Basic Information | |
---|---|
Family ID | F010060 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 309 |
Average Sequence Length | 47 residues |
Representative Sequence | MDTVLFTDHGIVVFAITTSAIALMFSVLGLATTHRMRSDIEHQF |
Number of Associated Samples | 174 |
Number of Associated Scaffolds | 309 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 80.87 % |
% of genes near scaffold ends (potentially truncated) | 32.69 % |
% of genes from short scaffolds (< 2000 bps) | 80.91 % |
Associated GOLD sequencing projects | 158 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.54 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (64.401 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (14.563 % of family members) |
Environment Ontology (ENVO) | Unclassified (33.981 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.162 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 309 Family Scaffolds |
---|---|---|
PF04392 | ABC_sub_bind | 5.18 |
PF00072 | Response_reg | 1.94 |
PF03401 | TctC | 1.29 |
PF13545 | HTH_Crp_2 | 1.29 |
PF01227 | GTP_cyclohydroI | 1.29 |
PF13505 | OMP_b-brl | 0.65 |
PF13649 | Methyltransf_25 | 0.65 |
PF00144 | Beta-lactamase | 0.65 |
PF04226 | Transgly_assoc | 0.65 |
PF12787 | EcsC | 0.65 |
PF00903 | Glyoxalase | 0.65 |
PF06035 | Peptidase_C93 | 0.32 |
PF12833 | HTH_18 | 0.32 |
PF13467 | RHH_4 | 0.32 |
PF01183 | Glyco_hydro_25 | 0.32 |
PF02776 | TPP_enzyme_N | 0.32 |
PF06233 | Usg | 0.32 |
PF13641 | Glyco_tranf_2_3 | 0.32 |
PF04909 | Amidohydro_2 | 0.32 |
PF02518 | HATPase_c | 0.32 |
PF16188 | Peptidase_M24_C | 0.32 |
PF05231 | MASE1 | 0.32 |
PF12697 | Abhydrolase_6 | 0.32 |
PF01987 | AIM24 | 0.32 |
PF01875 | Memo | 0.32 |
PF00083 | Sugar_tr | 0.32 |
PF00216 | Bac_DNA_binding | 0.32 |
PF17200 | sCache_2 | 0.32 |
PF07859 | Abhydrolase_3 | 0.32 |
PF01925 | TauE | 0.32 |
PF13458 | Peripla_BP_6 | 0.32 |
PF12071 | DUF3551 | 0.32 |
PF01329 | Pterin_4a | 0.32 |
PF07369 | DUF1488 | 0.32 |
PF08281 | Sigma70_r4_2 | 0.32 |
PF02775 | TPP_enzyme_C | 0.32 |
PF07784 | DUF1622 | 0.32 |
PF00589 | Phage_integrase | 0.32 |
PF01042 | Ribonuc_L-PSP | 0.32 |
PF13472 | Lipase_GDSL_2 | 0.32 |
PF01656 | CbiA | 0.32 |
PF12327 | FtsZ_C | 0.32 |
PF00211 | Guanylate_cyc | 0.32 |
PF01048 | PNP_UDP_1 | 0.32 |
PF02195 | ParBc | 0.32 |
COG ID | Name | Functional Category | % Frequency in 309 Family Scaffolds |
---|---|---|---|
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 5.18 |
COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 1.29 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.65 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.65 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.65 |
COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.65 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.32 |
COG4828 | Uncharacterized membrane protein | Function unknown [S] | 0.32 |
COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.32 |
COG3757 | Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family | Cell wall/membrane/envelope biogenesis [M] | 0.32 |
COG3672 | Predicted transglutaminase-like protein | Posttranslational modification, protein turnover, chaperones [O] | 0.32 |
COG3447 | Integral membrane sensor domain MASE1 | Signal transduction mechanisms [T] | 0.32 |
COG2820 | Uridine phosphorylase | Nucleotide transport and metabolism [F] | 0.32 |
COG2154 | Pterin-4a-carbinolamine dehydratase | Coenzyme transport and metabolism [H] | 0.32 |
COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.32 |
COG2013 | AIM24 protein, required for mitochondrial respiration | Energy production and conversion [C] | 0.32 |
COG1355 | Predicted class III extradiol dioxygenase, MEMO1 family | General function prediction only [R] | 0.32 |
COG0813 | Purine-nucleoside phosphorylase | Nucleotide transport and metabolism [F] | 0.32 |
COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 0.32 |
COG0775 | Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnB | Nucleotide transport and metabolism [F] | 0.32 |
COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.32 |
COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.32 |
COG0642 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.32 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 64.40 % |
All Organisms | root | All Organisms | 35.60 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459002|F0B48LX02HVA4X | Not Available | 525 | Open in IMG/M |
2170459012|GOYVCMS02HHHBI | Not Available | 517 | Open in IMG/M |
2228664021|ICCgaii200_c0733175 | Not Available | 1062 | Open in IMG/M |
2228664021|ICCgaii200_c1076697 | Not Available | 900 | Open in IMG/M |
3300000033|ICChiseqgaiiDRAFT_c0397324 | Not Available | 566 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_100387290 | Not Available | 669 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_101413339 | Not Available | 1197 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_101665034 | Not Available | 1567 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_101665112 | Not Available | 1305 | Open in IMG/M |
3300000559|F14TC_100469670 | Not Available | 793 | Open in IMG/M |
3300000559|F14TC_101088852 | Not Available | 551 | Open in IMG/M |
3300000580|AF_2010_repII_A01DRAFT_1013341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1320 | Open in IMG/M |
3300000580|AF_2010_repII_A01DRAFT_1052594 | Not Available | 626 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10007273 | All Organisms → cellular organisms → Bacteria | 3049 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10021809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1754 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10108711 | Not Available | 681 | Open in IMG/M |
3300000655|AF_2010_repII_A100DRAFT_1079134 | Not Available | 578 | Open in IMG/M |
3300000787|JGI11643J11755_11841446 | Not Available | 557 | Open in IMG/M |
3300000793|AF_2010_repII_A001DRAFT_10030385 | All Organisms → cellular organisms → Bacteria | 1267 | Open in IMG/M |
3300000793|AF_2010_repII_A001DRAFT_10047016 | Not Available | 971 | Open in IMG/M |
3300000793|AF_2010_repII_A001DRAFT_10119770 | Not Available | 550 | Open in IMG/M |
3300000816|AF_2010_repII_A10DRAFT_1000295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4332 | Open in IMG/M |
3300000816|AF_2010_repII_A10DRAFT_1004226 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1481 | Open in IMG/M |
3300000890|JGI11643J12802_10026686 | Not Available | 1016 | Open in IMG/M |
3300000890|JGI11643J12802_10442843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 624 | Open in IMG/M |
3300000955|JGI1027J12803_100238629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 2403 | Open in IMG/M |
3300003659|JGI25404J52841_10050161 | Not Available | 877 | Open in IMG/M |
3300003911|JGI25405J52794_10098803 | Not Available | 650 | Open in IMG/M |
3300004268|Ga0066398_10037085 | Not Available | 925 | Open in IMG/M |
3300004268|Ga0066398_10088131 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 700 | Open in IMG/M |
3300004268|Ga0066398_10180704 | Not Available | 546 | Open in IMG/M |
3300004281|Ga0066397_10067600 | Not Available | 685 | Open in IMG/M |
3300004479|Ga0062595_100354007 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
3300004479|Ga0062595_101224946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 668 | Open in IMG/M |
3300004479|Ga0062595_102254532 | Not Available | 535 | Open in IMG/M |
3300004479|Ga0062595_102468211 | Not Available | 517 | Open in IMG/M |
3300004633|Ga0066395_10033428 | All Organisms → cellular organisms → Bacteria | 2163 | Open in IMG/M |
3300004633|Ga0066395_10099952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1396 | Open in IMG/M |
3300004633|Ga0066395_10987912 | Not Available | 513 | Open in IMG/M |
3300005093|Ga0062594_100034375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 2380 | Open in IMG/M |
3300005293|Ga0065715_10835250 | Not Available | 597 | Open in IMG/M |
3300005294|Ga0065705_10010574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2756 | Open in IMG/M |
3300005294|Ga0065705_11010211 | Not Available | 545 | Open in IMG/M |
3300005295|Ga0065707_10019266 | Not Available | 1931 | Open in IMG/M |
3300005329|Ga0070683_101342604 | Not Available | 687 | Open in IMG/M |
3300005332|Ga0066388_100059063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Haematobacter | 4040 | Open in IMG/M |
3300005332|Ga0066388_100098731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3376 | Open in IMG/M |
3300005332|Ga0066388_100226327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2501 | Open in IMG/M |
3300005332|Ga0066388_100279777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2311 | Open in IMG/M |
3300005332|Ga0066388_100579893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1747 | Open in IMG/M |
3300005332|Ga0066388_100700005 | Not Available | 1620 | Open in IMG/M |
3300005332|Ga0066388_100761783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. | 1566 | Open in IMG/M |
3300005332|Ga0066388_101149923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 1320 | Open in IMG/M |
3300005332|Ga0066388_101460230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1193 | Open in IMG/M |
3300005332|Ga0066388_101831845 | Not Available | 1080 | Open in IMG/M |
3300005332|Ga0066388_102830176 | Not Available | 886 | Open in IMG/M |
3300005332|Ga0066388_105083654 | Not Available | 668 | Open in IMG/M |
3300005332|Ga0066388_106740119 | Not Available | 578 | Open in IMG/M |
3300005332|Ga0066388_107039872 | Not Available | 566 | Open in IMG/M |
3300005337|Ga0070682_101774508 | Not Available | 538 | Open in IMG/M |
3300005338|Ga0068868_101293939 | Not Available | 677 | Open in IMG/M |
3300005366|Ga0070659_101514802 | Not Available | 598 | Open in IMG/M |
3300005437|Ga0070710_11525670 | Not Available | 503 | Open in IMG/M |
3300005439|Ga0070711_101358493 | Not Available | 617 | Open in IMG/M |
3300005439|Ga0070711_101903053 | Not Available | 523 | Open in IMG/M |
3300005456|Ga0070678_102352447 | Not Available | 506 | Open in IMG/M |
3300005458|Ga0070681_11707118 | Not Available | 556 | Open in IMG/M |
3300005518|Ga0070699_100423795 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1205 | Open in IMG/M |
3300005535|Ga0070684_100812490 | Not Available | 874 | Open in IMG/M |
3300005547|Ga0070693_100957065 | Not Available | 645 | Open in IMG/M |
3300005548|Ga0070665_101770244 | Not Available | 625 | Open in IMG/M |
3300005564|Ga0070664_101922546 | Not Available | 561 | Open in IMG/M |
3300005713|Ga0066905_100060054 | Not Available | 2385 | Open in IMG/M |
3300005713|Ga0066905_100076029 | All Organisms → cellular organisms → Bacteria | 2184 | Open in IMG/M |
3300005713|Ga0066905_100097512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium 13_1_40CM_3_65_7 | 1986 | Open in IMG/M |
3300005713|Ga0066905_100106084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1921 | Open in IMG/M |
3300005713|Ga0066905_100112889 | All Organisms → cellular organisms → Bacteria | 1876 | Open in IMG/M |
3300005713|Ga0066905_100121766 | Not Available | 1822 | Open in IMG/M |
3300005713|Ga0066905_100433085 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1076 | Open in IMG/M |
3300005713|Ga0066905_100523520 | Not Available | 990 | Open in IMG/M |
3300005713|Ga0066905_100792387 | Not Available | 821 | Open in IMG/M |
3300005713|Ga0066905_101351746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 643 | Open in IMG/M |
3300005713|Ga0066905_102233719 | Not Available | 511 | Open in IMG/M |
3300005764|Ga0066903_100923383 | All Organisms → cellular organisms → Bacteria | 1583 | Open in IMG/M |
3300005764|Ga0066903_101386490 | Not Available | 1319 | Open in IMG/M |
3300005764|Ga0066903_103931865 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
3300005764|Ga0066903_104326421 | Not Available | 759 | Open in IMG/M |
3300005764|Ga0066903_108017329 | Not Available | 542 | Open in IMG/M |
3300005764|Ga0066903_108282858 | Not Available | 531 | Open in IMG/M |
3300005764|Ga0066903_108975429 | Not Available | 506 | Open in IMG/M |
3300005841|Ga0068863_100773846 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 956 | Open in IMG/M |
3300005937|Ga0081455_10010823 | All Organisms → cellular organisms → Bacteria | 9215 | Open in IMG/M |
3300005937|Ga0081455_10014382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 7764 | Open in IMG/M |
3300005937|Ga0081455_10026145 | Not Available | 5377 | Open in IMG/M |
3300005937|Ga0081455_10030817 | All Organisms → cellular organisms → Bacteria | 4866 | Open in IMG/M |
3300005937|Ga0081455_10035296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4472 | Open in IMG/M |
3300005937|Ga0081455_10103284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2283 | Open in IMG/M |
3300006049|Ga0075417_10124390 | Not Available | 1185 | Open in IMG/M |
3300006058|Ga0075432_10141150 | Not Available | 919 | Open in IMG/M |
3300006163|Ga0070715_10453934 | Not Available | 724 | Open in IMG/M |
3300006580|Ga0074049_11836242 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
3300006796|Ga0066665_10360126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3843 | 1190 | Open in IMG/M |
3300006844|Ga0075428_100041071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 5087 | Open in IMG/M |
3300006844|Ga0075428_100660839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Alsobacteraceae → Alsobacter → Alsobacter soli | 1114 | Open in IMG/M |
3300006852|Ga0075433_10095436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2632 | Open in IMG/M |
3300006852|Ga0075433_10442443 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
3300006853|Ga0075420_100030292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4835 | Open in IMG/M |
3300006853|Ga0075420_100638501 | Not Available | 919 | Open in IMG/M |
3300006854|Ga0075425_100007242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 11710 | Open in IMG/M |
3300006854|Ga0075425_100565528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1308 | Open in IMG/M |
3300006854|Ga0075425_100931773 | Not Available | 992 | Open in IMG/M |
3300006854|Ga0075425_102525103 | Not Available | 569 | Open in IMG/M |
3300006854|Ga0075425_102526047 | Not Available | 568 | Open in IMG/M |
3300006871|Ga0075434_101648627 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 649 | Open in IMG/M |
3300006904|Ga0075424_100028724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 5743 | Open in IMG/M |
3300006904|Ga0075424_101125400 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
3300006914|Ga0075436_100892328 | Not Available | 665 | Open in IMG/M |
3300009011|Ga0105251_10236762 | Not Available | 822 | Open in IMG/M |
3300009094|Ga0111539_10956132 | Not Available | 996 | Open in IMG/M |
3300009094|Ga0111539_11242678 | Not Available | 865 | Open in IMG/M |
3300009098|Ga0105245_12521173 | Not Available | 567 | Open in IMG/M |
3300009100|Ga0075418_11400105 | Not Available | 759 | Open in IMG/M |
3300009101|Ga0105247_10051594 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2534 | Open in IMG/M |
3300009147|Ga0114129_10854646 | Not Available | 1156 | Open in IMG/M |
3300009162|Ga0075423_10729430 | Not Available | 1047 | Open in IMG/M |
3300009162|Ga0075423_11050778 | Not Available | 866 | Open in IMG/M |
3300009162|Ga0075423_11070134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 858 | Open in IMG/M |
3300009174|Ga0105241_11426134 | Not Available | 664 | Open in IMG/M |
3300009177|Ga0105248_10365166 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1625 | Open in IMG/M |
3300009177|Ga0105248_10746075 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1105 | Open in IMG/M |
3300009553|Ga0105249_10954294 | Not Available | 925 | Open in IMG/M |
3300009792|Ga0126374_10195251 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1275 | Open in IMG/M |
3300009792|Ga0126374_10411228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 949 | Open in IMG/M |
3300009792|Ga0126374_10522911 | Not Available | 860 | Open in IMG/M |
3300009792|Ga0126374_11591357 | Not Available | 539 | Open in IMG/M |
3300010043|Ga0126380_10001060 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 10067 | Open in IMG/M |
3300010043|Ga0126380_10240016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1246 | Open in IMG/M |
3300010046|Ga0126384_11485560 | Not Available | 634 | Open in IMG/M |
3300010046|Ga0126384_11931832 | Not Available | 563 | Open in IMG/M |
3300010046|Ga0126384_11970192 | Not Available | 558 | Open in IMG/M |
3300010046|Ga0126384_12073071 | Not Available | 545 | Open in IMG/M |
3300010047|Ga0126382_10091354 | Not Available | 1938 | Open in IMG/M |
3300010047|Ga0126382_10098201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1884 | Open in IMG/M |
3300010047|Ga0126382_10156743 | Not Available | 1567 | Open in IMG/M |
3300010047|Ga0126382_10296008 | Not Available | 1212 | Open in IMG/M |
3300010047|Ga0126382_10311228 | Not Available | 1187 | Open in IMG/M |
3300010048|Ga0126373_12242498 | Not Available | 607 | Open in IMG/M |
3300010358|Ga0126370_10032760 | All Organisms → cellular organisms → Bacteria | 3147 | Open in IMG/M |
3300010358|Ga0126370_10363080 | Not Available | 1175 | Open in IMG/M |
3300010358|Ga0126370_11847967 | Not Available | 586 | Open in IMG/M |
3300010358|Ga0126370_12426413 | Not Available | 521 | Open in IMG/M |
3300010359|Ga0126376_10211893 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1615 | Open in IMG/M |
3300010359|Ga0126376_11546953 | Not Available | 694 | Open in IMG/M |
3300010359|Ga0126376_11835236 | Not Available | 645 | Open in IMG/M |
3300010359|Ga0126376_12176970 | Not Available | 599 | Open in IMG/M |
3300010359|Ga0126376_12948611 | Not Available | 525 | Open in IMG/M |
3300010360|Ga0126372_10366257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1300 | Open in IMG/M |
3300010360|Ga0126372_12574692 | Not Available | 560 | Open in IMG/M |
3300010361|Ga0126378_10058238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3640 | Open in IMG/M |
3300010362|Ga0126377_10007396 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8337 | Open in IMG/M |
3300010362|Ga0126377_10226440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1807 | Open in IMG/M |
3300010366|Ga0126379_10074546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2911 | Open in IMG/M |
3300010371|Ga0134125_10745567 | Not Available | 1079 | Open in IMG/M |
3300010375|Ga0105239_10325887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1732 | Open in IMG/M |
3300010376|Ga0126381_100166621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2911 | Open in IMG/M |
3300010398|Ga0126383_10046194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3594 | Open in IMG/M |
3300010398|Ga0126383_13461966 | Not Available | 515 | Open in IMG/M |
3300010400|Ga0134122_10620850 | Not Available | 1002 | Open in IMG/M |
3300011000|Ga0138513_100009928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1175 | Open in IMG/M |
3300012487|Ga0157321_1024503 | Not Available | 577 | Open in IMG/M |
3300012491|Ga0157329_1033281 | Not Available | 546 | Open in IMG/M |
3300012493|Ga0157355_1006412 | Not Available | 809 | Open in IMG/M |
3300012508|Ga0157315_1038908 | Not Available | 594 | Open in IMG/M |
3300012517|Ga0157354_1089715 | Not Available | 511 | Open in IMG/M |
3300012948|Ga0126375_10316466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1091 | Open in IMG/M |
3300012948|Ga0126375_11051636 | Not Available | 667 | Open in IMG/M |
3300012948|Ga0126375_12057627 | Not Available | 506 | Open in IMG/M |
3300012955|Ga0164298_10030957 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2403 | Open in IMG/M |
3300012957|Ga0164303_11136324 | Not Available | 567 | Open in IMG/M |
3300012958|Ga0164299_10122673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1392 | Open in IMG/M |
3300012958|Ga0164299_10937009 | Not Available | 632 | Open in IMG/M |
3300012961|Ga0164302_10671065 | Not Available | 763 | Open in IMG/M |
3300012971|Ga0126369_10003432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 11431 | Open in IMG/M |
3300012971|Ga0126369_10182732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 2005 | Open in IMG/M |
3300012971|Ga0126369_11753693 | Not Available | 710 | Open in IMG/M |
3300012984|Ga0164309_10002386 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8779 | Open in IMG/M |
3300012984|Ga0164309_10136309 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1611 | Open in IMG/M |
3300012984|Ga0164309_10351853 | Not Available | 1082 | Open in IMG/M |
3300012986|Ga0164304_10225101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1241 | Open in IMG/M |
3300012986|Ga0164304_10498380 | Not Available | 889 | Open in IMG/M |
3300012986|Ga0164304_11885199 | Not Available | 500 | Open in IMG/M |
3300012987|Ga0164307_10484156 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
3300012988|Ga0164306_10043629 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2669 | Open in IMG/M |
3300012989|Ga0164305_10162814 | Not Available | 1528 | Open in IMG/M |
3300013100|Ga0157373_11384075 | Not Available | 534 | Open in IMG/M |
3300013297|Ga0157378_12983602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 525 | Open in IMG/M |
3300013308|Ga0157375_10778222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1107 | Open in IMG/M |
3300014325|Ga0163163_10461550 | Not Available | 1331 | Open in IMG/M |
3300014325|Ga0163163_12534573 | Not Available | 571 | Open in IMG/M |
3300014745|Ga0157377_11251820 | Not Available | 577 | Open in IMG/M |
3300014745|Ga0157377_11748981 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
3300014968|Ga0157379_10354277 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1344 | Open in IMG/M |
3300015371|Ga0132258_12953553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1180 | Open in IMG/M |
3300015372|Ga0132256_100211765 | Not Available | 1990 | Open in IMG/M |
3300015372|Ga0132256_100787131 | Not Available | 1067 | Open in IMG/M |
3300015372|Ga0132256_103858963 | Not Available | 504 | Open in IMG/M |
3300015373|Ga0132257_100719045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1242 | Open in IMG/M |
3300015373|Ga0132257_101053301 | Not Available | 1025 | Open in IMG/M |
3300015373|Ga0132257_102410504 | Not Available | 683 | Open in IMG/M |
3300015374|Ga0132255_100339759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2171 | Open in IMG/M |
3300015374|Ga0132255_100602131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1625 | Open in IMG/M |
3300015374|Ga0132255_104217517 | Not Available | 610 | Open in IMG/M |
3300015374|Ga0132255_104998088 | Not Available | 561 | Open in IMG/M |
3300016341|Ga0182035_11361260 | Not Available | 636 | Open in IMG/M |
3300016371|Ga0182034_11176912 | Not Available | 666 | Open in IMG/M |
3300016371|Ga0182034_11454538 | Not Available | 600 | Open in IMG/M |
3300016404|Ga0182037_10643437 | Not Available | 903 | Open in IMG/M |
3300017792|Ga0163161_10722024 | Not Available | 831 | Open in IMG/M |
3300017792|Ga0163161_10920000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 742 | Open in IMG/M |
3300017792|Ga0163161_11723955 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
3300017939|Ga0187775_10281302 | Not Available | 649 | Open in IMG/M |
3300017944|Ga0187786_10340769 | Not Available | 630 | Open in IMG/M |
3300017997|Ga0184610_1291044 | Not Available | 539 | Open in IMG/M |
3300018067|Ga0184611_1048060 | Not Available | 1416 | Open in IMG/M |
3300018072|Ga0184635_10024106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2252 | Open in IMG/M |
3300018072|Ga0184635_10027559 | Not Available | 2118 | Open in IMG/M |
3300018072|Ga0184635_10173416 | Not Available | 861 | Open in IMG/M |
3300018072|Ga0184635_10176669 | Not Available | 853 | Open in IMG/M |
3300018072|Ga0184635_10191658 | Not Available | 815 | Open in IMG/M |
3300018072|Ga0184635_10235354 | Not Available | 727 | Open in IMG/M |
3300018081|Ga0184625_10105827 | Not Available | 1456 | Open in IMG/M |
3300018081|Ga0184625_10162071 | Not Available | 1169 | Open in IMG/M |
3300018081|Ga0184625_10423406 | Not Available | 684 | Open in IMG/M |
3300018081|Ga0184625_10556826 | Not Available | 569 | Open in IMG/M |
3300020018|Ga0193721_1079282 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
3300021478|Ga0210402_10790212 | Not Available | 874 | Open in IMG/M |
3300021560|Ga0126371_10121924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2633 | Open in IMG/M |
3300021560|Ga0126371_10122496 | All Organisms → cellular organisms → Bacteria | 2627 | Open in IMG/M |
3300021560|Ga0126371_10330091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1657 | Open in IMG/M |
3300021560|Ga0126371_11402632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 829 | Open in IMG/M |
3300025271|Ga0207666_1056138 | Not Available | 628 | Open in IMG/M |
3300025904|Ga0207647_10521014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 661 | Open in IMG/M |
3300025905|Ga0207685_10276582 | Not Available | 822 | Open in IMG/M |
3300025906|Ga0207699_10151711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1534 | Open in IMG/M |
3300025915|Ga0207693_10059393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2995 | Open in IMG/M |
3300025916|Ga0207663_10423872 | Not Available | 1022 | Open in IMG/M |
3300025916|Ga0207663_10704001 | Not Available | 800 | Open in IMG/M |
3300025918|Ga0207662_10212006 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium SCN 70-22 | 1258 | Open in IMG/M |
3300025932|Ga0207690_10601496 | Not Available | 897 | Open in IMG/M |
3300025932|Ga0207690_11492490 | Not Available | 565 | Open in IMG/M |
3300025961|Ga0207712_10657611 | Not Available | 911 | Open in IMG/M |
3300025986|Ga0207658_10074609 | Not Available | 2578 | Open in IMG/M |
3300026035|Ga0207703_12270732 | Not Available | 518 | Open in IMG/M |
3300026118|Ga0207675_102431658 | Not Available | 536 | Open in IMG/M |
3300027560|Ga0207981_1014412 | Not Available | 1416 | Open in IMG/M |
3300027617|Ga0210002_1034072 | Not Available | 853 | Open in IMG/M |
3300027646|Ga0209466_1113951 | Not Available | 549 | Open in IMG/M |
3300027873|Ga0209814_10149808 | Not Available | 1001 | Open in IMG/M |
3300028784|Ga0307282_10042388 | Not Available | 2008 | Open in IMG/M |
3300028784|Ga0307282_10084945 | Not Available | 1454 | Open in IMG/M |
3300028807|Ga0307305_10065481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1676 | Open in IMG/M |
3300028819|Ga0307296_10574267 | Not Available | 617 | Open in IMG/M |
3300028875|Ga0307289_10069993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1416 | Open in IMG/M |
3300028875|Ga0307289_10336168 | Not Available | 621 | Open in IMG/M |
3300030916|Ga0075386_12068215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium aquaticum | 680 | Open in IMG/M |
3300030916|Ga0075386_12147474 | Not Available | 565 | Open in IMG/M |
3300031092|Ga0308204_10193738 | Not Available | 630 | Open in IMG/M |
3300031170|Ga0307498_10001310 | All Organisms → cellular organisms → Bacteria | 3658 | Open in IMG/M |
3300031170|Ga0307498_10088917 | Not Available | 928 | Open in IMG/M |
3300031226|Ga0307497_10103304 | Not Available | 1114 | Open in IMG/M |
3300031226|Ga0307497_10389692 | Not Available | 663 | Open in IMG/M |
3300031446|Ga0170820_11519969 | Not Available | 2661 | Open in IMG/M |
3300031544|Ga0318534_10800429 | Not Available | 530 | Open in IMG/M |
3300031547|Ga0310887_10505077 | Not Available | 729 | Open in IMG/M |
3300031573|Ga0310915_10006191 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6690 | Open in IMG/M |
3300031713|Ga0318496_10662828 | Not Available | 576 | Open in IMG/M |
3300031720|Ga0307469_11797384 | Not Available | 592 | Open in IMG/M |
3300031820|Ga0307473_11377700 | Not Available | 531 | Open in IMG/M |
3300031821|Ga0318567_10623526 | Not Available | 612 | Open in IMG/M |
3300031854|Ga0310904_10626949 | Not Available | 737 | Open in IMG/M |
3300031890|Ga0306925_11624197 | Not Available | 627 | Open in IMG/M |
3300031908|Ga0310900_11297652 | Not Available | 608 | Open in IMG/M |
3300031910|Ga0306923_10303670 | All Organisms → cellular organisms → Bacteria | 1823 | Open in IMG/M |
3300031910|Ga0306923_11340008 | Not Available | 757 | Open in IMG/M |
3300031941|Ga0310912_10383593 | Not Available | 1093 | Open in IMG/M |
3300031954|Ga0306926_12634934 | Not Available | 548 | Open in IMG/M |
3300032000|Ga0310903_10593065 | Not Available | 589 | Open in IMG/M |
3300032075|Ga0310890_10183293 | Not Available | 1420 | Open in IMG/M |
3300032174|Ga0307470_10366146 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
3300032174|Ga0307470_11941610 | Not Available | 502 | Open in IMG/M |
3300032180|Ga0307471_100479917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1388 | Open in IMG/M |
3300032180|Ga0307471_103699192 | Not Available | 541 | Open in IMG/M |
3300032211|Ga0310896_10576285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 625 | Open in IMG/M |
3300032261|Ga0306920_104192533 | Not Available | 520 | Open in IMG/M |
3300033433|Ga0326726_10046311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3800 | Open in IMG/M |
3300033433|Ga0326726_10221577 | Not Available | 1753 | Open in IMG/M |
3300033433|Ga0326726_11074663 | Not Available | 782 | Open in IMG/M |
3300034090|Ga0326723_0582818 | Not Available | 517 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 14.56% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 12.95% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.74% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.74% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.21% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.21% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.88% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.91% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.59% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.59% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 2.59% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.94% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.94% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.62% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.29% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.29% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.29% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.29% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.97% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.97% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.97% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.97% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.65% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.65% |
Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.65% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.65% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.65% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.65% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.65% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.65% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.65% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.65% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.32% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.32% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.32% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.32% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.32% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.32% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.32% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.32% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.32% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.32% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459002 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cm | Environmental | Open in IMG/M |
2170459012 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO1O1 lysis Rhizosphere grass | Environmental | Open in IMG/M |
2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
3300000816 | Forest soil microbial communities from Amazon forest - 2010 replicate II A10 | Environmental | Open in IMG/M |
3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300011000 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015 | Environmental | Open in IMG/M |
3300012487 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 | Host-Associated | Open in IMG/M |
3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Host-Associated | Open in IMG/M |
3300012493 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.10.yng.090610 | Environmental | Open in IMG/M |
3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Host-Associated | Open in IMG/M |
3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Host-Associated | Open in IMG/M |
3300012517 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.6.yng.070610 | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027560 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC (SPAdes) | Environmental | Open in IMG/M |
3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) | Host-Associated | Open in IMG/M |
3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
3300030916 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
E1_01708200 | 2170459002 | Grass Soil | METVLFTDHDIVVFAITTSAIALLFSVLGLATTHHMRDEIGHQFKGPS |
N56_01040690 | 2170459012 | Grass Soil | MMDTVLFTDHGIVVFVITTSAIALILSVLGLATTHRTRSEIESQLKGLP |
ICCgaii200_07331753 | 2228664021 | Soil | MDTVLFTDHSIVVFAITTSAVALMFSVLGLATTRRMRSDIEHELKGLR |
ICCgaii200_10766971 | 2228664021 | Soil | MDTVLFTDHDIVVFAITATAAALLLSVLGLATTQQIRSDMKDQFQRE |
INPgaii200_11474171 | 2228664022 | Soil | MDTVLFTDHDIVVFAITATAAALLLSVLGLATTQQIRSDMK |
ICChiseqgaiiDRAFT_03973242 | 3300000033 | Soil | LEAVMETVLFTDHDIVVFAITTXAXALXFSVLGLATTHHMLDEIEHQFRGSS* |
INPhiseqgaiiFebDRAFT_1003872902 | 3300000364 | Soil | FTDHGIVVFAIATXAIALMLSVLGLATTHXIRADIDHHLRGLS* |
INPhiseqgaiiFebDRAFT_1014133391 | 3300000364 | Soil | MDTVLFTDHGIVVFVITASAIALTLSVLGLATTRLTRSEIEHQLKHLP* |
INPhiseqgaiiFebDRAFT_1016650343 | 3300000364 | Soil | MDTVLFTDHSIVVFAITTSAVALMFSVLGLATTRRMRSDIEHELKGLR* |
INPhiseqgaiiFebDRAFT_1016651123 | 3300000364 | Soil | MDTVLFTDHSIVVFAITTSAXALMFSVLGXATTRRMRSDIXHXXKGLR* |
F14TC_1004696702 | 3300000559 | Soil | MDTVLFTDHSIVVFAITTSAVALMFSVLGLATTRRMRSDI |
F14TC_1010888521 | 3300000559 | Soil | HGIVVFAIATCAIALMLSVLGLATTHQIRADIDHHLRGLS* |
AF_2010_repII_A01DRAFT_10133413 | 3300000580 | Forest Soil | MDTVLFTDHGIVVFVIVTSAIALMLSVLGLATTHHIRSDIEHQFRR* |
AF_2010_repII_A01DRAFT_10525941 | 3300000580 | Forest Soil | DHSIVVFAIVTGALSLIFSVLGLATTSQTRSDIKHQLGVR* |
AF_2010_repII_A1DRAFT_100072732 | 3300000597 | Forest Soil | MDTVLFSDHGIVVFAAATSAIALMLSVLGLATTRRTRFDIEHQFRH* |
AF_2010_repII_A1DRAFT_100218091 | 3300000597 | Forest Soil | MTDTVLFTDYSVLVFAILTSAMALIFSVLGLATTYQTRSEIQHQFGG |
AF_2010_repII_A1DRAFT_101087112 | 3300000597 | Forest Soil | METVLFTDHCIVVFAIVTGALSLIFSVLGLATTSQTRSDIKHQLGVR* |
AF_2010_repII_A100DRAFT_10791342 | 3300000655 | Forest Soil | METPMDTVLFTDHGIVVFVIVTSAIALMLSVLGLATTHHIRSDIEHQFRR* |
JGI11643J11755_118414461 | 3300000787 | Soil | MMEPVLFTDYGIVVFAITTSAIALTLSVLGLATTRQIRSDIDHHLRGLS* |
AF_2010_repII_A001DRAFT_100303853 | 3300000793 | Forest Soil | MMESVLFTDHSIVVFAIVTGALALTFSVLGLATTSQTRSDIKHQ |
AF_2010_repII_A001DRAFT_100470162 | 3300000793 | Forest Soil | MXTVLFTDHGIVVFVIATSAIALTLAVLGLATTHRVRSDIEHQFRR* |
AF_2010_repII_A001DRAFT_101197701 | 3300000793 | Forest Soil | SVLFTDHSIVVFAIVTGALALTFSVLGLATTSQTRSDIKHQLGVR* |
AF_2010_repII_A10DRAFT_10002956 | 3300000816 | Forest Soil | METVLFTDHGIVVFALVTGALGLIFSVLGLATTSQTRSDIKHQLGVR* |
AF_2010_repII_A10DRAFT_10042264 | 3300000816 | Forest Soil | MDTVLFTDHGIVVFVIATSAIALTLAVLGLATTHHVRSDIEHQFRR* |
JGI11643J12802_100266861 | 3300000890 | Soil | YGIVVFAITTSAIALTLSVLGLATTRQIRSDIDHHLRGLS* |
JGI11643J12802_104428431 | 3300000890 | Soil | MDTVFPDHGIVVFAITTGAIALILMLAVLGLATTHQTRSDIEHQWLPVSAD |
JGI1027J12803_1002386293 | 3300000955 | Soil | METVLFTDHSVVVFAVITGALALIFSVLGLATTSQTRSDIQ |
JGI25404J52841_100501611 | 3300003659 | Tabebuia Heterophylla Rhizosphere | METVLFTDHSIVVFAITTSAVALMLSVLGLATTRRIRADIEHQFKGLR* |
JGI25405J52794_100988032 | 3300003911 | Tabebuia Heterophylla Rhizosphere | MDTVLFTDHGIVVFAITTSAIALMFSVLGLATTHRMRSNIEHQFRH* |
Ga0066398_100370853 | 3300004268 | Tropical Forest Soil | MMESVLFTDLGIVVFAMTTSAIALILSVLGLATTNRTRSDIEHQLRGLP* |
Ga0066398_100881311 | 3300004268 | Tropical Forest Soil | METVLFTDHTVVVFAVITGALALIFSVLGLATTSQTRSDIQRQLKR |
Ga0066398_101807041 | 3300004268 | Tropical Forest Soil | LLSDWIKFQLEAEMDTVLFTDHDIVVFAIAASAIALMLSVLGLTTTQQTRSDINHQLKGLP* |
Ga0066397_100676002 | 3300004281 | Tropical Forest Soil | MDTVLFTDHGIVVFVIATSAIALTLAVLGLATTHRVRSDIEHQFRK* |
Ga0062595_1003540072 | 3300004479 | Soil | MDTVLFTDQGILVFVITGSIAVVLSVLGLATTHQTRADIEHQLKG* |
Ga0062595_1012249462 | 3300004479 | Soil | MMDTVLFTDHGIVVFAITTSAVALMFSVLGLATTHRMRSDIEHQFRH* |
Ga0062595_1022545322 | 3300004479 | Soil | MDTVLFTDHGIVVFAITTSAIALILSVLGLTTPNQTRSDIEHQLRGLP* |
Ga0062595_1024682112 | 3300004479 | Soil | MMDTVLFTDHDIVAFVIVASAIALVFSVLGLRTTQSARSDIRQQFRH* |
Ga0066395_100334283 | 3300004633 | Tropical Forest Soil | MMETVLFTDHSVVVFAIVTGALALTFSVLGLATTSQTRSDIQRQLRGLR* |
Ga0066395_100999522 | 3300004633 | Tropical Forest Soil | METVLFTDHTVVVFAVITGALALIFSVLGLATTSQTRSDIQRQLKRLQ* |
Ga0066395_109879121 | 3300004633 | Tropical Forest Soil | MDTVLFTDHGIVVFVIATSAIALTLAVLGLATTHRVRSDIEHQFR |
Ga0062594_1000343754 | 3300005093 | Soil | METVLFTDHSVVVFAVITGALALIFSVLGLATTSQTRSDIQRQLKGLQ* |
Ga0065715_108352501 | 3300005293 | Miscanthus Rhizosphere | VLRLEAIVDTVLFTDQGILVFVITGSIAVVLSVLGLATTHQTRADIEHQLKG* |
Ga0065705_100105743 | 3300005294 | Switchgrass Rhizosphere | MMETVLFTDHCIVVFAIVTGALALIFSVLGLATTSQTRSDIKHQLGVR* |
Ga0065705_110102112 | 3300005294 | Switchgrass Rhizosphere | MDTVLFTDHSIVVFAITTSAVALMFSVLGLATTRRMRSDIEHELKGCAESS* |
Ga0065707_100192662 | 3300005295 | Switchgrass Rhizosphere | MMETVLFTDHXIVVFAIVTGALALIFSVLGLATTSQTRSDIKHQLGVR* |
Ga0070683_1013426042 | 3300005329 | Corn Rhizosphere | MMESVLFTDHSIVVFAIVTGALTLTFSVLGLATTTQTRSDIKHQLG |
Ga0070683_1019477521 | 3300005329 | Corn Rhizosphere | MMETVLFTDRDIIAFVITASAIALVLSVLGLTTTQHMRSDIERRFRH* |
Ga0066388_1000590634 | 3300005332 | Tropical Forest Soil | MDTVLFTDHGVVVFAITTSAIALMFSVLGLATTRRMRSDIEHQFRH* |
Ga0066388_1000987312 | 3300005332 | Tropical Forest Soil | MMGTVLFTDHDIVMFAITASAIALMLSVLGLATTHQTRADIKHQLRGLP* |
Ga0066388_1002263274 | 3300005332 | Tropical Forest Soil | MDDTVLFTDHGIVVFAITTSAIALMFSVLGLATTYRMRSDIEQQFRH* |
Ga0066388_1002797774 | 3300005332 | Tropical Forest Soil | MDTVLFTDLGIVVFVIITSGVALMFSVLGLATTRRVRAEIKHQLKGLR* |
Ga0066388_1005798932 | 3300005332 | Tropical Forest Soil | METVLFTDHSLVVFTVITGALALIFSVLGLATTSQTRSDIQRQLKGLR* |
Ga0066388_1007000051 | 3300005332 | Tropical Forest Soil | MDTVLFTDHGIVVFVIATSAIALMLSVLGLATTHRTRSDIAHHFRR* |
Ga0066388_1007617833 | 3300005332 | Tropical Forest Soil | MDTVLFTDHAIVVFVIATSAIALTLAVLGLATTHRVRSDIGTNSEDE |
Ga0066388_1011499232 | 3300005332 | Tropical Forest Soil | MEARMETVLFTDHGMVVFVIVTGALGLIFSVLGLATTNQTRSDIKHQLGVR* |
Ga0066388_1014602301 | 3300005332 | Tropical Forest Soil | MDETVLFTDHGILVFAITTGAIALMLAVLGFATTRRTHSDIEHQLN* |
Ga0066388_1018318451 | 3300005332 | Tropical Forest Soil | MDTVLFTDHGIVVFVIAASAVALMCAVLGLATTHRMRADIEHQFRQHQ* |
Ga0066388_1028301761 | 3300005332 | Tropical Forest Soil | METVLFTDHSVVVFAVVTGALALIFSVLGLATTSQIRSDIQRQLKGLQ* |
Ga0066388_1050836541 | 3300005332 | Tropical Forest Soil | MDTVLFTDYGILVFALATSAIALMLSVLGLATTHQTRSDIKHQISGGLP* |
Ga0066388_1067401192 | 3300005332 | Tropical Forest Soil | MESVLFTDHSIVVFAIVTGALALIFSVLGLATTSQTRSDIKHQLGVR* |
Ga0066388_1070398721 | 3300005332 | Tropical Forest Soil | MDTVLFTDHGIVVFAIATSAIALMCSVLGLATTHRMRSDIEHQFRR* |
Ga0070682_1017745081 | 3300005337 | Corn Rhizosphere | METVLFTDQDIVVFVITATTLALVFSVLGLATPRRTRADIQHQLS* |
Ga0068868_1012939391 | 3300005338 | Miscanthus Rhizosphere | METVLFTDHCIVVFAIVTGALALIFSVLGLATTSQTRSDIKHQLGVR* |
Ga0070691_110468751 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MESVLFTDHGVLVFVITGTAIALVLSVLGLATTQQTHSDIK |
Ga0070659_1015148021 | 3300005366 | Corn Rhizosphere | METVLFADHCIVVFAIVTGALALIFSVLGLATTSQTRSDIKHQLGVR* |
Ga0070710_115256701 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MMDTVLFTDHGIVVFAITTSAIALILSVLGLATTHRTRSEIESQLKGLP* |
Ga0070711_1013584932 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MMDTVLFTDHDIVVFVITTSAIALILSVLGLATTHRTRSEIESQLKGL |
Ga0070711_1019030531 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | SIGGRSMMDTVLFTDHGIVVFAITTSAIALILSVLGLAATRLTRSEIESQLKGLP* |
Ga0070705_1016228311 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | VDTVLFTDQGILVFVITGSIAVVLSVLGLATTQQTHSDIK |
Ga0070678_1023524472 | 3300005456 | Miscanthus Rhizosphere | GGLLFTDHNIVVFAIVTGALALIFSVLGLATTSQTRSDIKHQLGVR* |
Ga0070681_117071182 | 3300005458 | Corn Rhizosphere | MESVLFTDHSIVVFAIVTGALALTFSVLGLATTSQTRSDIKHQL |
Ga0070699_1004237952 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MDIMDTVLFTDHGIVVFAIATSAIALMLSVLGLATTYRTRSDIQHQLKGLS* |
Ga0070684_1008124901 | 3300005535 | Corn Rhizosphere | MMDTVLFTDHGIVVFAITTSAIALMFSVLGLATTHRMRSDIGHQFRGSR* |
Ga0070693_1009570652 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MMDTVLFTDYGIVVFAITTSAIALILSVLGLASTRLTRSDIESQFKGLADSK* |
Ga0070665_1017702442 | 3300005548 | Switchgrass Rhizosphere | MESVLFTDHSIAVFAIVTGALALTFSVLGLATTSQTRSDIKHQLGVR* |
Ga0070664_1019225461 | 3300005564 | Corn Rhizosphere | MDTVLFTDQGILVFVIVGTAIALSLSVLLATTHQTRSGIKHQVK* |
Ga0068856_1013460392 | 3300005614 | Corn Rhizosphere | MMETVLFTDRDIIAFVITASAIALVLSVLGLTTTQRMRSDIERQFRH* |
Ga0066905_1000600545 | 3300005713 | Tropical Forest Soil | MDTVLFTDYGIVVFAITTSAIALMLSVLGLATTHQTRSDIEHQIRGLP* |
Ga0066905_1000760293 | 3300005713 | Tropical Forest Soil | MDTVLFTDHDIVVFAIAASAIALMLSVLGLTTTQQTRSDINHQLKGLP* |
Ga0066905_1000975123 | 3300005713 | Tropical Forest Soil | MESVLFTDHSIVVFAIVTGALALTFSVLGLATTSETRSDIKHQLGVR* |
Ga0066905_1001060842 | 3300005713 | Tropical Forest Soil | METVLFTDHGIVVFAIVTGALGLIFSVVGLATTIQTRSDIKHQLGVR* |
Ga0066905_1001128893 | 3300005713 | Tropical Forest Soil | METVLFTDHSVVVFAIVTGALALTFSVLGLATTSQTRSDIQRQLRGLR* |
Ga0066905_1001217662 | 3300005713 | Tropical Forest Soil | MDTVLFSDYGVVVLAITTSAVALMFSVLGLATTRRMRSDIEHQFRH* |
Ga0066905_1004330854 | 3300005713 | Tropical Forest Soil | MDTVLFTDHGIVVFAITTSAIALMFSVLGLATTHRMRSDIEHQFRH* |
Ga0066905_1005235201 | 3300005713 | Tropical Forest Soil | METVLFTDHSIVVFAITTSAVALMLSVLGLATTRRIRAD |
Ga0066905_1007923871 | 3300005713 | Tropical Forest Soil | MDTVLFTDHGIVVFAITTSAIALMFSVLGLATTHQIRADIDHHLRGLP* |
Ga0066905_1013517462 | 3300005713 | Tropical Forest Soil | MDTVLFTDLGIVVFAIITSAVALMFSVFGLATTRRVRAEIEHQLKGLR* |
Ga0066905_1022337192 | 3300005713 | Tropical Forest Soil | MDTVLFTDYGILVFALATSAIALMLSVLGLATTHQTRSDI |
Ga0066903_1009233833 | 3300005764 | Tropical Forest Soil | METVLFTDHGIVVFAIVTGALGLIFSVLGLATTSQTRSDIKHQLGVR* |
Ga0066903_1013864901 | 3300005764 | Tropical Forest Soil | MEANMETVLFTDYSLVVFAIVTGALALIFSALGLATTSQTRSDIKNQLGLR* |
Ga0066903_1039318651 | 3300005764 | Tropical Forest Soil | MMESVLFTDHSIVVFAIVTGALALTFSVLGLATTSQTRSDIKHQLGVR* |
Ga0066903_1043264211 | 3300005764 | Tropical Forest Soil | MDTVLFTDHGIVVFVIATSAIALMLSVLGLATTHRIRSDIERQFRR* |
Ga0066903_1080173291 | 3300005764 | Tropical Forest Soil | MESVLFTDHGIVVFAIVTGALGLIFSVLGLATTRQTRSDIKRQLGVH* |
Ga0066903_1082828582 | 3300005764 | Tropical Forest Soil | MESVLFTDHSIVVFAIVTGALALTFSVLGLATTSQTRSDIKHQLGVR* |
Ga0066903_1089754291 | 3300005764 | Tropical Forest Soil | WRSMMETVLFTDHSIVVFAIVTGALSLIFSVLGLATTSQTRSDIKHQLGVR* |
Ga0068863_1007738461 | 3300005841 | Switchgrass Rhizosphere | SIAVFAIVTGALALTFSVLGLATTSQTRSDIKHQLGVR* |
Ga0081455_100108235 | 3300005937 | Tabebuia Heterophylla Rhizosphere | METVLFTDHSIVVFAITTSAIALMLSVMGLATTRLMRADIEHQFKGLR* |
Ga0081455_100143823 | 3300005937 | Tabebuia Heterophylla Rhizosphere | METVLFTDHGIVVFAITTSAIALILSVLGLTTPNRMRSDIEHQLRGLP* |
Ga0081455_100261456 | 3300005937 | Tabebuia Heterophylla Rhizosphere | METVLFTDIGIVVFAITTSALALMFSVLGLATTRRMRADIEQQLNGLR* |
Ga0081455_100308174 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MDTVLFTDYGIVVFAITTSAIALMFSVLGLATTHQTRSDIEHQIRGLP* |
Ga0081455_100352964 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MMDTVLFIDHGIVVFAITTSAIALMFSVLGLATTHRMRSDIEHQFRH* |
Ga0081455_101032843 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MDTVLFTDYGIVVFAITTSAIALMFSVLGLATTHRMRSDIEHQFRH* |
Ga0075417_101243902 | 3300006049 | Populus Rhizosphere | MDTVLFTDHGIVVFAIATSAIALMFSVLGLATTHQIRADIDHHLRGLS* |
Ga0075432_101411502 | 3300006058 | Populus Rhizosphere | LEATMETVLFTDHGIVVFAITTSAIALILSVLGLTTPNRMRSDIEHQLRGLP* |
Ga0070715_104539341 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | TMETVLFTDHSVVVFAVITGALALIFSVLGLATTSQTRSDIQRQLKGLQ* |
Ga0074049_118362421 | 3300006580 | Soil | MDTVLFTDQGILMFVITGTIAVVLSVLGLATTHQTRADIEHQLKG* |
Ga0066665_103601262 | 3300006796 | Soil | MMDTVLFTDHDIVVFAITTSAIALMLSVLGLATTHRMRSDIEHQFRH* |
Ga0075428_1000410717 | 3300006844 | Populus Rhizosphere | MDTVFPDHGIVVFAITTGAIALMLMLAVLGLATTHRTRSDIEHQW |
Ga0075428_1006608393 | 3300006844 | Populus Rhizosphere | MMDTVLFTDHGIVVFAIATCAIALMLSVLGLATTHQIRADIDHHLRGLS* |
Ga0075433_100954361 | 3300006852 | Populus Rhizosphere | PMMDTVLFTDHGIVVFAITTSAVALMFSVLGLATTHRMRSDIEHQFRH* |
Ga0075433_104424434 | 3300006852 | Populus Rhizosphere | MDTVLFTDYGIVVFAITTSAIALMLSVLGLATTHQTRSDIEHQMRGLS* |
Ga0075420_1000302921 | 3300006853 | Populus Rhizosphere | MDTVLFTDQGIVVFATTTGVIALMLMLAMLGLATTHRTRSD |
Ga0075420_1006385012 | 3300006853 | Populus Rhizosphere | MDTVLFTDHGILVFAITTGAIALMLMFAVLGLATTHRTRSDIEHQWLPAGFR |
Ga0075425_10000724218 | 3300006854 | Populus Rhizosphere | TDHSIVVFAITTSAVALMFSVLGLATTRRMRSDIEHELKGLR* |
Ga0075425_1005655281 | 3300006854 | Populus Rhizosphere | MDTVLFTDQGIVVFATTTGVIALMLMLAMLGLATTHRTRSDIEHQWLPGGFSA |
Ga0075425_1009317731 | 3300006854 | Populus Rhizosphere | MDTVLFTDHGIVVFAILTSAMALLLSVFGLATTHHTRSEI |
Ga0075425_1025251031 | 3300006854 | Populus Rhizosphere | LGDVMDTVFPDHGIVVFAITTGAIALMLMLAVLGLATTHRTRSDI |
Ga0075425_1025260472 | 3300006854 | Populus Rhizosphere | IVVFAIVTGALALTFSVLGLATTSQTRSDIKHQLGVR* |
Ga0075434_1016486272 | 3300006871 | Populus Rhizosphere | MMDTVLFTDHGIVVFAMATCAIALMLSVLGLATTHQIRADIDHHLRGLS* |
Ga0075424_1000287243 | 3300006904 | Populus Rhizosphere | MMDTVLFTDHGIVVFAVTTSAVALMFSVLGLATTHRMRSDIEHQFRH* |
Ga0075424_1011254001 | 3300006904 | Populus Rhizosphere | MDTVLFTDHGIVVFAILTSAMALLLSVFGLATTHHTRSEIEHHF |
Ga0075436_1008923281 | 3300006914 | Populus Rhizosphere | MDTVLFTDHGILVFATTTGAIAFMLMLAVLGLATTHRTRSDIEHQWLP |
Ga0105251_102367622 | 3300009011 | Switchgrass Rhizosphere | MESVLFTDHSIVVFAIVTGALALTFSVLGLATTTQTRSDIKHQLGVR* |
Ga0111539_109561321 | 3300009094 | Populus Rhizosphere | MMETVLFTDHNIVVFAIVTGALALIFSVLGLATTSQTRSDIKHQLGVR* |
Ga0111539_112426782 | 3300009094 | Populus Rhizosphere | MESVLFTDHSIVVFAVVTGALALTFSVLGLATTSQTRSDIKHQLGVR* |
Ga0105245_125211731 | 3300009098 | Miscanthus Rhizosphere | PTMETVLFTDHSVVVFAVITGALALIFSVLGLATTSQTRSDIQRQLKGLQ* |
Ga0075418_114001053 | 3300009100 | Populus Rhizosphere | EGPKMDTVLFTDYGIVVFAITTCAIALMLSVLGLATTHQARSDIEHQMRGLS* |
Ga0105247_100515942 | 3300009101 | Switchgrass Rhizosphere | MMESVLFTDHSIAVFAIVTGALALTFSVLGLATTTQTRSDIKHQLGVR* |
Ga0114129_108546461 | 3300009147 | Populus Rhizosphere | MDTVLFTDHGIVVFAILTSAMALLLSVFGLATTHHTRSEIE |
Ga0075423_107294301 | 3300009162 | Populus Rhizosphere | DHSVVVFAVITGALALIFSVLGLATTSQTRSDIQRQLKGLQ* |
Ga0075423_110507783 | 3300009162 | Populus Rhizosphere | MMETVLFTDHSILVFAIVTGALALTFSVLGLATTSQTRSDIKHQLGVR* |
Ga0075423_110701341 | 3300009162 | Populus Rhizosphere | MESVLFTDHNIVVFAIVTGALALIFSVLGLATTSQTRSDIKHQLGVR* |
Ga0105241_114261341 | 3300009174 | Corn Rhizosphere | MMESVLFTDHSIAVFAIVTGALALTFSVLGLATTSQTRSDIKHQLGVR* |
Ga0105248_103651663 | 3300009177 | Switchgrass Rhizosphere | METVLFTDQDIVVFVITATTLALVFSVLGLATPRRTRSDIQHQLNGMR* |
Ga0105248_107460752 | 3300009177 | Switchgrass Rhizosphere | MMDTVLFTDHGILVFAITCAAAALLLSVLGLATTSQIRSD |
Ga0105249_109542942 | 3300009553 | Switchgrass Rhizosphere | LEAIVDTVLFTDQGILVFVITGSIAVVLSVLGLATTHQTRADIEHQLKG* |
Ga0126374_101952512 | 3300009792 | Tropical Forest Soil | MDTVLFTDHGIVVFVIATSAIALTLAVLGLATMHRVRSDIEHQFRR* |
Ga0126374_104112281 | 3300009792 | Tropical Forest Soil | MDTVLFTDHGIVVFAITTSAIALMFSVLGLATTHRMRSDIEHQF* |
Ga0126374_105229113 | 3300009792 | Tropical Forest Soil | MMDTVLFTDHGIVVFVITTSAIALTLSVLGLATTHQIRSDIDHHLRGLS* |
Ga0126374_115913571 | 3300009792 | Tropical Forest Soil | MMDTVLFTDHDIVVFATMGTAAALLLSVLGLATTQRIRSDMKA |
Ga0126380_100010609 | 3300010043 | Tropical Forest Soil | MDTVLFTDHDIVVFVIATSATALVLSVLGLATTHRIRSDIEHQFRR* |
Ga0126380_102400163 | 3300010043 | Tropical Forest Soil | VVFVIATSAIALTLAVLGLATTHRVRSDIEHQFRK* |
Ga0126384_110882071 | 3300010046 | Tropical Forest Soil | MMHTVLFTDHDIVVFATMGTAAALLLSVLGLATAQ |
Ga0126384_114855601 | 3300010046 | Tropical Forest Soil | NYGTRHSDWRPMMESVLFTDLGIVVFAMTTSAVALILSVLGLATTNPTRSDIEHQLRGFP |
Ga0126384_119318321 | 3300010046 | Tropical Forest Soil | MMETVLFTDHSVVVFAVVTGALALIFSVLGLATTSQIRSDIQRQLKGLQ* |
Ga0126384_119701921 | 3300010046 | Tropical Forest Soil | MMETVLFTDHSIVVFAIVTGALSLIFSVLGLATTSQTRSDIKHQLGVR* |
Ga0126384_120730712 | 3300010046 | Tropical Forest Soil | MESVLFTDLGIVVFAMTTSAIALILSVLGLATTNRTRSDIEHQLRGFP* |
Ga0126382_100913542 | 3300010047 | Tropical Forest Soil | MDTVLFTDHGIVVFAMTTSAIALILSVLGLATTNRTRSDIEHQLRGLP* |
Ga0126382_100982011 | 3300010047 | Tropical Forest Soil | MDTVLFTDHGIVVFAVTTSAIALMLSVLGLATTRRTRTDIEHHFRR* |
Ga0126382_101567432 | 3300010047 | Tropical Forest Soil | MMESVLFTDHSIVVFAIVTGALALIFSVLGLATTSQTRSDIKHQLGVR* |
Ga0126382_102960081 | 3300010047 | Tropical Forest Soil | MMDTVLFTDHGIVVFVITTSAIALTLSFLGLATTHQIRSDIDHHLRGLS* |
Ga0126382_103112283 | 3300010047 | Tropical Forest Soil | MDTVLFTDYGILVFALATSAIALMLSVLGLATTHQTRSDIEHQIRGLP* |
Ga0126373_122424982 | 3300010048 | Tropical Forest Soil | METVLFTDHTVVVFAVVTGALALIFSVLGLATTSQTRSDIQRQLKGLR* |
Ga0126370_100327603 | 3300010358 | Tropical Forest Soil | MMETVLFTDHSVVVFAIVTGALALTFSVLGLATTSKKRYDIKRQ |
Ga0126370_103630802 | 3300010358 | Tropical Forest Soil | MESVLFTDHSIVVFAVVTGALALIFSVLGLATTSQTRSDIKHQLGVR* |
Ga0126370_118479671 | 3300010358 | Tropical Forest Soil | MEAMMETVLFTDHGILVFVMTTSAIALVFSVLGLATTHRIRSDIEHQFRH* |
Ga0126370_124264131 | 3300010358 | Tropical Forest Soil | MDTVLFTDHGIVVFVIATSAIALMLSVLGLATTHRIRSDIEHQFRR* |
Ga0126376_102118932 | 3300010359 | Tropical Forest Soil | MMETVLFTDHGIVVFAIVTGALGLIFSVVGLATTIQTRSDIKHQLGVR* |
Ga0126376_115469532 | 3300010359 | Tropical Forest Soil | MDDTVLFTDHGILVFAIITSATALLLSVLGFATTRRTRFDVERQLSGLR* |
Ga0126376_118352362 | 3300010359 | Tropical Forest Soil | MMETVLFTDHDIIAFVITASAIALVFSVLGLTTTQRMRSDIERQFRH* |
Ga0126376_121769701 | 3300010359 | Tropical Forest Soil | MMDTVLFTDHGIVVFVITTSAIALTLSVLGLGTTHQIRSDIDHHLRGLS* |
Ga0126376_129486111 | 3300010359 | Tropical Forest Soil | VFAVVTGALALIFSVLGLATTGQIRSDIQRQLKGLQ* |
Ga0126372_103662571 | 3300010360 | Tropical Forest Soil | METVLFTDHTVVVFAVITGALALIFSDLGLATTSQTRSDIQRQLKRLQ* |
Ga0126372_125746921 | 3300010360 | Tropical Forest Soil | MDDTVLFTDHGILVFAIITSATALLLSVLGFATTRRTRSDVEHQLSGLR* |
Ga0126378_100582381 | 3300010361 | Tropical Forest Soil | TVLFTDHGIVVFAITTSAIALMFSVLGLATTYRMRSDIEQQFRH* |
Ga0126377_100073968 | 3300010362 | Tropical Forest Soil | METVLFTDHTVVVFAVITGALALIFSVLGLATTSHTRSDIQRQLKRLQ* |
Ga0126377_102264402 | 3300010362 | Tropical Forest Soil | MDTVLFTDHGIVVFVIATSAIALTLAVLGLAITHRVRSDIEHQFRK* |
Ga0126379_100745464 | 3300010366 | Tropical Forest Soil | MMGTVLFTDHDIVMFAITASAIALMLSVLGLATTHQTRADIEHQLRGLP* |
Ga0134125_107455673 | 3300010371 | Terrestrial Soil | MMETVLFTDHGIIAFVITASAIALVLSVLGLTTTQRMRSDIERQFRH* |
Ga0105239_103258872 | 3300010375 | Corn Rhizosphere | METVLFTDHSVVVFAVITGALSLIFSVLGLATTSQTRSDIQRQLKGLQ* |
Ga0126381_1001666211 | 3300010376 | Tropical Forest Soil | MDTVLFTDHAIVVFVIATSAIALTLAVLGLATTHRVRSDIEHQFRR* |
Ga0126383_100461946 | 3300010398 | Tropical Forest Soil | MDTVLFTDHGIVVFAITTSAIALMFSVLGLATTYRMRSDIEQQFRH* |
Ga0126383_134619661 | 3300010398 | Tropical Forest Soil | MMDTVLFTDHGIVVFVITTSAIALMLSVLRLATTHQIRSDIDHHLRGLS* |
Ga0134122_106208502 | 3300010400 | Terrestrial Soil | MMEPVLFTDHSIAVFAIVTGALALTFSVLGLATTSQTRSDIKHQLGVR* |
Ga0138513_1000099281 | 3300011000 | Soil | MDTVLFTDHSIVLFAITTCAIALMLSVLGLATPHSTRADIEQELKGLRWER* |
Ga0157321_10245031 | 3300012487 | Arabidopsis Rhizosphere | MMESVLFTDHSIVVFAIVTGALALTFSVLGLATTSQTRSDIKHQL |
Ga0157329_10332812 | 3300012491 | Arabidopsis Rhizosphere | MESVLFTDHSIVVFAIVTGALALTFSVLGLATTSQTRSDIKH |
Ga0157355_10064121 | 3300012493 | Unplanted Soil | MESVLFTDHSIVVFAIVTGALALTFSVLGLVTTSQTRSDIKHQLGVR* |
Ga0157341_10097752 | 3300012494 | Arabidopsis Rhizosphere | MMDTVLFTDHGILVFAITCAAAALLLSVLGLATTHQIRSDIIDQFRLEVPFEADTA |
Ga0157315_10389082 | 3300012508 | Arabidopsis Rhizosphere | MESVLFTDHSIAVFAIVTGALALTFSVLGLATTSQTRSDI |
Ga0157354_10897151 | 3300012517 | Unplanted Soil | MMDTVLFTDYGIVVFAITTSAVALMFSVLGLATTRRTRSDIEHELKGLQ* |
Ga0126375_103164661 | 3300012948 | Tropical Forest Soil | RLTMDTVLFTDLGIVVFAIITSGVALMFSVLGLATTRRVRAEIKHQLKGLR* |
Ga0126375_110516362 | 3300012948 | Tropical Forest Soil | LFTDYGIVVFAITTSTITLMVSVLGLATTRRTRSDIEHQLRGLP* |
Ga0126375_120576271 | 3300012948 | Tropical Forest Soil | MMDTVLFTDHSIVVFVIVTSAIALMFSVLGLATTYQMRSEIQHEF |
Ga0164298_100309571 | 3300012955 | Soil | MMDTVLFTDHGIVVFAITTSAIALILSVLGLATTRLTRSDIESQFKGLADSK* |
Ga0164303_111363241 | 3300012957 | Soil | MMDTVLFTDHGIVVFVITTSAIALILSVLGLATTRLTRSDIESQFKGLADSK* |
Ga0164299_101226731 | 3300012958 | Soil | MMDTVLFTDHGIVVFAITTSAIALILSVLGLATTRLTRSEIESQLKGLP* |
Ga0164299_109370091 | 3300012958 | Soil | MMECVLFTDHSIAVFAIVTGALALTFSVLGLATTSQTRSDIKHQLGVR* |
Ga0164302_106710652 | 3300012961 | Soil | METVFFTDHGIVVFAVVTGALGLIFSVLGLATTSQTRSDIKHQLGVR* |
Ga0126369_1000343213 | 3300012971 | Tropical Forest Soil | MMDDTVLFTDHGIVVFAITTSAIALMFSVLGLATTYRMRSDIEQQFRH* |
Ga0126369_101827324 | 3300012971 | Tropical Forest Soil | MDTVLFTDHAIVVFVIATSAIALTLAVLGLATTHRVRSDIEHQFR |
Ga0126369_117536933 | 3300012971 | Tropical Forest Soil | FTDHAIVVFVIATSAIALTLAVLGLATTHRVRSDIEHQFRR* |
Ga0164309_1000238612 | 3300012984 | Soil | METVLFTDQDILVFVITATALALVFSVLGLATPRRTRADIQHQLNGMR* |
Ga0164309_101363094 | 3300012984 | Soil | DHSIVVFAIVTGALALTFSVLGLATTSQTRSDIKHQLGVR* |
Ga0164309_103518533 | 3300012984 | Soil | MMDTVLFTDYGIVVFAITTSAIALILSVLGLATTRLTRSDIESQFKVLANSK* |
Ga0164304_102251011 | 3300012986 | Soil | MMDTVLFTDYGIVVFAITTSAIALILSVLGLATTRLTRSDIESQFKGLADS |
Ga0164304_104983801 | 3300012986 | Soil | MMDTVLFTDHGILVFAIACAAAALLLSVLGLATTYQIRSDIIDQF |
Ga0164304_118851991 | 3300012986 | Soil | MMGTVLFTDHGILVFAMTTGAIALMLMLAVLGLATTHRTRSDIEH |
Ga0164307_104841561 | 3300012987 | Soil | RPMMETVLFTDHCIVVFAIVTGALALIFSVLGLATTSQTRSDIKHQLGVR* |
Ga0164306_100436294 | 3300012988 | Soil | MMDTVLFTDYGIVVFAITTSAIALILSVLGLATTRLTRADIESQFKGLADAK* |
Ga0164306_110416841 | 3300012988 | Soil | MDTELFTDHDIVAFAITSAAAALLLSVLGLASTYQM |
Ga0164305_101628141 | 3300012989 | Soil | TVLFTDHSVVVFAVITGALALIFSVLGLATTSQTRSDIQRQLKGLQ* |
Ga0157373_113840751 | 3300013100 | Corn Rhizosphere | GGRSMMDTVLFTDHGIVVFAITTSAIALILSVLGLATTRLTRSEIESQLKGLP* |
Ga0157378_129836021 | 3300013297 | Miscanthus Rhizosphere | LTMETVLFTDHSIVVFAITTSAVALMFSVLGLATTRRTRSDIEHELKGLQ* |
Ga0157375_107782221 | 3300013308 | Miscanthus Rhizosphere | MEAVLFTDHSVVVFAVITGALALIFSVLGLATTSQTRSDIQRQLKGLQ* |
Ga0163163_104615501 | 3300014325 | Switchgrass Rhizosphere | MMETVLFTDHSILVFAIVTGALALIFSVLGLATTSQTRSDIKHQLGVR* |
Ga0163163_125345733 | 3300014325 | Switchgrass Rhizosphere | VVFAVITGALALIFSVLGLATTSQTRSDIQRQLKGLQ* |
Ga0157377_112518202 | 3300014745 | Miscanthus Rhizosphere | MMETVLFTDHCIVVFAIVTGALALIFSVLGLATTSQTR |
Ga0157377_117489811 | 3300014745 | Miscanthus Rhizosphere | METVLFTDHSVVVFAVITGALALIFSVLGLATTSQTR |
Ga0157379_103542774 | 3300014968 | Switchgrass Rhizosphere | VFAIVTGALALTFSVLGLATTSQTRSDIKHQLGVR* |
Ga0132258_129535532 | 3300015371 | Arabidopsis Rhizosphere | PTRLIGHLTLRLEAIMDTVLFTDQGILVFVITGSIAVVLSVLGLATTHQTRADIEHQLKV |
Ga0132256_1002117652 | 3300015372 | Arabidopsis Rhizosphere | METVLFTDLDIVVFAITASAVALMCSVLGLATTRRIRSDIQHELNGLRWER* |
Ga0132256_1007871313 | 3300015372 | Arabidopsis Rhizosphere | MMDTVLFTDHGILVFAIACAAAALLLSVLGLATTYQIRADIIDQ |
Ga0132256_1038589631 | 3300015372 | Arabidopsis Rhizosphere | MDTVLFADHGIVVFAITTTAIALVFSVLGLATTHRMRSDIGHQFRG |
Ga0132257_1007190451 | 3300015373 | Arabidopsis Rhizosphere | TVLFTDQGILVFVIAGTAIALSLSVLLATTHQTRSGIKHQVK* |
Ga0132257_1010533012 | 3300015373 | Arabidopsis Rhizosphere | MDDTVLFTDHGILLFAIVTSATALMLSVLGFATTRRTRSDIEHELNGLR* |
Ga0132257_1024105042 | 3300015373 | Arabidopsis Rhizosphere | MMDTVLFTDHGIVVVAITTSAIALMFSVLGLATTHRMRSDIGH |
Ga0132255_1003397591 | 3300015374 | Arabidopsis Rhizosphere | MDTVLFTDHGILVFAITCAAAALLLSVLGLATTYQIRSDII |
Ga0132255_1006021311 | 3300015374 | Arabidopsis Rhizosphere | MMGTVLFTDHGILVFAMTTGAIALMLMLAVLGLATTHRTRSDIEHQWL |
Ga0132255_1042175172 | 3300015374 | Arabidopsis Rhizosphere | MMDTVLFTDYGIVVFAITTSAIALIASVLGLATTHRTRSDIESQLKGLRDRPSAAA* |
Ga0132255_1049980882 | 3300015374 | Arabidopsis Rhizosphere | MGTVLFTDNGILMFVITTGAIALMLMLAVLGLATTHRTRSDIESQLKGLSGGR* |
Ga0182035_113612602 | 3300016341 | Soil | TDDSIVVFAIVTGALALIFSVLGLATTSETRSDIKHQLGVR |
Ga0182034_111769121 | 3300016371 | Soil | MDTVLFTDHGVVVFAITTSAVALMFSVLGLATTRRMRSDIEHQFDT |
Ga0182034_114545381 | 3300016371 | Soil | METVLFTDHSIVVFAIVTGALALIFSVLGLATTSQTR |
Ga0182037_106434372 | 3300016404 | Soil | MDTVLFTDTGILVFALATGAIALMLSVLGLATTYQTRSDIKHQISGGLP |
Ga0163161_107220241 | 3300017792 | Switchgrass Rhizosphere | METVLFTDHNIVVFAIVTGALALIFSVLGLATTSQTRSDIKHQLGVR |
Ga0163161_109200002 | 3300017792 | Switchgrass Rhizosphere | MESVLFTDHSIAVFAIVTGALALTFSVLGLATTSQTRSDIKHQL |
Ga0163161_117239551 | 3300017792 | Switchgrass Rhizosphere | METVLFTDHSVVVFAVITGALALIFSVLGLATTSQTRSDIQRQLKGLQ |
Ga0187775_102813021 | 3300017939 | Tropical Peatland | METVLFTDYSLVVFVITTSAIALMFSVLGLATTQRTRTDIKHQLRSPQ |
Ga0187786_103407691 | 3300017944 | Tropical Peatland | MDTVLFTDQSILLFVITTTAITLVLSVLGLATTDRTRSDIKQQLKGLR |
Ga0184610_12910442 | 3300017997 | Groundwater Sediment | MDTVLFTDHGIVVFAITASAMALIFSVLGLATPHQTRSDINRELKGLP |
Ga0184611_10480602 | 3300018067 | Groundwater Sediment | METVLFTDHGIVVFAITTSAIALILSVLGLTTPNRMRSDIEHQLRGLP |
Ga0184635_100241063 | 3300018072 | Groundwater Sediment | MDTVLFTDHSIVLFAITNCAIALMLSVLGLATPHSTRADIEQELKGLRWER |
Ga0184635_100275594 | 3300018072 | Groundwater Sediment | METVLFTDHGIVVFAVTTSAIALILSVLGLTTPNRTRSDIEHQLRGLP |
Ga0184635_101734162 | 3300018072 | Groundwater Sediment | METVLFTDHSIVVFAITTSAFALMFSVLGLATTRRTRSDIEHELKGLR |
Ga0184635_101766691 | 3300018072 | Groundwater Sediment | MMDTVLFTDYGIVVFAITMSAIALILSVLGLATTNRMRSEIEQQLRGLP |
Ga0184635_101916581 | 3300018072 | Groundwater Sediment | MMDTVLFTDYGIVVFAITMSAIALILSVLGLAATHRTRSDIESQLKGLP |
Ga0184635_102353543 | 3300018072 | Groundwater Sediment | MDTVLFTDHGIVVFAITCSAMALILSVLGLATPHETRSDI |
Ga0184625_101058273 | 3300018081 | Groundwater Sediment | METVLFTDHGIVVFAITTSAIALILSVLGLTTPNRTRSDIEHQLRGLP |
Ga0184625_101620711 | 3300018081 | Groundwater Sediment | MRDTVLFTDYGIVVFAITMSAIALILSVLGLATTNRMRSEIEQQLRGLP |
Ga0184625_104234061 | 3300018081 | Groundwater Sediment | MDTVLFTDHSIVLFAITTCAIALMLSVLGLATPHSTRADIEQELKGLRWE |
Ga0184625_105568261 | 3300018081 | Groundwater Sediment | TVLFTDHSIVVFAITTIAIALMFSVLGVATTHHMRDEIEHQFRGPS |
Ga0193721_10792822 | 3300020018 | Soil | MMDTLLFTDYGILMFAITTSAIALMLSVLGLATTQQTRSDIQHQLR |
Ga0210402_107902121 | 3300021478 | Soil | MMDTVLFTDHGIVVFVITTSALALILSVLGLATTHRTRSEIESQLKGLP |
Ga0126371_101219241 | 3300021560 | Tropical Forest Soil | METVLFTDHTVVVFAVITGALALIFSVLGLATTSQTRSDIQRQLKRLH |
Ga0126371_101224961 | 3300021560 | Tropical Forest Soil | WRPMMETVLFTDHGIVVFAIVTGALGLIFSVVGLATTIQTRSDIKHQLGVR |
Ga0126371_103300911 | 3300021560 | Tropical Forest Soil | MMDDTVLFTDHGIVVFAITTSAIALMFSVLGLATTYRMRSDIEQQFRH |
Ga0126371_114026322 | 3300021560 | Tropical Forest Soil | MMGTVLFTDHDIVMFAITASAIALMLSVLGLATTHQTRADIKHQLRGLP |
Ga0207666_10561381 | 3300025271 | Corn, Switchgrass And Miscanthus Rhizosphere | LEAIVDTVLFTDQGILVFVITGSIAVVLSVLGLATTHQTRADIEHQLKG |
Ga0207647_105210142 | 3300025904 | Corn Rhizosphere | MEPVLFTDHSIVVFAIVTGALALTFSVLGLATTSQTRSDIKHQLGVR |
Ga0207685_102765821 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | TVLFTDHSIVVFAITTSAVALMFSVLGLATTRRTRSDIEHELKGLQ |
Ga0207699_101517111 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | METVLFTDHSVVVFAVITGALALIFSVLGLATTSQTRSDIQRQ |
Ga0207707_100609094 | 3300025912 | Corn Rhizosphere | MMETVLFTDRDIIAFVITASAIALVLSVLGLTTTQHMRSDIERRFRH |
Ga0207693_100593934 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MESVLFTDHNIVVFAIVTGALALIFSVLGLATTSQTRSDIKHQLGVR |
Ga0207663_104238722 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | METVLFTDHNIVVFAIVTGALALIFSVLGLATTSQTRSDIK |
Ga0207663_107040012 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MMDTVLFTDYGIVVFAITTSAIALILSVLGLATTRLTRSDIESQFKGLADSK |
Ga0207662_102120062 | 3300025918 | Switchgrass Rhizosphere | MDTVLFTDHGILVFAIACAAAALLLSVLGLATTYQIRSDIIDQ |
Ga0207690_106014962 | 3300025932 | Corn Rhizosphere | MNSQRPFAIVTGALALTFSVLGLATTSQTRSDIKHQLGVR |
Ga0207690_114924901 | 3300025932 | Corn Rhizosphere | AVFAIVTGALALTFSVLGLATTSQTRSDIKHQLGVR |
Ga0207712_106576112 | 3300025961 | Switchgrass Rhizosphere | MDTVLFTDQGILVFVITGSIAVVLSVLGLATTHQTRADIEHQLKG |
Ga0207658_100746093 | 3300025986 | Switchgrass Rhizosphere | METVLFTDQDIVVFVITATTLALVFSVLGLATPRRTRSDIQHQLNGMR |
Ga0207703_122707323 | 3300026035 | Switchgrass Rhizosphere | FTDHDIVVFAITTCALALIFSVLGLATTHHMRDEIEHQFRGPS |
Ga0207675_1024316581 | 3300026118 | Switchgrass Rhizosphere | MEPVLFTDHSIAVFAIVTGALALTFSVLGLATTSQTRSDIKHQLGVR |
Ga0207981_10144122 | 3300027560 | Soil | LIGHLTLGLEAIMDTVLFTDQGILVFVITGSIAVVLSVLGLATTHQTRADIKHQLKG |
Ga0210002_10340722 | 3300027617 | Arabidopsis Thaliana Rhizosphere | MDTVLFTDQGILVFVIVGTAIALSLSVLLATTHQTRSGIKHQVK |
Ga0209466_11139511 | 3300027646 | Tropical Forest Soil | METVLFTDHGIVVFAIVTGALGLIFSVVGLATTIQTRSDIKHQLGVR |
Ga0209814_101498084 | 3300027873 | Populus Rhizosphere | MDTVLFTDHGIVVFAIATSAIALMFSVLGLATTHQIRADIDHHLRGLS |
Ga0209481_103160372 | 3300027880 | Populus Rhizosphere | MDTVLFTDHDIVVFAITATAAALLLSVLGLATTQQIRSDMKD |
Ga0209382_106179563 | 3300027909 | Populus Rhizosphere | MDTVLFTDHDIVVFAITATAAALLLSVLGLATTQQIR |
Ga0307282_100423882 | 3300028784 | Soil | METVLFTDHSIVVFAITTIAIALMFSVLGVATTHHMRDEIEHQFRGPS |
Ga0307282_100849452 | 3300028784 | Soil | MDTVLFTDHGIVVFAITASAMALIFSVLGLATTHQTRSDINHQLKGLP |
Ga0307305_100654813 | 3300028807 | Soil | WTLEAIMDTVLFTDHGIVVFAITASAMALIFSVLGLATTHQTRSDINHQLKGLP |
Ga0307296_105742673 | 3300028819 | Soil | DHDIVVFAITTSAIALLFSVLGLATTHHMRDEIGHQFRGPS |
Ga0307289_100699931 | 3300028875 | Soil | MDTVLFSDHGILVFAMTTGAIALMLMLAVLGLATTYRTRSDIEHQW |
Ga0307289_103361682 | 3300028875 | Soil | MDTVLFTDNGILVFAMTTGAIALTLMLAVLGLATTHRTRSDIEHQWLPV |
Ga0075386_120682152 | 3300030916 | Soil | METVLFTDHGVVIFAITTSAFALIFSVSGLATTRQTRCDIERELKGCSESS |
Ga0075386_121474741 | 3300030916 | Soil | LGDVMDTVLFTDHGIVVFAITIGAIALMLMLAVLGLATTHRTRS |
Ga0308204_101937382 | 3300031092 | Soil | FTDYGIVVFAITMSAIALILSVLGLAATHRTRSDIETQ |
Ga0307498_100013106 | 3300031170 | Soil | METVLFTDHDIVVFAITTSAIALLFSVLGLATTHHMRDEIGHQFRGPS |
Ga0307498_100889172 | 3300031170 | Soil | MDTVLFTDHGIVVFAITCSAMALILSVLGLATPHQIRSDINRELKGLP |
Ga0307497_101033041 | 3300031226 | Soil | MDTVLFTDHGIVVFAITCSAMALILSVLGLATPHQTRSDINRELKGLP |
Ga0307497_103896921 | 3300031226 | Soil | MDTVLFTDQGILMFVIVGSTIALTLSVLLAITHQTRSDFKHQLKGLPWG |
Ga0170820_115199693 | 3300031446 | Forest Soil | METVLFTDHDIVAFAITTSAIALIFSVLGLATTHHMRDEIEHQFRGPS |
Ga0318534_108004291 | 3300031544 | Soil | METVLFTDHSIVVFAIVTGALSLIFSVLGLATTSQTRSDIKHQLGVR |
Ga0310887_105050772 | 3300031547 | Soil | MMESVLFTDHSIAVFAIVTGALALTFSVLGLATTSQTRSDIKHQLGVR |
Ga0310915_1000619110 | 3300031573 | Soil | MDTLLFTDHFDTVLFTDHGLVVFAITTSAIALMFSVLGLATTHRMRSDIEHQFRH |
Ga0318496_106628282 | 3300031713 | Soil | SIVVFAIVTGALSLIFSVLGLATTSQTRSDIKHQLGVR |
Ga0307469_117973841 | 3300031720 | Hardwood Forest Soil | MMDTVLFTDYGIVVFAITTSAIALILSVLGLATTHRTRSDIESQLKGLP |
Ga0307473_113777002 | 3300031820 | Hardwood Forest Soil | METVLFTDHNIVVFAIVTGALALIFSVLGLATTSQTRSDVKHQLGVR |
Ga0318567_106235261 | 3300031821 | Soil | IVVFAIVTGALSLIFSVLGLATTSQTRSDIKHQLGVR |
Ga0310904_106269491 | 3300031854 | Soil | SVLFTDHSIAVFAIVTGALALTFSVLGLATTSQTRSDIKHQLGVR |
Ga0306925_116241972 | 3300031890 | Soil | MDTVLFTDHGVVVFAITTSAVALMFSVLGLATTRRMRSDIEHQFDTERQLRGLR |
Ga0310900_112976521 | 3300031908 | Soil | LEAIMDTVLFTDQGILVFVITGSIAVVLSVLGLATTHQTRADIEHQLKG |
Ga0306923_103036702 | 3300031910 | Soil | METVLFTDHSLVVFVITASAIALMSSVLGLATTHRTRSDIKHQFREQ |
Ga0306923_113400082 | 3300031910 | Soil | MESVLFTDHSIVVFAIVTGALALIFSVLGLATTSETRSDIKHQLGVR |
Ga0310912_103835931 | 3300031941 | Soil | FTDHGVVVFAITTSAVALMFSVLGLATTRRMRSDIEHQFDTERQLRGLR |
Ga0306926_126349342 | 3300031954 | Soil | METVLFTDHSIVVFAIVTGALALIFSVLGLATTSQTRSDIKHQLGVR |
Ga0310903_105930652 | 3300032000 | Soil | MGTVLFTDHGILVFAMTTGAIALMLMLAVLGLATTHRTRSDIEHQWLPA |
Ga0310890_101832933 | 3300032075 | Soil | MMETVLFTDHSIVVFAIVTGALALIFSVLGLATTSQTRSDIKHQLGVR |
Ga0307470_103661462 | 3300032174 | Hardwood Forest Soil | METVLFTDHSIVVFAIVTGALALTFSVLGLATTSQTRSDIKHQLGVR |
Ga0307470_119416101 | 3300032174 | Hardwood Forest Soil | MMDTVLFTDHGIVVFVITTSAIALILSVLGLATTRLTRSEIESQLKGLP |
Ga0307471_1004799171 | 3300032180 | Hardwood Forest Soil | METVLFTDHRVVVFAVITGALALIFSVLGLATTSQTRSDIQRQLKGLQ |
Ga0307471_1036991921 | 3300032180 | Hardwood Forest Soil | MMDTVLFTDHGIVVFAITTSAIALILSVLGLATTRLTRSEIESQLKGLP |
Ga0310896_105762852 | 3300032211 | Soil | MDTVLFTDQGILVFVITGSIAVVLSVLGLATTHQTRADIEHQLK |
Ga0306920_1041925332 | 3300032261 | Soil | MDTVLFTDYGILVFALATGAIALMLSVLGLATTHQTRSDIKHQISGGLP |
Ga0326726_100463112 | 3300033433 | Peat Soil | MMDTVLFTDHGIVVFAITTSAIALILSVLGLATTHRTRSEIESQLKGLP |
Ga0326726_102215774 | 3300033433 | Peat Soil | MDTVLFTDQGILVFVITGSAIALMLSVLGLTTTHQTRSDIKHQLKGLP |
Ga0326726_110746632 | 3300033433 | Peat Soil | MDTVLFTDQGILLFCITTTAITLVLSVFGFATTNQTRSDIKRQFKRAAVRRGSA |
Ga0326723_0582818_159_305 | 3300034090 | Peat Soil | MDTVLFTDQGIVLFCITTTAIALMLLVLGLSTTDRTRSDIKHQLKGLR |
⦗Top⦘ |