100474762 | 3300031858 | Soil | LFGKKGAMDLVAVMSTYAVSGFYATAVDEHMPAGRPDLERPARQ |
| Ga0310892_102220472 | 3300031858 | Soil | LFHDNRMDTATFGKAVQLFGKKGAMDLVAVMSTYAVSGFYATAVDEHMPAGRPDLERGAR |
| Ga0306919_113841042 | 3300031879 | Soil | VEFYGKRGAMDMVAVMNTYAVSGFYGIAVDEHAAPGKPSL |
| Ga0310893_105787231 | 3300031892 | Soil | TFAKAKELYGAKGTMDLVAVMSTYAVSGFYAIAVDEHPAAGQPTLPPVAAH |
| Ga0310900_106939432 | 3300031908 | Soil | NDRKVSSATFAKAKELYGAKGTMDLVAVMSTYAVSGFYAIAVDEHPAAGQPTLPPVAAH |
| Ga0310900_108895431 | 3300031908 | Soil | ELFGRKGAMDMVAVMNTYAVSGFYAIAVDERAPEGRLDLLSAPVH |
| Ga0308175_1015633901 | 3300031938 | Soil | ATFAKAVQFWGKRGTMDMVAAMNTYAVSGFFAIAVDEHAAEGKAELPGVK |
| Ga0310885_107265752 | 3300031943 | Soil | ATFAKVVELFGQRGAMDIVAVMNTYAVSGFYAIAVDEQPPAGKPALEQSK |
| Ga0310909_108549651 | 3300031947 | Soil | YGKNGAMDLVAVMSTYAVSGFYAIAVDEHPPAGKPALPMLKK |
| Ga0308176_118758841 | 3300031996 | Soil | KKVVDLFGRRGAMDIVAVMNTYAVSGFYALAVDEHMPAGRPDLQRVSE |
| Ga0310903_106397431 | 3300032000 | Soil | RRGAMDLVAVMNTYAVSGFYALAVDEHMPPGRADLR |
| Ga0310903_107743742 | 3300032000 | Soil | MDLVAVMSTYAVSGFYATAVDEHMPAGRPDLERPARQ |
| Ga0307411_115547511 | 3300032005 | Rhizosphere | FGRQMFRDKKMEPATFAKVVELFGRKGAMDMVAVMNTYAVSGFYAIAVDERAPEGRPDLLSSPVH |
| Ga0310902_104879553 | 3300032012 | Soil | ELLNDRKMSSATFATAKQLYGAKGAMDLVAVMSTYAVSGFYAIAVDEHAAPGQPTLPK |
| Ga0310890_117229343 | 3300032075 | Soil | DRKVSSATFAKAKELYGAKGTMDLVAVMSTYAVSGFYAIAVDEHPAAGQPTLPK |
| Ga0310889_100790892 | 3300032179 | Soil | QLFHDNKMDAATFAKAVQLFGKKGAMDLVAVMSTYAVSGFYATAVDEHMPAGRPDLERAARP |
| Ga0310889_105866401 | 3300032179 | Soil | QMFGDKKTDAATFAAVKQFFGPRGAMDMVAVMNTYAVSGFYAIAVDERMPPGRPDLKP |
| Ga0310896_103042831 | 3300032211 | Soil | HDNKMDAATFAKAVQLFGKKGAMDLVAVMSTYAVSGFYATAVDEHMPAGRPDLERGARP |
| Ga0348332_104335251 | 3300032515 | Plant Litter | VEFWGKRGTMDMVAVMSAYVVSGYFAIAVDERSPEGKPELPPVK |
| Ga0335081_107527491 | 3300032892 | Soil | KRGTMDMVAVMTTYAVSGYFAIAVDERTPEGRPELPPVK |
| Ga0335072_104903372 | 3300032898 | Soil | FWGKRGTMDLVAVMTTYAVSGYFAIAVDERSAEGKPELPPVK |
| Ga0335076_108525111 | 3300032955 | Soil | SATFAKAVQLYGKNGAMDLVAVMSTYAVSGFYAIAVDEHPPAGKPALPALKK |
| Ga0310810_102444393 | 3300033412 | Soil | SATFAKAVALFGKQGAMDLVAVMSTYAVSGFYAIAVDEHMPAGRADLERVRQ |
| Ga0214471_102325051 | 3300033417 | Soil | FGQRGAMDLVAVMNTYAVSGFYAIAVDEHAQAGKPTLKR |
| Ga0326729_10702131 | 3300033432 | Peat Soil | DTFAKVAKLYGNKGAMDVVAVMSTYAVSGFFAVAVDEHAPAGKPSLPSLTK |
| Ga0316624_105607691 | 3300033486 | Soil | FAKAVELWGKRGTMDMVAVMNTYAVSGYFAIAVDERSPEGKPELPAVK |
| Ga0326730_10142443 | 3300033500 | Peat Soil | ATFAKAVQLYGKNGAMDLVAVMSTYAVSGFYAIAVDEHPAAGKPALPALKK |
| Ga0326723_0456998_440_568 | 3300034090 | Peat Soil | LWGKRGTMDMVAAMNTYAVSGFFAIAVDERSPEGKPELPAVK |
| Ga0335068_0547044_2_142 | 3300034116 | Freshwater | FAKAKQLFGDKGAMDLVAVMSTYAVSGFYAIAVDEHVPADKPQLPR |
| Ga0364935_0039548_5_145 | 3300034151 | Sediment | VELFGRKGAMDMVAVMNTYAVSGFYAIAVDERAPDGRLDLLSSPVH |
| ⦗Top⦘ |