Metagenome / Metatranscriptome Family F010035

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F010035
Family Type	Metagenome / Metatranscriptome
Number of Sequences	309
Average Sequence Length	44 residues
Representative Sequence	VFSNRPDANHRYMTDRAVRDQMVAKGWLAEGDGPDLVVMCAPQ
Number of Associated Samples	205
Number of Associated Scaffolds	309

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	0.97 %
% of genes near scaffold ends (potentially truncated)	95.15 %
% of genes from short scaffolds (< 2000 bps)	94.50 %
Associated GOLD sequencing projects	176
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.53

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (89.644 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere (12.298 % of family members)
Environment Ontology (ENVO)	Unclassified (60.841 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (62.460 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 12.68% β-sheet: 11.27% Coil/Unstructured: 76.06%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.53
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.53
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 309 Family Scaffolds
PF02321	OEP	3.56
PF00171	Aldedh	2.91
PF07690	MFS_1	2.91
PF00578	AhpC-TSA	1.62
PF01757	Acyl_transf_3	1.62
PF00795	CN_hydrolase	1.62
PF00535	Glycos_transf_2	1.29
PF00378	ECH_1	1.29
PF00300	His_Phos_1	1.29
PF01070	FMN_dh	1.29
PF13472	Lipase_GDSL_2	0.97
PF02518	HATPase_c	0.97
PF01544	CorA	0.97
PF02350	Epimerase_2	0.97
PF05532	CsbD	0.97
PF00892	EamA	0.97
PF01551	Peptidase_M23	0.97
PF08402	TOBE_2	0.97
PF03466	LysR_substrate	0.97
PF03887	YfbU	0.65
PF00196	GerE	0.65
PF09906	DUF2135	0.65
PF04366	Ysc84	0.65
PF13378	MR_MLE_C	0.65
PF01370	Epimerase	0.65
PF04542	Sigma70_r2	0.65
PF00271	Helicase_C	0.65
PF03472	Autoind_bind	0.65
PF13517	FG-GAP_3	0.65
PF00072	Response_reg	0.65
PF13368	Toprim_C_rpt	0.65
PF00293	NUDIX	0.65
PF00583	Acetyltransf_1	0.65
PF05193	Peptidase_M16_C	0.32
PF00501	AMP-binding	0.32
PF00873	ACR_tran	0.32
PF11219	DUF3014	0.32
PF01979	Amidohydro_1	0.32
PF03480	DctP	0.32
PF16658	RF3_C	0.32
PF01220	DHquinase_II	0.32
PF00156	Pribosyltran	0.32
PF00392	GntR	0.32
PF00005	ABC_tran	0.32
PF13673	Acetyltransf_10	0.32
PF03575	Peptidase_S51	0.32
PF03704	BTAD	0.32
PF13231	PMT_2	0.32
PF13193	AMP-binding_C	0.32
PF04397	LytTR	0.32
PF00085	Thioredoxin	0.32
PF00381	PTS-HPr	0.32
PF03144	GTP_EFTU_D2	0.32
PF00561	Abhydrolase_1	0.32
PF03618	Kinase-PPPase	0.32
PF02852	Pyr_redox_dim	0.32
PF00162	PGK	0.32
PF12399	BCA_ABC_TP_C	0.32
PF06983	3-dmu-9_3-mt	0.32
PF09459	EB_dh	0.32
PF02586	SRAP	0.32
PF00012	HSP70	0.32
PF13377	Peripla_BP_3	0.32
PF06146	PsiE	0.32
PF05488	PAAR_motif	0.32
PF04828	GFA	0.32
PF13683	rve_3	0.32
PF08352	oligo_HPY	0.32
PF01839	FG-GAP	0.32
PF13544	Obsolete Pfam Family	0.32
PF04380	BMFP	0.32
PF05362	Lon_C	0.32
PF00903	Glyoxalase	0.32
PF00310	GATase_2	0.32
PF07681	DoxX	0.32
PF07992	Pyr_redox_2	0.32
PF00528	BPD_transp_1	0.32
PF01467	CTP_transf_like	0.32
PF02595	Gly_kinase	0.32
PF01208	URO-D	0.32
PF13649	Methyltransf_25	0.32
PF13511	DUF4124	0.32
PF13442	Cytochrome_CBB3	0.32
PF07732	Cu-oxidase_3	0.32
PF11008	DUF2846	0.32
PF01734	Patatin	0.32
PF03364	Polyketide_cyc	0.32
PF00793	DAHP_synth_1	0.32
PF06742	DUF1214	0.32
PF01163	RIO1	0.32
PF00665	rve	0.32
PF00656	Peptidase_C14	0.32
PF13551	HTH_29	0.32
PF07731	Cu-oxidase_2	0.32
PF10049	DUF2283	0.32
PF00268	Ribonuc_red_sm	0.32
PF13560	HTH_31	0.32
PF00701	DHDPS	0.32
PF02678	Pirin	0.32
PF10518	TAT_signal	0.32
PF13419	HAD_2	0.32
PF01230	HIT	0.32

COG ID	Name	Functional Category	% Frequency in 309 Family Scaffolds
COG1538	Outer membrane protein TolC	Cell wall/membrane/envelope biogenesis [M]	7.12
COG0014	Gamma-glutamyl phosphate reductase	Amino acid transport and metabolism [E]	2.91
COG4230	Delta 1-pyrroline-5-carboxylate dehydrogenase	Amino acid transport and metabolism [E]	2.91
COG1012	Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase	Lipid transport and metabolism [I]	2.91
COG0069	Glutamate synthase domain 2	Amino acid transport and metabolism [E]	1.29
COG2197	DNA-binding response regulator, NarL/FixJ family, contains REC and HTH domains	Transcription [K]	1.29
COG1304	FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase	Energy production and conversion [C]	1.29
COG0598	Mg2+ and Co2+ transporter CorA	Inorganic ion transport and metabolism [P]	0.97
COG0707	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase	Cell wall/membrane/envelope biogenesis [M]	0.97
COG0381	UDP-N-acetylglucosamine 2-epimerase	Cell wall/membrane/envelope biogenesis [M]	0.97
COG3237	Uncharacterized conserved protein YjbJ, UPF0337 family	Function unknown [S]	0.97
COG1191	DNA-directed RNA polymerase specialized sigma subunit	Transcription [K]	0.65
COG2132	Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA)	Cell cycle control, cell division, chromosome partitioning [D]	0.65
COG1595	DNA-directed RNA polymerase specialized sigma subunit, sigma24 family	Transcription [K]	0.65
COG0329	4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase	Cell wall/membrane/envelope biogenesis [M]	0.65
COG4941	Predicted RNA polymerase sigma factor, contains C-terminal TPR domain	Transcription [K]	0.65
COG0568	DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)	Transcription [K]	0.65
COG2930	Lipid-binding SYLF domain, Ysc84/FYVE family	Lipid transport and metabolism [I]	0.65
COG4104	Zn-binding Pro-Ala-Ala-Arg (PAAR) domain, involved in Type VI secretion	Intracellular trafficking, secretion, and vesicular transport [U]	0.32
COG3223	Phosphate starvation-inducible membrane PsiE (function unknown)	General function prediction only [R]	0.32
COG3316	Transposase (or an inactivated derivative), DDE domain	Mobilome: prophages, transposons [X]	0.32
COG3480	Predicted secreted protein YlbL, contains PDZ domain	Signal transduction mechanisms [T]	0.32
COG5402	Uncharacterized protein, contains DUF1214 domain	Function unknown [S]	0.32
COG3621	Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR	General function prediction only [R]	0.32
COG3629	DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domain	Transcription [K]	0.32
COG3791	Uncharacterized conserved protein	Function unknown [S]	0.32
COG3865	Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase	General function prediction only [R]	0.32
COG3947	Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains	Transcription [K]	0.32
COG4667	Predicted phospholipase, patatin/cPLA2 family	Lipid transport and metabolism [I]	0.32
COG5361	Uncharacterized conserved protein	Mobilome: prophages, transposons [X]	0.32
COG4249	Uncharacterized conserved protein, contains caspase domain	General function prediction only [R]	0.32
COG4270	Uncharacterized membrane protein	Function unknown [S]	0.32
COG4584	Transposase	Mobilome: prophages, transposons [X]	0.32
COG1752	Predicted acylesterase/phospholipase RssA, containd patatin domain	General function prediction only [R]	0.32
COG0126	3-phosphoglycerate kinase	Carbohydrate transport and metabolism [G]	0.32
COG0208	Ribonucleotide reductase beta subunit, ferritin-like domain	Nucleotide transport and metabolism [F]	0.32
COG0407	Uroporphyrinogen-III decarboxylase HemE	Coenzyme transport and metabolism [H]	0.32
COG0443	Molecular chaperone DnaK (HSP70)	Posttranslational modification, protein turnover, chaperones [O]	0.32
COG0466	ATP-dependent Lon protease, bacterial type	Posttranslational modification, protein turnover, chaperones [O]	0.32
COG0757	3-dehydroquinate dehydratase	Amino acid transport and metabolism [E]	0.32
COG1067	Predicted ATP-dependent protease	Posttranslational modification, protein turnover, chaperones [O]	0.32
COG1741	Redox-sensitive bicupin YhaK, pirin superfamily	General function prediction only [R]	0.32
COG1750	Predicted archaeal serine protease, S18 family	General function prediction only [R]	0.32
COG2960	Ubiquinone biosynthesis accessory factor UbiK	Coenzyme transport and metabolism [H]	0.32
COG1806	Regulator of PEP synthase PpsR, kinase-PPPase family (combines ADP:protein kinase and phosphorylase activities)	Signal transduction mechanisms [T]	0.32
COG1925	HPr or related phosphotransfer protein	Signal transduction mechanisms [T]	0.32
COG1929	Glycerate kinase	Carbohydrate transport and metabolism [G]	0.32
COG2135	ssDNA abasic site-binding protein YedK/HMCES, SRAP family	Replication, recombination and repair [L]	0.32
COG2259	Uncharacterized membrane protein YphA, DoxX/SURF4 family	Function unknown [S]	0.32
COG2764	Zn-dependent glyoxalase, PhnB family	Energy production and conversion [C]	0.32
COG2801	Transposase InsO and inactivated derivatives	Mobilome: prophages, transposons [X]	0.32
COG2826	Transposase and inactivated derivatives, IS30 family	Mobilome: prophages, transposons [X]	0.32

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	89.64 %
Unclassified	root	N/A	10.36 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	89.64 %
Unclassified	root	N/A	10.36 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	89.64 %
Unclassified	root	N/A	10.36 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	69.26 %
Unclassified	root	N/A	10.36 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.32 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	0.65 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.97 %

Name	Rank	Taxonomy	Distribution
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	49.51 %
Unclassified	root	N/A	10.36 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	5.18 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2.27 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	0.32 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.32 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	0.32 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	0.65 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.65 %

Name	Rank	Taxonomy	Distribution
unclassified Betaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria	17.48 %
Unclassified	root	N/A	10.36 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	5.50 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	5.50 %
Arenicellales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Arenicellales	1.29 %
Chromatiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales	1.29 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	1.29 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1.29 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.32 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.32 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.32 %
Methylococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales	0.32 %
Caulobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales	0.32 %
Anaerolineae	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae	0.32 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	0.65 %

Name	Rank	Taxonomy	Distribution
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	17.15 %
Unclassified	root	N/A	10.36 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	5.18 %
Beijerinckiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae	1.29 %
Arenicellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Arenicellales → Arenicellaceae	1.29 %
Chromatiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	1.29 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	1.94 %
unclassified Anaerolineae	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae	0.32 %
Rhodanobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae	0.32 %
Betaproteobacteria bacterium GR16-43	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium GR16-43	0.32 %
Zoogloeaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae	0.32 %
Desulfuromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales	0.32 %
Methylococcaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae	0.32 %
Caulobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae	0.32 %
Frankiales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales	0.32 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.32 %
unclassified Candidatus Rokubacteria	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria	0.65 %
Alcaligenaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae	0.65 %
unclassified Xanthomonadales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales	0.65 %
Oxalobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae	0.65 %

Name	Rank	Taxonomy	Distribution
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	17.15 %
Unclassified	root	N/A	10.36 %
Aromatoleum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum	5.18 %
Arenicella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Arenicellales → Arenicellaceae → Arenicella	1.29 %
Beijerinckia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia	1.29 %
Anaerolineae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium	0.32 %
Phenylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Phenylobacterium	0.32 %
Oxalobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Oxalobacter	0.32 %
Thauera	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera	0.32 %
Caenimonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Caenimonas	0.32 %
Frankiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae	0.32 %
Geobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae	0.32 %
Dyella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dyella	0.32 %
Limnohabitans	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans	0.32 %
Methylovulum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylovulum	0.32 %
Betaproteobacteria bacterium GR16-43	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium GR16-43	0.32 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.32 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.65 %
Achromobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Achromobacter	0.65 %
Xanthomonadales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	0.65 %
Variovorax	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax	0.97 %
Nitrosococcus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Nitrosococcus	0.97 %

Name	Rank	Taxonomy	Distribution
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	17.15 %
Unclassified	root	N/A	10.36 %
unclassified Aromatoleum	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum	5.18 %
Arenicella xantha	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Arenicellales → Arenicellaceae → Arenicella → Arenicella xantha	1.29 %
unclassified Beijerinckia	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia	1.29 %
Caenimonas soli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Caenimonas → Caenimonas soli	0.32 %
Geomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geomonas	0.32 %
unclassified Phenylobacterium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Phenylobacterium → unclassified Phenylobacterium	0.32 %
Oxalobacter formigenes	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Oxalobacter → Oxalobacter formigenes	0.32 %
Nitrosococcus oceani	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Nitrosococcus → Nitrosococcus oceani	0.32 %
Frankia	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia	0.32 %
Variovorax paradoxus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → Variovorax paradoxus	0.32 %
Thauera aromatica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera → Thauera aromatica	0.32 %
unclassified Variovorax	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax	0.32 %
Anaerolineae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium	0.32 %
Dyella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dyella	0.32 %
Limnohabitans	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans	0.32 %
Methylovulum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylovulum	0.32 %
Betaproteobacteria bacterium GR16-43	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium GR16-43	0.32 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.32 %
Achromobacter marplatensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Achromobacter → Achromobacter marplatensis	0.65 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.65 %
Xanthomonadales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	0.65 %

Name	Rank	Taxonomy	Distribution
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	17.15 %
Unclassified	root	N/A	10.36 %
Aromatoleum sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp.	5.18 %
Beijerinckia sp. L45	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45	1.29 %
Arenicella xantha	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Arenicellales → Arenicellaceae → Arenicella → Arenicella xantha	1.29 %
unclassified Geomonas	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geomonas → unclassified Geomonas	0.32 %
Variovorax sp. URHB0020	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. URHB0020	0.32 %
Phenylobacterium sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Phenylobacterium → unclassified Phenylobacterium → Phenylobacterium sp.	0.32 %
unclassified Frankia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia	0.32 %
Thauera aromatica K172	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera → Thauera aromatica → Thauera aromatica K172	0.32 %
Caenimonas soli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Caenimonas → Caenimonas soli	0.32 %
Oxalobacter formigenes	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Oxalobacter → Oxalobacter formigenes	0.32 %
Nitrosococcus oceani	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Nitrosococcus → Nitrosococcus oceani	0.32 %
Variovorax paradoxus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → Variovorax paradoxus	0.32 %
Anaerolineae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium	0.32 %
Dyella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dyella	0.32 %
Limnohabitans	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans	0.32 %
Methylovulum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylovulum	0.32 %
Betaproteobacteria bacterium GR16-43	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium GR16-43	0.32 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.32 %
Achromobacter marplatensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Achromobacter → Achromobacter marplatensis	0.65 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.65 %
Xanthomonadales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	0.65 %

Name	Rank	Taxonomy	Distribution
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	17.15 %
Unclassified	root	N/A	10.36 %
Aromatoleum sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp.	5.18 %
Beijerinckia sp. L45	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45	1.29 %
Arenicella xantha	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Arenicellales → Arenicellaceae → Arenicella → Arenicella xantha	1.29 %
Geomonas sp. Red32	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geomonas → unclassified Geomonas → Geomonas sp. Red32	0.32 %
Frankia sp. BMG5.36	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. BMG5.36	0.32 %
Variovorax sp. URHB0020	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. URHB0020	0.32 %
Phenylobacterium sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Phenylobacterium → unclassified Phenylobacterium → Phenylobacterium sp.	0.32 %
Thauera aromatica K172	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera → Thauera aromatica → Thauera aromatica K172	0.32 %
Caenimonas soli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Caenimonas → Caenimonas soli	0.32 %
Oxalobacter formigenes	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Oxalobacter → Oxalobacter formigenes	0.32 %
Nitrosococcus oceani	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Nitrosococcus → Nitrosococcus oceani	0.32 %
Variovorax paradoxus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → Variovorax paradoxus	0.32 %
Anaerolineae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium	0.32 %
Dyella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dyella	0.32 %
Limnohabitans	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans	0.32 %
Methylovulum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylovulum	0.32 %
Betaproteobacteria bacterium GR16-43	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium GR16-43	0.32 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.32 %
Achromobacter marplatensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Achromobacter → Achromobacter marplatensis	0.65 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.65 %
Xanthomonadales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	0.65 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2162886012\|MBSR1b_contig_3339001	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	911	Open in IMG/M
3300000364\|INPhiseqgaiiFebDRAFT_105588248	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1200	Open in IMG/M
3300001213\|JGIcombinedJ13530_103053465	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	529	Open in IMG/M
3300001213\|JGIcombinedJ13530_108020211	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	975	Open in IMG/M
3300001213\|JGIcombinedJ13530_109042605	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp.	1721	Open in IMG/M
3300001431\|F14TB_104528183	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	534	Open in IMG/M
3300004050\|Ga0055491_10140480	All Organisms → cellular organisms → Bacteria	627	Open in IMG/M
3300004155\|Ga0066600_10144391	All Organisms → cellular organisms → Bacteria → Proteobacteria	980	Open in IMG/M
3300004155\|Ga0066600_10560134	All Organisms → cellular organisms → Bacteria → Proteobacteria	565	Open in IMG/M
3300005327\|Ga0070658_10335449	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1293	Open in IMG/M
3300005328\|Ga0070676_10774369	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	706	Open in IMG/M
3300005332\|Ga0066388_101431567	All Organisms → cellular organisms → Bacteria	1203	Open in IMG/M
3300005333\|Ga0070677_10606900	All Organisms → cellular organisms → Bacteria → Proteobacteria	607	Open in IMG/M
3300005335\|Ga0070666_10188656	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1448	Open in IMG/M
3300005335\|Ga0070666_10909547	All Organisms → cellular organisms → Bacteria	651	Open in IMG/M
3300005336\|Ga0070680_101862868	All Organisms → cellular organisms → Bacteria → Proteobacteria	521	Open in IMG/M
3300005339\|Ga0070660_101292384	All Organisms → cellular organisms → Bacteria	619	Open in IMG/M
3300005340\|Ga0070689_101219102	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Achromobacter → Achromobacter marplatensis	676	Open in IMG/M
3300005344\|Ga0070661_100384604	All Organisms → cellular organisms → Bacteria	1107	Open in IMG/M
3300005344\|Ga0070661_100684110	All Organisms → cellular organisms → Bacteria → Proteobacteria	835	Open in IMG/M
3300005344\|Ga0070661_101580256	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	554	Open in IMG/M
3300005347\|Ga0070668_102187285	All Organisms → cellular organisms → Bacteria → Proteobacteria	511	Open in IMG/M
3300005353\|Ga0070669_100628441	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans	902	Open in IMG/M
3300005353\|Ga0070669_100657533	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	882	Open in IMG/M
3300005353\|Ga0070669_100818199	All Organisms → cellular organisms → Bacteria → Proteobacteria	792	Open in IMG/M
3300005353\|Ga0070669_101123608	All Organisms → cellular organisms → Bacteria	677	Open in IMG/M
3300005354\|Ga0070675_100029737	All Organisms → cellular organisms → Bacteria → Proteobacteria	4408	Open in IMG/M
3300005354\|Ga0070675_101344275	Not Available	659	Open in IMG/M
3300005354\|Ga0070675_101948119	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	542	Open in IMG/M
3300005364\|Ga0070673_101702193	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	597	Open in IMG/M
3300005365\|Ga0070688_101569103	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	537	Open in IMG/M
3300005366\|Ga0070659_100686469	All Organisms → cellular organisms → Bacteria	885	Open in IMG/M
3300005366\|Ga0070659_101716234	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Nitrosococcus	562	Open in IMG/M
3300005367\|Ga0070667_100738754	All Organisms → cellular organisms → Bacteria	912	Open in IMG/M
3300005367\|Ga0070667_101061551	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	757	Open in IMG/M
3300005367\|Ga0070667_101606930	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	611	Open in IMG/M
3300005439\|Ga0070711_101327963	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp.	624	Open in IMG/M
3300005439\|Ga0070711_101630901	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	564	Open in IMG/M
3300005456\|Ga0070678_100535440	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → Variovorax paradoxus	1038	Open in IMG/M
3300005457\|Ga0070662_100549168	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	968	Open in IMG/M
3300005459\|Ga0068867_100163055	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1759	Open in IMG/M
3300005468\|Ga0070707_100994461	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	804	Open in IMG/M
3300005491\|Ga0074212_108274	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp.	821	Open in IMG/M
3300005539\|Ga0068853_100446752	Not Available	1216	Open in IMG/M
3300005539\|Ga0068853_101050904	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	785	Open in IMG/M
3300005539\|Ga0068853_101973254	All Organisms → cellular organisms → Bacteria	566	Open in IMG/M
3300005539\|Ga0068853_102177005	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Nitrosococcus	538	Open in IMG/M
3300005543\|Ga0070672_101006248	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	739	Open in IMG/M
3300005543\|Ga0070672_101018651	All Organisms → cellular organisms → Bacteria	734	Open in IMG/M
3300005543\|Ga0070672_102060730	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	514	Open in IMG/M
3300005547\|Ga0070693_101161977	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	591	Open in IMG/M
3300005547\|Ga0070693_101348344	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	553	Open in IMG/M
3300005548\|Ga0070665_101093934	Not Available	809	Open in IMG/M
3300005548\|Ga0070665_101679124	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	643	Open in IMG/M
3300005548\|Ga0070665_102463138	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	522	Open in IMG/M
3300005563\|Ga0068855_102318123	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	537	Open in IMG/M
3300005564\|Ga0070664_100875962	All Organisms → cellular organisms → Bacteria	841	Open in IMG/M
3300005578\|Ga0068854_100238763	All Organisms → cellular organisms → Bacteria	1446	Open in IMG/M
3300005614\|Ga0068856_100458163	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1296	Open in IMG/M
3300005614\|Ga0068856_102469763	All Organisms → cellular organisms → Bacteria	527	Open in IMG/M
3300005615\|Ga0070702_100566608	All Organisms → cellular organisms → Bacteria → Proteobacteria	846	Open in IMG/M
3300005616\|Ga0068852_100373706	All Organisms → cellular organisms → Bacteria → Proteobacteria	1397	Open in IMG/M
3300005616\|Ga0068852_100694477	All Organisms → cellular organisms → Bacteria	1027	Open in IMG/M
3300005617\|Ga0068859_100043841	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	4496	Open in IMG/M
3300005618\|Ga0068864_101987247	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp.	587	Open in IMG/M
3300005618\|Ga0068864_102132309	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp.	567	Open in IMG/M
3300005719\|Ga0068861_100105037	All Organisms → cellular organisms → Bacteria → Proteobacteria	2255	Open in IMG/M
3300005719\|Ga0068861_100286673	All Organisms → cellular organisms → Bacteria	1420	Open in IMG/M
3300005834\|Ga0068851_11036009	All Organisms → cellular organisms → Bacteria	519	Open in IMG/M
3300005834\|Ga0068851_11043663	All Organisms → cellular organisms → Bacteria → Proteobacteria	517	Open in IMG/M
3300005840\|Ga0068870_10468843	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	833	Open in IMG/M
3300005841\|Ga0068863_100355358	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	1427	Open in IMG/M
3300005842\|Ga0068858_100855027	All Organisms → cellular organisms → Bacteria → Proteobacteria	888	Open in IMG/M
3300005842\|Ga0068858_101858770	All Organisms → cellular organisms → Bacteria	595	Open in IMG/M
3300005842\|Ga0068858_102244036	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	540	Open in IMG/M
3300005843\|Ga0068860_100906823	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	898	Open in IMG/M
3300005844\|Ga0068862_100318533	All Organisms → cellular organisms → Bacteria → Proteobacteria	1435	Open in IMG/M
3300005844\|Ga0068862_100458726	Not Available	1203	Open in IMG/M
3300005901\|Ga0075274_1022935	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	855	Open in IMG/M
3300005937\|Ga0081455_10233765	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium	1355	Open in IMG/M
3300005940\|Ga0073913_10088736	All Organisms → cellular organisms → Bacteria → Proteobacteria	529	Open in IMG/M
3300006224\|Ga0079037_101884459	All Organisms → cellular organisms → Bacteria	597	Open in IMG/M
3300006237\|Ga0097621_100534970	All Organisms → cellular organisms → Bacteria	1065	Open in IMG/M
3300006237\|Ga0097621_100599590	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1007	Open in IMG/M
3300006237\|Ga0097621_100815720	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	865	Open in IMG/M
3300006358\|Ga0068871_102019946	Not Available	549	Open in IMG/M
3300006606\|Ga0074062_12824197	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	799	Open in IMG/M
3300006846\|Ga0075430_100683852	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Nitrosococcus → Nitrosococcus oceani	846	Open in IMG/M
3300006852\|Ga0075433_10164806	All Organisms → cellular organisms → Bacteria → Proteobacteria	1973	Open in IMG/M
3300006852\|Ga0075433_11604379	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	561	Open in IMG/M
3300006881\|Ga0068865_100426663	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1091	Open in IMG/M
3300006881\|Ga0068865_100830443	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	799	Open in IMG/M
3300006904\|Ga0075424_100839159	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	980	Open in IMG/M
3300006904\|Ga0075424_101385069	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp.	747	Open in IMG/M
3300006904\|Ga0075424_102002085	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	611	Open in IMG/M
3300006914\|Ga0075436_101122437	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	592	Open in IMG/M
3300006954\|Ga0079219_11256923	All Organisms → cellular organisms → Bacteria → Proteobacteria	647	Open in IMG/M
3300007076\|Ga0075435_100476971	All Organisms → cellular organisms → Bacteria → Proteobacteria	1077	Open in IMG/M
3300007076\|Ga0075435_101478626	All Organisms → cellular organisms → Bacteria	596	Open in IMG/M
3300009011\|Ga0105251_10180693	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	950	Open in IMG/M
3300009075\|Ga0105090_10790732	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	576	Open in IMG/M
3300009087\|Ga0105107_11075147	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	560	Open in IMG/M
3300009098\|Ga0105245_12029926	All Organisms → cellular organisms → Bacteria	628	Open in IMG/M
3300009148\|Ga0105243_13057425	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	507	Open in IMG/M
3300009167\|Ga0113563_10277986	All Organisms → cellular organisms → Bacteria	1722	Open in IMG/M
3300009167\|Ga0113563_12355035	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	641	Open in IMG/M
3300009176\|Ga0105242_12676696	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	548	Open in IMG/M
3300009177\|Ga0105248_12073145	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	646	Open in IMG/M
3300009177\|Ga0105248_12714201	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	565	Open in IMG/M
3300009430\|Ga0114938_1020346	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	2737	Open in IMG/M
3300009455\|Ga0114939_10005239	All Organisms → cellular organisms → Bacteria → Proteobacteria	8194	Open in IMG/M
3300009455\|Ga0114939_10080580	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1387	Open in IMG/M
3300009540\|Ga0073899_11104071	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp.	555	Open in IMG/M
3300009553\|Ga0105249_13529659	All Organisms → cellular organisms → Bacteria	504	Open in IMG/M
3300010154\|Ga0127503_10415481	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp.	1137	Open in IMG/M
3300010397\|Ga0134124_11339415	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	740	Open in IMG/M
3300010397\|Ga0134124_12053497	Not Available	609	Open in IMG/M
3300010397\|Ga0134124_12759486	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	535	Open in IMG/M
3300010400\|Ga0134122_12724274	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	546	Open in IMG/M
3300010403\|Ga0134123_10035634	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	3657	Open in IMG/M
3300011106\|Ga0151489_1337156	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	552	Open in IMG/M
3300012211\|Ga0137377_11903974	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	512	Open in IMG/M
3300012212\|Ga0150985_115642542	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	648	Open in IMG/M
3300012357\|Ga0137384_10948908	All Organisms → cellular organisms → Bacteria	692	Open in IMG/M
3300012533\|Ga0138256_11186723	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp.	567	Open in IMG/M
3300012923\|Ga0137359_11529788	Not Available	555	Open in IMG/M
3300013105\|Ga0157369_10841449	All Organisms → cellular organisms → Bacteria	942	Open in IMG/M
3300013296\|Ga0157374_11044445	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	837	Open in IMG/M
3300013296\|Ga0157374_11415489	Not Available	718	Open in IMG/M
3300013297\|Ga0157378_10017253	All Organisms → cellular organisms → Bacteria → Proteobacteria	6331	Open in IMG/M
3300013297\|Ga0157378_10075504	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. URHB0020	3035	Open in IMG/M
3300013297\|Ga0157378_10204365	All Organisms → cellular organisms → Bacteria → Proteobacteria	1870	Open in IMG/M
3300013297\|Ga0157378_10509408	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1203	Open in IMG/M
3300013306\|Ga0163162_11539044	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Achromobacter → Achromobacter marplatensis	758	Open in IMG/M
3300013307\|Ga0157372_10935646	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Arenicellales → Arenicellaceae → Arenicella → Arenicella xantha	1005	Open in IMG/M
3300013308\|Ga0157375_10358003	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1625	Open in IMG/M
3300013308\|Ga0157375_11489874	All Organisms → cellular organisms → Bacteria	798	Open in IMG/M
3300013308\|Ga0157375_11933605	Not Available	700	Open in IMG/M
3300013308\|Ga0157375_12398801	All Organisms → cellular organisms → Bacteria	629	Open in IMG/M
3300013308\|Ga0157375_13491973	All Organisms → cellular organisms → Bacteria	523	Open in IMG/M
3300014157\|Ga0134078_10512153	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	560	Open in IMG/M
3300014303\|Ga0075358_1099509	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	571	Open in IMG/M
3300014312\|Ga0075345_1133079	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	586	Open in IMG/M
3300014323\|Ga0075356_1224199	All Organisms → cellular organisms → Bacteria → Proteobacteria	516	Open in IMG/M
3300014325\|Ga0163163_11674464	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	697	Open in IMG/M
3300014325\|Ga0163163_11917607	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	652	Open in IMG/M
3300014325\|Ga0163163_12457672	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp.	579	Open in IMG/M
3300014968\|Ga0157379_10175232	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1936	Open in IMG/M
3300014968\|Ga0157379_11644999	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium GR16-43	628	Open in IMG/M
3300014968\|Ga0157379_11653740	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	626	Open in IMG/M
3300014968\|Ga0157379_12538548	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	513	Open in IMG/M
3300014969\|Ga0157376_10718930	All Organisms → cellular organisms → Bacteria	1005	Open in IMG/M
3300014969\|Ga0157376_11187898	Not Available	791	Open in IMG/M
3300015371\|Ga0132258_12602120	All Organisms → cellular organisms → Bacteria → Proteobacteria	1264	Open in IMG/M
3300015374\|Ga0132255_102010810	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	880	Open in IMG/M
3300016357\|Ga0182032_10365906	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45	1158	Open in IMG/M
3300016357\|Ga0182032_10682867	Not Available	861	Open in IMG/M
3300016387\|Ga0182040_10284327	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1258	Open in IMG/M
3300016422\|Ga0182039_11091720	Not Available	718	Open in IMG/M
3300016445\|Ga0182038_10312804	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1288	Open in IMG/M
3300016445\|Ga0182038_10579484	All Organisms → cellular organisms → Bacteria	966	Open in IMG/M
3300017936\|Ga0187821_10313817	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	625	Open in IMG/M
3300017947\|Ga0187785_10643182	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Phenylobacterium → unclassified Phenylobacterium → Phenylobacterium sp.	550	Open in IMG/M
3300017959\|Ga0187779_10320255	Not Available	996	Open in IMG/M
3300018468\|Ga0066662_10791315	All Organisms → cellular organisms → Bacteria	919	Open in IMG/M
3300018476\|Ga0190274_13482482	All Organisms → cellular organisms → Bacteria → Proteobacteria	531	Open in IMG/M
3300020004\|Ga0193755_1192731	Not Available	588	Open in IMG/M
3300021432\|Ga0210384_10923883	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	773	Open in IMG/M
3300021445\|Ga0182009_10378280	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	728	Open in IMG/M
3300021445\|Ga0182009_10441773	Not Available	678	Open in IMG/M
3300025130\|Ga0209594_1010616	All Organisms → cellular organisms → Bacteria	3665	Open in IMG/M
3300025321\|Ga0207656_10695087	All Organisms → cellular organisms → Bacteria	521	Open in IMG/M
3300025900\|Ga0207710_10777020	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	503	Open in IMG/M
3300025903\|Ga0207680_11041566	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	586	Open in IMG/M
3300025907\|Ga0207645_10915687	Not Available	595	Open in IMG/M
3300025908\|Ga0207643_10259917	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1072	Open in IMG/M
3300025923\|Ga0207681_10930830	All Organisms → cellular organisms → Bacteria	728	Open in IMG/M
3300025923\|Ga0207681_11189772	All Organisms → cellular organisms → Bacteria	640	Open in IMG/M
3300025923\|Ga0207681_11400492	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	587	Open in IMG/M
3300025923\|Ga0207681_11426991	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	581	Open in IMG/M
3300025925\|Ga0207650_10233915	All Organisms → cellular organisms → Bacteria	1483	Open in IMG/M
3300025925\|Ga0207650_10717349	All Organisms → cellular organisms → Bacteria → Proteobacteria	845	Open in IMG/M
3300025926\|Ga0207659_10052561	All Organisms → cellular organisms → Bacteria → Proteobacteria	2903	Open in IMG/M
3300025926\|Ga0207659_11453153	Not Available	587	Open in IMG/M
3300025927\|Ga0207687_10562711	All Organisms → cellular organisms → Bacteria	957	Open in IMG/M
3300025927\|Ga0207687_10944633	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Arenicellales → Arenicellaceae → Arenicella → Arenicella xantha	739	Open in IMG/M
3300025930\|Ga0207701_10699761	All Organisms → cellular organisms → Bacteria	858	Open in IMG/M
3300025931\|Ga0207644_10449202	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Arenicellales → Arenicellaceae → Arenicella → Arenicella xantha	1059	Open in IMG/M
3300025931\|Ga0207644_11875241	All Organisms → cellular organisms → Bacteria	501	Open in IMG/M
3300025932\|Ga0207690_10933333	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	721	Open in IMG/M
3300025933\|Ga0207706_10175421	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Arenicellales → Arenicellaceae → Arenicella → Arenicella xantha	1883	Open in IMG/M
3300025933\|Ga0207706_10543053	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1001	Open in IMG/M
3300025933\|Ga0207706_11439567	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	564	Open in IMG/M
3300025937\|Ga0207669_10969238	All Organisms → cellular organisms → Bacteria → Proteobacteria	713	Open in IMG/M
3300025938\|Ga0207704_10076223	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	2148	Open in IMG/M
3300025938\|Ga0207704_10957273	Not Available	722	Open in IMG/M
3300025940\|Ga0207691_10525315	All Organisms → cellular organisms → Bacteria	1004	Open in IMG/M
3300025940\|Ga0207691_11306844	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	599	Open in IMG/M
3300025949\|Ga0207667_11713831	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	595	Open in IMG/M
3300025960\|Ga0207651_11129691	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	703	Open in IMG/M
3300025960\|Ga0207651_11743993	Not Available	561	Open in IMG/M
3300025972\|Ga0207668_10132921	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Oxalobacter → Oxalobacter formigenes	1902	Open in IMG/M
3300025972\|Ga0207668_10161936	All Organisms → cellular organisms → Bacteria	1744	Open in IMG/M
3300025972\|Ga0207668_10439396	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1111	Open in IMG/M
3300025972\|Ga0207668_10528855	All Organisms → cellular organisms → Bacteria	1018	Open in IMG/M
3300025972\|Ga0207668_10679845	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	903	Open in IMG/M
3300025986\|Ga0207658_10226701	All Organisms → cellular organisms → Bacteria	1575	Open in IMG/M
3300025986\|Ga0207658_10443792	Not Available	1148	Open in IMG/M
3300025986\|Ga0207658_11018909	All Organisms → cellular organisms → Bacteria	755	Open in IMG/M
3300025986\|Ga0207658_11629071	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Caenimonas → Caenimonas soli	590	Open in IMG/M
3300025986\|Ga0207658_11734007	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	570	Open in IMG/M
3300025986\|Ga0207658_11898124	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	543	Open in IMG/M
3300026023\|Ga0207677_12289180	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp.	503	Open in IMG/M
3300026035\|Ga0207703_11656637	All Organisms → cellular organisms → Bacteria	615	Open in IMG/M
3300026035\|Ga0207703_11969437	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. BMG5.36	560	Open in IMG/M
3300026041\|Ga0207639_10264248	All Organisms → cellular organisms → Bacteria	1506	Open in IMG/M
3300026041\|Ga0207639_10761835	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	900	Open in IMG/M
3300026067\|Ga0207678_10177644	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1818	Open in IMG/M
3300026078\|Ga0207702_11123962	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae	780	Open in IMG/M
3300026078\|Ga0207702_12290128	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	528	Open in IMG/M
3300026088\|Ga0207641_10417614	All Organisms → cellular organisms → Bacteria → Proteobacteria	1291	Open in IMG/M
3300026088\|Ga0207641_10483725	All Organisms → cellular organisms → Bacteria	1200	Open in IMG/M
3300026088\|Ga0207641_12131665	All Organisms → cellular organisms → Bacteria → Proteobacteria	561	Open in IMG/M
3300026088\|Ga0207641_12513556	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	513	Open in IMG/M
3300026089\|Ga0207648_10009975	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dyella	9041	Open in IMG/M
3300026089\|Ga0207648_10507973	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax	1103	Open in IMG/M
3300026095\|Ga0207676_10769223	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	938	Open in IMG/M
3300026121\|Ga0207683_11103189	All Organisms → cellular organisms → Bacteria	736	Open in IMG/M
3300026121\|Ga0207683_11412471	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera → Thauera aromatica → Thauera aromatica K172	643	Open in IMG/M
3300026142\|Ga0207698_10782586	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	955	Open in IMG/M
3300026142\|Ga0207698_12242274	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	559	Open in IMG/M
3300027691\|Ga0209485_1074303	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	916	Open in IMG/M
3300027850\|Ga0209591_10008439	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	11223	Open in IMG/M
3300027871\|Ga0209397_10031704	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1802	Open in IMG/M
3300027876\|Ga0209974_10403117	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	537	Open in IMG/M
3300027877\|Ga0209293_10105595	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1282	Open in IMG/M
3300027878\|Ga0209181_10122761	Not Available	2482	Open in IMG/M
3300027885\|Ga0209450_10848744	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geomonas → unclassified Geomonas → Geomonas sp. Red32	656	Open in IMG/M
3300027885\|Ga0209450_11189530	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	530	Open in IMG/M
3300027897\|Ga0209254_10831957	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	621	Open in IMG/M
3300027899\|Ga0209668_10406181	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	892	Open in IMG/M
3300027900\|Ga0209253_11054904	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	557	Open in IMG/M
3300027909\|Ga0209382_10754750	Not Available	1041	Open in IMG/M
3300028379\|Ga0268266_10126927	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2278	Open in IMG/M
3300028379\|Ga0268266_12053403	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	545	Open in IMG/M
3300028380\|Ga0268265_10587258	Not Available	1063	Open in IMG/M
3300028380\|Ga0268265_11308145	All Organisms → cellular organisms → Bacteria	725	Open in IMG/M
3300028380\|Ga0268265_11729428	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	631	Open in IMG/M
3300028381\|Ga0268264_10823624	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	928	Open in IMG/M
3300028381\|Ga0268264_12231059	All Organisms → cellular organisms → Bacteria	555	Open in IMG/M
3300028590\|Ga0247823_10651582	Not Available	792	Open in IMG/M
3300028592\|Ga0247822_11763066	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	528	Open in IMG/M
3300029987\|Ga0311334_10304385	All Organisms → cellular organisms → Bacteria → Proteobacteria	1246	Open in IMG/M
3300029990\|Ga0311336_10915920	All Organisms → cellular organisms → Bacteria → Proteobacteria	759	Open in IMG/M
3300030000\|Ga0311337_10557481	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	983	Open in IMG/M
3300030002\|Ga0311350_11851441	Not Available	532	Open in IMG/M
3300030019\|Ga0311348_11028971	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	613	Open in IMG/M
3300031521\|Ga0311364_12478714	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp.	505	Open in IMG/M
3300031538\|Ga0310888_10239218	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1014	Open in IMG/M
3300031547\|Ga0310887_10501200	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylovulum	731	Open in IMG/M
3300031547\|Ga0310887_10683099	All Organisms → cellular organisms → Bacteria	636	Open in IMG/M
3300031561\|Ga0318528_10729503	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	530	Open in IMG/M
3300031562\|Ga0310886_10409871	All Organisms → cellular organisms → Bacteria	801	Open in IMG/M
3300031726\|Ga0302321_100901743	All Organisms → cellular organisms → Bacteria → Proteobacteria	1002	Open in IMG/M
3300031769\|Ga0318526_10439660	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp.	533	Open in IMG/M
3300031771\|Ga0318546_10260255	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45	1195	Open in IMG/M
3300031777\|Ga0318543_10141338	All Organisms → cellular organisms → Bacteria	1054	Open in IMG/M
3300031792\|Ga0318529_10285049	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	769	Open in IMG/M
3300031805\|Ga0318497_10621264	Not Available	606	Open in IMG/M
3300031847\|Ga0310907_10613812	All Organisms → cellular organisms → Bacteria → Proteobacteria	594	Open in IMG/M
3300031858\|Ga0310892_10394445	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	899	Open in IMG/M
3300031901\|Ga0307406_11836068	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	539	Open in IMG/M
3300031902\|Ga0302322_100619318	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp.	1275	Open in IMG/M
3300031902\|Ga0302322_102318764	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	661	Open in IMG/M
3300031938\|Ga0308175_100234588	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1831	Open in IMG/M
3300031939\|Ga0308174_10150875	All Organisms → cellular organisms → Bacteria → Proteobacteria	1729	Open in IMG/M
3300031939\|Ga0308174_10669864	All Organisms → cellular organisms → Bacteria → Proteobacteria	864	Open in IMG/M
3300031939\|Ga0308174_11640254	All Organisms → cellular organisms → Bacteria	552	Open in IMG/M
3300031939\|Ga0308174_11659404	All Organisms → cellular organisms → Bacteria → Proteobacteria	549	Open in IMG/M
3300031939\|Ga0308174_11961243	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	504	Open in IMG/M
3300031947\|Ga0310909_10515285	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1002	Open in IMG/M
3300031995\|Ga0307409_100448059	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	1245	Open in IMG/M
3300032005\|Ga0307411_11659666	All Organisms → cellular organisms → Bacteria	591	Open in IMG/M
3300032013\|Ga0310906_11261607	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp.	539	Open in IMG/M
3300032042\|Ga0318545_10193452	Not Available	727	Open in IMG/M
3300032044\|Ga0318558_10098829	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45	1364	Open in IMG/M
3300032052\|Ga0318506_10457957	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	565	Open in IMG/M
3300032089\|Ga0318525_10281985	All Organisms → cellular organisms → Bacteria	853	Open in IMG/M
3300032143\|Ga0315292_11425035	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	563	Open in IMG/M
3300032164\|Ga0315283_11998874	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	577	Open in IMG/M
3300032275\|Ga0315270_11060088	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	538	Open in IMG/M
3300032276\|Ga0316188_10514986	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	640	Open in IMG/M
3300032770\|Ga0335085_11116565	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	844	Open in IMG/M
3300032954\|Ga0335083_10001525	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	31684	Open in IMG/M
3300033289\|Ga0310914_10439365	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45	1181	Open in IMG/M
3300033408\|Ga0316605_10943022	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	826	Open in IMG/M
3300033413\|Ga0316603_11007831	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	786	Open in IMG/M
3300033414\|Ga0316619_12157861	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	509	Open in IMG/M
3300033418\|Ga0316625_100146748	All Organisms → cellular organisms → Bacteria	1447	Open in IMG/M
3300033418\|Ga0316625_100286159	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	1162	Open in IMG/M
3300033481\|Ga0316600_10746641	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	689	Open in IMG/M
3300033482\|Ga0316627_100268904	Not Available	1374	Open in IMG/M
3300033482\|Ga0316627_100341967	Not Available	1253	Open in IMG/M
3300033483\|Ga0316629_10935252	Not Available	676	Open in IMG/M
3300033513\|Ga0316628_103430652	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp.	573	Open in IMG/M
3300033550\|Ga0247829_11062660	Not Available	672	Open in IMG/M
3300034177\|Ga0364932_0365513	All Organisms → cellular organisms → Bacteria → Proteobacteria	544	Open in IMG/M
3300034691\|Ga0370488_129455	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	731	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	58.25%
Environmental	Environmental	41.10%
Engineered	Engineered	0.65%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	58.25%
Terrestrial	Environmental → Terrestrial	31.07%
Aquatic	Environmental → Aquatic	10.03%
Wastewater	Engineered → Wastewater	0.65%

Habitat	Taxonomy	Distribution
Rhizosphere	Host-Associated → Plants → Rhizosphere	34.95%
Soil	Environmental → Terrestrial → Soil	27.83%
Rhizoplane	Host-Associated → Plants → Rhizoplane	21.04%
Freshwater	Environmental → Aquatic → Freshwater	8.41%
Peat	Environmental → Terrestrial → Peat	2.91%
Roots	Host-Associated → Plants → Roots	2.27%
Marine	Environmental → Aquatic → Marine	1.62%
Activated Sludge	Engineered → Wastewater → Activated Sludge	0.65%
Floodplain	Environmental → Terrestrial → Floodplain	0.32%

Habitat	Taxonomy	Distribution
Soil	Host-Associated → Plants → Rhizosphere → Soil	21.36%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	18.77%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	17.80%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	13.59%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	6.15%
Loam	Environmental → Terrestrial → Soil → Loam	3.56%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	2.91%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	2.27%
Lentic	Environmental → Aquatic → Freshwater → Lentic	1.94%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	1.62%
Sediment	Environmental → Aquatic → Freshwater → Sediment	1.29%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	1.29%
Wetlands	Environmental → Aquatic → Marine → Wetlands	1.29%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.29%
Lake	Environmental → Aquatic → Freshwater → Lake	0.97%
Soil	Host-Associated → Plants → Rhizoplane → Soil	0.97%
Ice	Environmental → Aquatic → Freshwater → Ice	0.65%
Pond	Environmental → Aquatic → Freshwater → Pond	0.65%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified	0.65%
Coastal	Environmental → Aquatic → Marine → Coastal	0.32%
Sand	Environmental → Terrestrial → Soil → Sand	0.32%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.32%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	21.36%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	18.77%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	13.59%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	6.15%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	6.15%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	5.18%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	4.85%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	2.91%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	2.91%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	2.27%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment	1.94%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	1.62%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	1.29%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.29%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	0.97%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	0.97%
Sediment	Environmental → Aquatic → Marine → Wetlands → Sediment	0.97%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	0.97%
Unclassified	Host-Associated → Plants → Rhizoplane → Soil → Unclassified	0.97%
Glacial Lake	Environmental → Aquatic → Freshwater → Ice → Glacial Lake	0.65%
Sediment	Environmental → Aquatic → Freshwater → Pond → Sediment	0.65%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.65%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified	0.65%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	0.32%
Sediment	Environmental → Aquatic → Marine → Coastal → Sediment	0.32%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	0.32%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.32%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	0.32%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	0.32%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.32%

Habitat	Taxonomy	Distribution
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	12.30%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	7.77%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	6.47%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	5.18%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	4.53%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	4.53%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	4.21%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	4.21%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	3.88%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	3.24%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	3.24%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	2.91%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.94%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	1.94%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment	1.62%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.62%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.62%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.62%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater	1.29%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.29%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	1.29%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.29%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	0.97%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	0.97%
Wetland	Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland	0.97%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	0.97%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	0.97%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere	0.97%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.97%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.97%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.65%
Wetland	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland	0.65%
Freshwater	Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater	0.65%
Freshwater	Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater	0.65%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.65%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.65%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.65%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.65%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.65%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.65%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.65%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Sediment	0.32%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	0.32%
Soil	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil	0.32%
Worm Burrow	Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow	0.32%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	0.32%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.32%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	0.32%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.32%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere	0.32%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	0.32%
Rice Paddy Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil	0.32%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.32%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.32%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.32%
Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Sand	0.32%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.32%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere	0.32%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	0.32%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.32%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.32%
Activated Sludge	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge	0.32%
Active Sludge	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge	0.32%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2162886012	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1	Host-Associated	Open in IMG/M
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300001213	Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)	Environmental	Open in IMG/M
3300001431	Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly	Environmental	Open in IMG/M
3300004050	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D2	Environmental	Open in IMG/M
3300004155	Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11	Environmental	Open in IMG/M
3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Host-Associated	Open in IMG/M
3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Host-Associated	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Host-Associated	Open in IMG/M
3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Host-Associated	Open in IMG/M
3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Environmental	Open in IMG/M
3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Host-Associated	Open in IMG/M
3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Environmental	Open in IMG/M
3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Host-Associated	Open in IMG/M
3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Host-Associated	Open in IMG/M
3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Host-Associated	Open in IMG/M
3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Host-Associated	Open in IMG/M
3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Host-Associated	Open in IMG/M
3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Environmental	Open in IMG/M
3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Host-Associated	Open in IMG/M
3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Host-Associated	Open in IMG/M
3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Environmental	Open in IMG/M
3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Host-Associated	Open in IMG/M
3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Host-Associated	Open in IMG/M
3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Host-Associated	Open in IMG/M
3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Environmental	Open in IMG/M
3300005491	Sediment ecosystem from Lake Washington, Seattle, Washington, USA - Formaldehyde enrichment	Environmental	Open in IMG/M
3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Host-Associated	Open in IMG/M
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated	Open in IMG/M
3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Environmental	Open in IMG/M
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated	Open in IMG/M
3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Host-Associated	Open in IMG/M
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated	Open in IMG/M
3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Host-Associated	Open in IMG/M
3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Host-Associated	Open in IMG/M
3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Environmental	Open in IMG/M
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Host-Associated	Open in IMG/M
3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Host-Associated	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated	Open in IMG/M
3300005901	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_201	Environmental	Open in IMG/M
3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated	Open in IMG/M
3300005940	Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14	Environmental	Open in IMG/M
3300006224	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG	Environmental	Open in IMG/M
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated	Open in IMG/M
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated	Open in IMG/M
3300006606	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006846	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Host-Associated	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300006914	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Host-Associated	Open in IMG/M
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental	Open in IMG/M
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated	Open in IMG/M
3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Host-Associated	Open in IMG/M
3300009075	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015	Environmental	Open in IMG/M
3300009087	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015	Environmental	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009167	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)	Environmental	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300009430	Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Big Spring	Environmental	Open in IMG/M
3300009455	Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Crystal Spring	Environmental	Open in IMG/M
3300009540	Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB5-Ph	Engineered	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300010154	Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300011106	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300012211	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012357	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG	Environmental	Open in IMG/M
3300012533	Active sludge microbial communities from wastewater in Klosterneuburg, Austria - KNB2014incub_MG	Engineered	Open in IMG/M
3300012923	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG	Environmental	Open in IMG/M
3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Host-Associated	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Host-Associated	Open in IMG/M
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated	Open in IMG/M
3300014157	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG	Environmental	Open in IMG/M
3300014303	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleA_D1	Environmental	Open in IMG/M
3300014312	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D1	Environmental	Open in IMG/M
3300014323	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailB_D1	Environmental	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300016357	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000	Environmental	Open in IMG/M
3300016387	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176	Environmental	Open in IMG/M
3300016422	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111	Environmental	Open in IMG/M
3300016445	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108	Environmental	Open in IMG/M
3300017936	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1	Environmental	Open in IMG/M
3300017947	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG	Environmental	Open in IMG/M
3300017959	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG	Environmental	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental	Open in IMG/M
3300020004	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2	Environmental	Open in IMG/M
3300021432	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M	Environmental	Open in IMG/M
3300021445	Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG	Environmental	Open in IMG/M
3300025130	Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Crystal Spring (SPAdes)	Environmental	Open in IMG/M
3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025930	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Environmental	Open in IMG/M
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300027691	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes)	Environmental	Open in IMG/M
3300027850	Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01 (SPAdes)	Environmental	Open in IMG/M
3300027871	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes)	Environmental	Open in IMG/M
3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes)	Host-Associated	Open in IMG/M
3300027877	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes)	Environmental	Open in IMG/M
3300027878	Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-05 (SPAdes)	Environmental	Open in IMG/M
3300027885	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes)	Environmental	Open in IMG/M
3300027897	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes)	Environmental	Open in IMG/M
3300027899	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)	Environmental	Open in IMG/M
3300027900	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)	Environmental	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028590	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30	Environmental	Open in IMG/M
3300028592	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30	Environmental	Open in IMG/M
3300029987	I_Fen_E3 coassembly	Environmental	Open in IMG/M
3300029990	I_Fen_N2 coassembly	Environmental	Open in IMG/M
3300030000	I_Fen_N3 coassembly	Environmental	Open in IMG/M
3300030002	II_Fen_N1 coassembly	Environmental	Open in IMG/M
3300030019	II_Fen_E2 coassembly	Environmental	Open in IMG/M
3300031521	III_Fen_E2 coassembly	Environmental	Open in IMG/M
3300031538	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1	Environmental	Open in IMG/M
3300031547	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4	Environmental	Open in IMG/M
3300031561	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26	Environmental	Open in IMG/M
3300031562	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3	Environmental	Open in IMG/M
3300031726	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1	Environmental	Open in IMG/M
3300031769	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24	Environmental	Open in IMG/M
3300031771	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19	Environmental	Open in IMG/M
3300031777	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24	Environmental	Open in IMG/M
3300031792	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23	Environmental	Open in IMG/M
3300031805	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23	Environmental	Open in IMG/M
3300031847	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4	Environmental	Open in IMG/M
3300031858	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2	Environmental	Open in IMG/M
3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Host-Associated	Open in IMG/M
3300031902	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2	Environmental	Open in IMG/M
3300031938	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1	Environmental	Open in IMG/M
3300031939	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2	Environmental	Open in IMG/M
3300031947	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H	Environmental	Open in IMG/M
3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Host-Associated	Open in IMG/M
3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Host-Associated	Open in IMG/M
3300032013	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3	Environmental	Open in IMG/M
3300032042	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26	Environmental	Open in IMG/M
3300032044	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20	Environmental	Open in IMG/M
3300032052	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19	Environmental	Open in IMG/M
3300032089	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23	Environmental	Open in IMG/M
3300032143	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0	Environmental	Open in IMG/M
3300032164	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0	Environmental	Open in IMG/M
3300032275	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom	Environmental	Open in IMG/M
3300032276	Coastal sediment microbial communities from Maine, United States - Phippsburg worm burrow 1	Environmental	Open in IMG/M
3300032770	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5	Environmental	Open in IMG/M
3300032954	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2	Environmental	Open in IMG/M
3300033289	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108	Environmental	Open in IMG/M
3300033408	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT	Environmental	Open in IMG/M
3300033413	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT	Environmental	Open in IMG/M
3300033414	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B	Environmental	Open in IMG/M
3300033418	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A	Environmental	Open in IMG/M
3300033481	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CT	Environmental	Open in IMG/M
3300033482	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C	Environmental	Open in IMG/M
3300033483	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A	Environmental	Open in IMG/M
3300033513	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C	Environmental	Open in IMG/M
3300033550	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4	Environmental	Open in IMG/M
3300034177	Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17	Environmental	Open in IMG/M
3300034691	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_04D_16	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
MBSR1b_0951.00006730	2162886012	Miscanthus Rhizosphere	NRPDANHRYMTDRAVRDQMVMKGWLAEGDGPDLVVMCAPQ
INPhiseqgaiiFebDRAFT_1055882481	3300000364	Soil	FSNRADANHRYMTERAIRDQMVGMGWLAEGDGPDLVVMCAPS*
JGIcombinedJ13530_1030534652	3300001213	Wetland	FSNRADANHRYTTDRATRDQMVGKGWLAEGDGPDFVVMCAPQ*
JGIcombinedJ13530_1080202113	3300001213	Wetland	FSARPDANHRYMTDRAVRDQMVLNGWLAEGDGPDLVVMCAPL*
JGIcombinedJ13530_1090426051	3300001213	Wetland	HRYMTDRTVRDQMVAKGWLAEGDGPDLVVMCAPQ*
F14TB_1045281831	3300001431	Soil	TTPIYRVFSNRPDANHRYMIDRAVRTEMTSKGWLAEGDGPDRVVMCGP*
Ga0055491_101404802	3300004050	Natural And Restored Wetlands	GTVPVYRVFSNRPDANHRYMVDRTVREQMAARGWLVEGDGPDAVVLCAPQ*
Ga0066600_101443912	3300004155	Freshwater	VFSNRPDANHRYMTDRAVRDQMVAKGWLAEGDGPDLVVMCAPQ*
Ga0066600_105601342	3300004155	Freshwater	TTPVYRVFSNRPDANHRYMTDRVVRDQMIARGWLAEGDGPELVVMCAPP*
Ga0070658_103354491	3300005327	Corn Rhizosphere	ACPAGSVAIYRLFNNRPDANHRYITDSFARDQMAARGWIAEGDGPDRVVMCAPQ*
Ga0070676_107743693	3300005328	Miscanthus Rhizosphere	VAIYRLFNNRPDANHRYITDSFARDQMAARGWIAEGDGPDRVVMCAPQ*
Ga0066388_1014315671	3300005332	Tropical Forest Soil	RADANHRYMTDPALRDQMVAQNWIAEGDGPDKVVMCAPG*
Ga0070677_106069002	3300005333	Miscanthus Rhizosphere	TSIYRAFSNRTDANHRYMTDRAIRSQMVAAGWLAEGDGPDLVVMCAQ*
Ga0070666_101886563	3300005335	Switchgrass Rhizosphere	NRSDANHRYTTERTVRESMITRGWLAEGDGEDHVVMCTPAAI*
Ga0070666_109095472	3300005335	Switchgrass Rhizosphere	PGTRNVYRVFSGRADANHRYMVDAGIRAAMVGKGWIAEGDGVDLVVMCAPA*
Ga0070680_1018628682	3300005336	Corn Rhizosphere	VYRAFDNRPDANHRYMTDRAIRDQMVALGWIAEGDGPDLVVMCAPA*
Ga0070660_1012923842	3300005339	Corn Rhizosphere	SNRPDANHRYMTDKTVRDQMVTKGWLAEGDGPDLVVMCAPQ*
Ga0070689_1012191021	3300005340	Switchgrass Rhizosphere	SNRADVNHRYMTSRALRDQMAAQGWIAEGDGPDRVAMCVPV*
Ga0070661_1003846042	3300005344	Corn Rhizosphere	RADANHRYMVDRAIRDQMVARGWLAEGDGADLVVMCAPA*
Ga0070661_1006841101	3300005344	Corn Rhizosphere	GTTQIYRVFSNRPDANHRYMTSSALRDQMVAMGWLAEGDGPDQVVMCAPA*
Ga0070661_1015802562	3300005344	Corn Rhizosphere	IYRVFSNRPDANHRYMTHRAVRDQMVARGWLAEGDGPDLVVMCAV*
Ga0070668_1021872851	3300005347	Switchgrass Rhizosphere	TTQVYRVFSNRSDANHRYMTDRAIRDQMVAQGWLVEGDGPDAVVMCAPQ*
Ga0070669_1006284412	3300005353	Switchgrass Rhizosphere	DANHRYTIDPQVRDQMVAMGWIAEGDGPDLVVMCAPAAP*
Ga0070669_1006575331	3300005353	Switchgrass Rhizosphere	VYRVYSNRADANHRYMTSRAVRDTMVAKGWLAEGDGPDVVVMCAP*
Ga0070669_1008181992	3300005353	Switchgrass Rhizosphere	FSGRPDANHRYMTDKLVRSVMVAKGWLVEGDGPDAVVMCAPQ*
Ga0070669_1011236081	3300005353	Switchgrass Rhizosphere	PASTTPIYRVFSNRPDANHRYMTEKAVRDQMVSAGWLAEGDGSDLVVMCAPV*
Ga0070675_1000297374	3300005354	Miscanthus Rhizosphere	MVAGTRPAATRPVYRVFSNRADVNHRYMTSRALRDQMAAQGWIAEGDGPDRVAMCVPV*
Ga0070675_1013442752	3300005354	Miscanthus Rhizosphere	FSNRVDANHRYTTDRATRDLMVTKGWIAEGDGADTVVMCAPQ*
Ga0070675_1019481191	3300005354	Miscanthus Rhizosphere	RMDANHRYMTDRLLRDQMVMMGWLAEGDGPDLVVMCAPPEP*
Ga0070673_1017021932	3300005364	Switchgrass Rhizosphere	VFSNRADANHRYTTDRTTRDQMVAKGWLAEGDGPDRVVMCAP*
Ga0070688_1015691032	3300005365	Switchgrass Rhizosphere	YRVFSNRPDANHRYMTDRAVRDQMVMKGWLAEGDGPDLVVMCAPQ*
Ga0070659_1006864691	3300005366	Corn Rhizosphere	FSNRPDANHRYMTDRVVRDQMVARGWLAEGDGPDLVVMCAV*
Ga0070659_1017162341	3300005366	Corn Rhizosphere	FSNRPDANHRYMTDRAVRDQMVAKGWIAEGDGPDLVVMCAPG*
Ga0070667_1007387541	3300005367	Switchgrass Rhizosphere	YSNRADANHRYTTDRATRDLMVTRGWIAEGDGADIVVMCAPQ*
Ga0070667_1010615512	3300005367	Switchgrass Rhizosphere	SIYRAFSNRTDANHRYMTDRAIRSQMVAAGWLAEGDGPDLVVMCAQ*
Ga0070667_1016069301	3300005367	Switchgrass Rhizosphere	TEVYRVFDNRPDANHRYMTDKAVRDQMVAKGWLAEGDGPNMVVMCAPQ*
Ga0070711_1013279631	3300005439	Corn, Switchgrass And Miscanthus Rhizosphere	VFSNRADANHRYMTDKAVRDAMVALGWLAEGDGPNLVAMCAPQ*
Ga0070711_1016309012	3300005439	Corn, Switchgrass And Miscanthus Rhizosphere	FRVFSNRPDANHRYMTDTQTRDQMVEAGWLAEGDGPDLVVMCAPQ*
Ga0070678_1005354403	3300005456	Miscanthus Rhizosphere	TTQIYRVFSNRPDANHRYMTSSALRDQMVAMGWLAEGDGPDQVVMCAPA*
Ga0070662_1005491681	3300005457	Corn Rhizosphere	VYRVFSNRADVNHRYMTSRALRDQMAAQGWIAEGDGPDRVAMCVPV*
Ga0068867_1001630551	3300005459	Miscanthus Rhizosphere	FSNRPDANHRYMTDRAVRDQMVMKGWLAEGDGPDLVVMCAPQ*
Ga0070707_1009944612	3300005468	Corn, Switchgrass And Miscanthus Rhizosphere	RVFSNRPDANHRYMIVRTLRDQMVVLGWLAEGDGADLVVMCVPL*
Ga0074212_1082741	3300005491	Sediment	SDANHRYMTDRAVRDQMVAKGWLAEGDGPDLVVMCAPQ*
Ga0068853_1004467522	3300005539	Corn Rhizosphere	SNRPDANHRYMTSKLIRDQMVALGWLAEGDGPDLVVMCAPA*
Ga0068853_1010509041	3300005539	Corn Rhizosphere	TTPVYRAFNNRADANHRYMTSVYQRDQMGAAGWILEGDGPDRVVMCAPGP*
Ga0068853_1019732541	3300005539	Corn Rhizosphere	GRADANHRYMVDAGIRAAMVGKGWIAEGDGVDLVVMCAPA*
Ga0068853_1021770051	3300005539	Corn Rhizosphere	VYRVFSNRPDANHRYMTDKNVRDQMVAAGWLAEGDGPDLVVMCAPQ*
Ga0070672_1010062482	3300005543	Miscanthus Rhizosphere	TEVYRVFDNRPDANHRYMTDKAVRDQMVAKGWLAEGDGANMVVMCAPQ*
Ga0070672_1010186512	3300005543	Miscanthus Rhizosphere	VFSNRSDANHRYTTNAQLRDRMVNLGWLAEGDGSDLVVMCAPS*
Ga0070672_1020607302	3300005543	Miscanthus Rhizosphere	DANHRYMTEAALRDAMVSGGWIAEGDGADRVALCAPA*
Ga0070693_1011619772	3300005547	Corn, Switchgrass And Miscanthus Rhizosphere	FSNRADANHRYVTDPAVRNQMAMKGWLAEGDGPDLVVMCAPQ*
Ga0070693_1013483442	3300005547	Corn, Switchgrass And Miscanthus Rhizosphere	RADANHRYITDETTRAQMAASGWVVEGDGPDSVVMCAPL*
Ga0070665_1010939342	3300005548	Switchgrass Rhizosphere	ANHRYMVNATIRDEMVAKHWLAEGDGPDLVVMCSPV*
Ga0070665_1016791243	3300005548	Switchgrass Rhizosphere	VAIYRLFNNRPDANHRYVTDSFARDQMAARGWIAEGDGPDRVVMCAPQ*
Ga0070665_1024631381	3300005548	Switchgrass Rhizosphere	LYRVFSNRADANHRYMIDRATRDFMLTLGWLAEGDGPNLVVMCMPA*
Ga0068855_1023181232	3300005563	Corn Rhizosphere	ANHRYTTERSVREQMIARGWTAEGDGPDLVVMCAPQ*
Ga0070664_1008759621	3300005564	Corn Rhizosphere	NHRYMVDAGIRAAMVGKGWIAEGDGVDLVVMCAPA*
Ga0068854_1002387631	3300005578	Corn Rhizosphere	RVFSNRPDANHRYMTDKTVRDQMVTKGWLAEGDGPDLVVMCAPQ*
Ga0068856_1004581631	3300005614	Corn Rhizosphere	NHRYMVDRAIRDQMVARGWLAEGDGADLVVMCAPA*
Ga0068856_1024697632	3300005614	Corn Rhizosphere	EDPAFMHVYMTDRAFRDQMVARGWIAEGGGPDLVVMCSPS*
Ga0070702_1005666082	3300005615	Corn, Switchgrass And Miscanthus Rhizosphere	YRVFSNRADANHRYMTDRAVRAQMVAKGWLAEGDGPDLVVMCAPQ*
Ga0068852_1003737061	3300005616	Corn Rhizosphere	TCPDNITPVYRVFSNRADANHRYMTDPALRDAMVATGWLAEGDGPDRVVMCAP*
Ga0068852_1006944772	3300005616	Corn Rhizosphere	PSNTAQVYRVFSNRVDANHRYMTDPIMRDQMVTKGWIAEGDGPDRVVMCAPL*
Ga0068859_1000438411	3300005617	Switchgrass Rhizosphere	RADANHRYTTSRAVRDTMVAKGWLAEGDGPDVVVMCAP*
Ga0068864_1019872472	3300005618	Switchgrass Rhizosphere	NHRYMTDKAVRDQMVAKGWLAEGDGPNMVVMCAPQ*
Ga0068864_1021323092	3300005618	Switchgrass Rhizosphere	DANHRYMTDRAVRDQMVARGWLAEGDGPDLVVMCAA*
Ga0068861_1001050371	3300005719	Switchgrass Rhizosphere	VFNNRPDANHRYTIERGLRDLMVEGGWIAEGDGDDRVVMCVAL*
Ga0068861_1002866731	3300005719	Switchgrass Rhizosphere	RVFSNRPDANHRYTIERAVRDDMVAHGWIAEGDGPDRVVMCAPS*
Ga0068851_110360092	3300005834	Corn Rhizosphere	QIYRVFSNRPDANHRYMTSRALRDQMVAMGWLSEGDGPDQVVMCAPA*
Ga0068851_110436632	3300005834	Corn Rhizosphere	ANSTQVYRVFSNRPDANHRYMTDKTVRDQMVTKGWLAEGDGPDLVVMCAPQ*
Ga0068870_104688433	3300005840	Miscanthus Rhizosphere	DANHRYVTDPAVRNQMAMKGWLAEGDGPDLVVMCAPQ*
Ga0068863_1003553583	3300005841	Switchgrass Rhizosphere	TAGVCPPFTTQVYRVFSNRPDANHRYMTEKTVRDLMAASGWLVEGDGPDLVVMCAPA*
Ga0068858_1008550273	3300005842	Switchgrass Rhizosphere	FSNRPDANHRYMTDRAIRDEMVARGWLAEGDGANLVVMCAPAS*
Ga0068858_1018587702	3300005842	Switchgrass Rhizosphere	SGRADANHRYMVDPAIRAAMVTTGWIAEGDGADMVVMCAPA*
Ga0068858_1022440362	3300005842	Switchgrass Rhizosphere	QIYRVFSNRADANHRYMTDKAIRSQMTSKGWLEEGDGPDLVVMCEPTAPPGP*
Ga0068860_1009068231	3300005843	Switchgrass Rhizosphere	SNRADANHRYMTDRATRDQMVAMGWVAEGDGPDLVVMCAPQ*
Ga0068862_1003185331	3300005844	Switchgrass Rhizosphere	NHRYTTERAVRDEMAAKGWLVEGDGADAVVMCAPG*
Ga0068862_1004587262	3300005844	Switchgrass Rhizosphere	VYRAFSNRADANHRYMVNPTIRDEMVAKHWLAEGDGPDLVVMCSPV*
Ga0075274_10229352	3300005901	Rice Paddy Soil	VFSDRADANHRYMVDRSLRDQMVARGWLAEGDGPDLVVMCAPL*
Ga0081455_102337653	3300005937	Tabebuia Heterophylla Rhizosphere	VFRVFSNRADANHRYMIDAAIRSQMVAQGWLAEGDGAQQIVMCGPE*
Ga0073913_100887362	3300005940	Sand	APVYRVFSNRGDANHRYMTDRTIRDQMVAKGWLAEGDGPDLVVMCAPQ*
Ga0079037_1018844592	3300006224	Freshwater Wetlands	VPVYRVFSNRPDANHRYMVDRTVREQMAARGWLVEGDGPDAVVMCAPQ*
Ga0097621_1005349701	3300006237	Miscanthus Rhizosphere	FSNRADANHRYMTDRSIRDQMVAQGWLAEGDGPDLVVMCAPL*
Ga0097621_1005995902	3300006237	Miscanthus Rhizosphere	IYRVFSNRADANHRYMTDKALRDQMVTQGWLAEGDGPNLVVMCAPQ*
Ga0097621_1008157201	3300006237	Miscanthus Rhizosphere	NHRYMTDKAVRDQMVAKGWLAEGDGANMVVMCAPQ*
Ga0068871_1020199461	3300006358	Miscanthus Rhizosphere	ANHRYMNNAMLRDQMVMMGWVAEGDGPDMVVMCGATISP*
Ga0074062_128241971	3300006606	Soil	YRVFSNRADANHRYMTDKAVRQMMVDKGWLAEGDGPNLVVMCAPA*
Ga0075430_1006838522	3300006846	Populus Rhizosphere	PAGTTSIYRVFSNRVDANHRYMTDRNVRNQMVAKGWIAEGDGPDLVVMCAPG*
Ga0075433_101648061	3300006852	Populus Rhizosphere	RPDANHRYMTSRSVRNDMTARGWLAEGDGADLVVMCSPG*
Ga0075433_116043792	3300006852	Populus Rhizosphere	FSNRLDANHRYMIDRAVRDAMIAAGWLAEGDGPDLVVMCAPA*
Ga0068865_1004266632	3300006881	Miscanthus Rhizosphere	RPDANHRYMTVRGLRDQMVADGWLAEGDGPDLVVMCAPQ*
Ga0068865_1008304431	3300006881	Miscanthus Rhizosphere	VKVYRVFSNRADANHRYMTDVATRAQMAALGWIIEGDGPDAVVMCGPA*
Ga0075424_1008391591	3300006904	Populus Rhizosphere	GTTAIYRVFTNRPDANHRYMTDRSVRDQMVAKGWLAEGDGPDLVVMCAP*
Ga0075424_1013850691	3300006904	Populus Rhizosphere	SNRPDANHRYTIERAVRDQMVASGWLAEGDGPDIVVMCAPA*
Ga0075424_1020020851	3300006904	Populus Rhizosphere	MASIYRVFSNRADANHRYMTDKALRDQMVAKGWIAEGDGPDIVAMCAPQ*
Ga0075436_1011224372	3300006914	Populus Rhizosphere	LSGLPSCRAFDNRRDANHGYMSKAMRDEMVAKGWIAEGDGPDLVVMCSPG*
Ga0079219_112569232	3300006954	Agricultural Soil	TPIYRVFSNRPDANHRYMTDRSVRDQMVAKGWLTEGDGPDLVVMCAP*
Ga0075435_1004769711	3300007076	Populus Rhizosphere	VYRVYTIRADANHRYTTDRATRDAMVAKGWIAEGDGADTVAMCAPQ*
Ga0075435_1014786261	3300007076	Populus Rhizosphere	CAPGTTPVYRVFDQRRDANHRYVVERSVRDRMVGNGWLAEGDGEDRVAMCAPL*
Ga0105251_101806931	3300009011	Switchgrass Rhizosphere	RPDANHRYMTDKTIRDQMVAKGWLAEGDGPDLVVMCAPR*
Ga0105090_107907322	3300009075	Freshwater Sediment	NRPDANHRYMVDRTVREQMAARGWLVEGDGPDAVVMCAPQ*
Ga0105107_110751471	3300009087	Freshwater Sediment	CPQGTVPVYRVFDGRTDANHRYMIERSVRDQMVTQGWIAEGDGPDFVVMCAPP*
Ga0105245_120299262	3300009098	Miscanthus Rhizosphere	RPDANHRYMTDKTVRDQMVTKGWLAEGDGPDLVVMCAPQ*
Ga0105243_130574251	3300009148	Miscanthus Rhizosphere	VFSNRPDANHRYMTVRGLRDQMVADGWLAEGDGPDLVVMCAPQ*
Ga0113563_102779864	3300009167	Freshwater Wetlands	RVFSNRADANHRYTTDRAVRDRMVAKGWLAEGDGADLVVMCAPQ*
Ga0113563_123550352	3300009167	Freshwater Wetlands	HRYTTDRAVRDQMTARGWMAEGDGPDLVVMCAPR*
Ga0105242_126766961	3300009176	Miscanthus Rhizosphere	VPIYRVFSNRADANHRYMTDRAVRAQMVAKGWLAEGDGPDLVVMCATQ*
Ga0105248_120731451	3300009177	Switchgrass Rhizosphere	GTVAVYRVFSNRPDANHRYTIEQATRAAMVALGWLAEGDGPDLVVMCAP*
Ga0105248_127142012	3300009177	Switchgrass Rhizosphere	FNNRPDANHRYITDSFARDQMVAKGWIAEGDGADRVVMCAPQ*
Ga0114938_10203462	3300009430	Groundwater	VSSNRPDANHRHMVDRTVREQTAARGWLVEGDGPDAVVMCAPR*
Ga0114939_100052393	3300009455	Groundwater	VSNNRPDANHRHMVDRTVREQTAARGWLVEGDGPDAVVMCAPR*
Ga0114939_100805803	3300009455	Groundwater	VFTNRRDANHRYTIESAVREEMVARGWLAEGDGPDLVVMCAPK*
Ga0073899_111040711	3300009540	Activated Sludge	RYVTERTVRDGMVAQGWLAEGDGPDLVVMCAPGS*
Ga0105249_135296591	3300009553	Switchgrass Rhizosphere	PIYRGFSNRPDASHRYMISTATRNQMVAQGWLAEGDGPDLVVMCVPAV*
Ga0127503_104154811	3300010154	Soil	ANHRYMTERTVRDLMVTSGWLAEGDGPDLVVMCAPM*
Ga0134124_113394152	3300010397	Terrestrial Soil	RPDANHRYTTDRALRAEMMAKGWLAEGDGPDLVVMCAPQ*
Ga0134124_120534971	3300010397	Terrestrial Soil	NTTQIYRVFSNRPDANHRYMTSKIIRDQMAAKGWLVEGDGPDSVVMCAPM*
Ga0134124_127594861	3300010397	Terrestrial Soil	PVYRVFSNRPDANHRYMTDKAVRDQMAAKGWLVEGDGPDAVVMCAPQ*
Ga0134122_127242741	3300010400	Terrestrial Soil	NRPDANHRYMTDKAVRDQMVAKGWLAEGDGPNMVVMCAPQ*
Ga0134123_100356341	3300010403	Terrestrial Soil	YRVFSNRADANHRYVTDPAVRNQMAMKGWLAEGDGPDLVVMCAPQ*
Ga0151489_13371562	3300011106	Soil	DANHRYMTDKAVRQMMVDKGWLAEGDGPNLVVMCAPA*
Ga0137377_119039742	3300012211	Vadose Zone Soil	VFSNRADANHRYMIDRTLRDQMAAMGWTIEGDGPDFVVMCAPPAPATV
Ga0150985_1156425422	3300012212	Avena Fatua Rhizosphere	TSPIHRVFSNRGGANHRYMSDSALRDAMVNRRWLAEGDGPDLVVMCAPR*
Ga0137384_109489081	3300012357	Vadose Zone Soil	NRPDANHRYMTDKAIRDQMAAKGWLIEGDGPDRVVMCAPQ*
Ga0138256_111867231	3300012533	Active Sludge	HRYTTNRALRDAMVARGWLAEGDGPDTVLMCAPAPGA*
Ga0137359_115297882	3300012923	Vadose Zone Soil	RADSNHRYTTDRATRDEMVDKGWIAEGDGPDRIAFCASW*
Ga0157369_108414492	3300013105	Corn Rhizosphere	FSDRADANHRYMVDRAIRDQMVARGWLAEGDGADLVVMCAPA*
Ga0157374_110444454	3300013296	Miscanthus Rhizosphere	ANHRYTTDRATRDLMVSKGWLAEGDGADIVVMCAPQ*
Ga0157374_114154891	3300013296	Miscanthus Rhizosphere	NRADVNHRSTTDRGVRDAMVAKGWIAEGDGPDRVVMCAPQ*
Ga0157378_100172536	3300013297	Miscanthus Rhizosphere	FSNRMDANHRYMTDRLLRDQMVMMGWVAEGDGPDLVVMCAPPAP*
Ga0157378_100755041	3300013297	Miscanthus Rhizosphere	AQVYRVFSNRPDANHRYMTDKTVRDQMVTKGWLAEGDGPDLVVMCAPQ*
Ga0157378_102043654	3300013297	Miscanthus Rhizosphere	VFSNRYDANHRYMTDKATRDQMVAKGWLAEGDGPDLVVMCAPD*
Ga0157378_105094081	3300013297	Miscanthus Rhizosphere	IYRVFSNRGDANHRYMTDKALRDQMVAKGWLAEGDGPDRVVMCAPQ*
Ga0163162_115390442	3300013306	Switchgrass Rhizosphere	CPAATRPVYRVFSNRADVNPRYMTSRALRDQMAAQGWIAEGDGPDRVAMCVPV*
Ga0163162_120198452	3300013306	Switchgrass Rhizosphere	ANHRYVTDRTVRTQMVAAGWIAEGDGPDMVAMCVPG*
Ga0157372_109356461	3300013307	Corn Rhizosphere	FSNRADANHRYMTDRATRDQVVGMGWLAEGDGPDLVVMCAPQ*
Ga0157375_103580033	3300013308	Miscanthus Rhizosphere	FSNRPDANHRYMIVRTLRDQMVVLGWLAEGDGADLVVMCVPL*
Ga0157375_114898742	3300013308	Miscanthus Rhizosphere	VFRGRADANHRYMVDAGIRAAMVGKGWIAEGDGVDLVVMCAPA*
Ga0157375_119336051	3300013308	Miscanthus Rhizosphere	ANHRYMTSRSVRNDMTARGWLAEGDGADLVVMCSPG*
Ga0157375_123988012	3300013308	Miscanthus Rhizosphere	PDANHRYMTDRALRDQMVAKGWLAEGDGPDLVVMCAPT*
Ga0157375_134919731	3300013308	Miscanthus Rhizosphere	NRPDTNHRYMTDKAVRYQMVAKGWLAEGDGPNMVVMCAPQ*
Ga0134078_105121531	3300014157	Grasslands Soil	VFSNRADANHRYTTDPATRDQMAAMGWTVEGDGPDFVVMCAPPAM*
Ga0075358_10995091	3300014303	Natural And Restored Wetlands	NRPDANHRYTVDKSVLAKMVASGWLAEGDGADLVVMCAPQ*
Ga0075345_11330792	3300014312	Natural And Restored Wetlands	VFSNRADANHRYTTDRVMREQMVGMGWLAEGDGPDLVVMCAPQ*
Ga0075356_12241991	3300014323	Natural And Restored Wetlands	SNRPDANHRYMTDRAVRDAMVAKGWLAEGDGPDLVVMCAP*
Ga0163163_116744641	3300014325	Switchgrass Rhizosphere	HRYMTDKLIRAAMVAKGWLAEGDGADLTVMCAPL*
Ga0163163_119176071	3300014325	Switchgrass Rhizosphere	FNGRPDANHRYTIERGIRDLMVEAGWIAEGDGDDRVVMCVAL*
Ga0163163_124576722	3300014325	Switchgrass Rhizosphere	ANHRYMTDRATRDQMVAMGWVAEGDGPDLVVMCAPQ*
Ga0157379_101752324	3300014968	Switchgrass Rhizosphere	AAGQTPVYRVYSNRPDANHRYVTSRQVRDTMVAKGWLAEGDGPDAVVMCAP*
Ga0157379_116449991	3300014968	Switchgrass Rhizosphere	TRNLYRVFNNRPDANHRYTIERGIRDLMVEGGWVAEGDGEDRVAMCVAL*
Ga0157379_116537401	3300014968	Switchgrass Rhizosphere	VFSNRYDANHRYMTDKATRDQMVAKGWLAEGDGPDLVVMCAPQ*
Ga0157379_125385482	3300014968	Switchgrass Rhizosphere	VFSNRADANHRYMVDPAVRDFMVGQGWLAEGDGPNLVVMCAPT*
Ga0157376_107189301	3300014969	Miscanthus Rhizosphere	NRPDANHRYMTDRSVRDQMVAKGWLAEGDGPDLVVMCAPN*
Ga0157376_111878981	3300014969	Miscanthus Rhizosphere	NHRYMTDKSVRSVMVAKGWLIEGDGPDAVVMCAPQ*
Ga0132258_126021203	3300015371	Arabidopsis Rhizosphere	CPLFTQPVYRLFDGRSDANHRFTTSAALRDAMKARGWIAEGYGTDAVAMCVPQ*
Ga0132255_1020108101	3300015374	Arabidopsis Rhizosphere	VYRVFSNRADVNHRYMTSRALRDQMAAQGWIAEGDGPDR
Ga0182032_103659061	3300016357	Soil	PVGTTNVYRVFDGRPDANHRYMTDKAIRDQMVAKGWIAEGDGPDLVVMCAPQ
Ga0182032_106828672	3300016357	Soil	RPDANHRYMTDKTVRDQMVAKGWVAEGDGPDLVVMCAP
Ga0182040_102843271	3300016387	Soil	PDANHRYMTDKSLRDQMVAKGWIAEGDGPDLVVMCAPQ
Ga0182039_110917202	3300016422	Soil	CPAGTINVYRVFDNRPDANHRYMIDPAVRAQMVAKGWIAEGDGPDMVVMCAPQ
Ga0182038_103128042	3300016445	Soil	ANHRYMTDPAIEEQMIAKGWIPEGDGPGLVVMCAPQ
Ga0182038_105794842	3300016445	Soil	FDNRPDANHRYVTDRTIRDQMVATGWVAEGDGPDTVAMCAPQ
Ga0187821_103138171	3300017936	Freshwater Sediment	NHRFTTDRATRDQMVTLGWVAEGNGPDIIFACVPQ
Ga0187785_106431821	3300017947	Tropical Peatland	PVYRLFNSRPDANHRYTIERETRDAMVAKGWIAEGDGPEHVAMCAPN
Ga0187779_103202551	3300017959	Tropical Peatland	QGIHFSQRSSDLDANHRYMTDKAIRTPMTGKGWVAEGDGPDVVVMCAPQ
Ga0066662_107913151	3300018468	Grasslands Soil	RAFDNRADANHRYMTDSTVLAQMVTRGWIAEGDGPDLVAMCAPQ
Ga0190274_134824821	3300018476	Soil	DANHRYTTDRATRDEMVAKGWLAEGDGPDRVVMCAP
Ga0193755_11927311	3300020004	Soil	DANHRYMTDRTVRDQMMAKGWLAEGDGPDLVVMCAPA
Ga0210384_109238831	3300021432	Soil	TEVYRVFSNRADANHRYMTDKDLRDQMVAMGWLAEGDGPDLVVMCAPQ
Ga0182009_103782801	3300021445	Soil	SPLYRVFSNRADANHRYMVDRATRDAMVARGWLAEGDGPDLVVMCVPQ
Ga0182009_104417731	3300021445	Soil	SNRADANHRYMTDRAVRDMMVSRGWVAEGDGPDLVVMCAPG
Ga0209594_10106164	3300025130	Groundwater	VHRVSNNRPDANHRHMVDRTVREQTAARGWLVEGDGPDAVVMCAPR
Ga0207656_106950871	3300025321	Corn Rhizosphere	CPANSTQVYRVFSNRPDANHRYMTDKTVRDQMVTKGWLAEGDGPDLVVMCAPQ
Ga0207710_107770201	3300025900	Switchgrass Rhizosphere	VSCPFGLTPIYRVFSNRPDANHRYLTDRATRTQMVSKGWLAEGDGPDMVVMCGGAL
Ga0207680_110415662	3300025903	Switchgrass Rhizosphere	QQIFRVFSNRADANHRYITDKTTRAQMASRGWVVEGDGPDAVVMCAPP
Ga0207645_109156872	3300025907	Miscanthus Rhizosphere	SNRIDANHRYTIDPLVRDQMVVMGWIAEGDGPDLVAMCAPVAP
Ga0207643_102599173	3300025908	Miscanthus Rhizosphere	DANHRYVTDPAVRNQMAMKGWLAEGDGPDLVVMCAPQ
Ga0207681_109308301	3300025923	Switchgrass Rhizosphere	SGRADANHRYMVDPAIRAAMVTTGWIAEGDGADMVVMCAPA
Ga0207681_111897721	3300025923	Switchgrass Rhizosphere	VYRVFSNRADVNHRYMTSRALRDQMAAQGWIAEGDGPDRVAMCVPV
Ga0207681_114004921	3300025923	Switchgrass Rhizosphere	YRVFDNRPDANHRYMTDKAVRDQMVAKGWLAEGDGANMVVMCAPQ
Ga0207681_114269911	3300025923	Switchgrass Rhizosphere	CPAGTITIYRVFSNRADANHRYMTDRAIRDQMVARGWLAEGDGADLVVMCGAG
Ga0207650_102339151	3300025925	Switchgrass Rhizosphere	RVFSNRPDANHRYTIERAVRDDMVAHGWIAEGDGPDRVVMCAPS
Ga0207650_107173491	3300025925	Switchgrass Rhizosphere	YRVFNNRPDANHRYTIERGLRDLMVEGGWIAEGDGDDRVVMCVAL
Ga0207659_100525611	3300025926	Miscanthus Rhizosphere	MVAGTRPAATRPVYRVFSNRADVNHRYMTSRALRDQMAAQGWIAEGDGPDRVAMCVPV
Ga0207659_114531531	3300025926	Miscanthus Rhizosphere	ADANHRYMVNASIRDLMVTKRWVAEGDGPDLVVMCSPV
Ga0207687_105627112	3300025927	Miscanthus Rhizosphere	RPDANHRYMTDKTVRDQMVTKGWLAEGDGPDLVVMCAPQ
Ga0207687_109446331	3300025927	Miscanthus Rhizosphere	NRADANHRYMTDRATRDQMVGMGWLAEGDGPDLVVMCAPQ
Ga0207701_106997612	3300025930	Corn, Switchgrass And Miscanthus Rhizosphere	ANHRYMTDRAVRDQMVAKGWIAEGDGPDLVVMCAPG
Ga0207644_104492021	3300025931	Switchgrass Rhizosphere	VFSNRMDANHRYMTDRATRDQMVGMGWLAEGDGPDLVVMCAPQ
Ga0207644_118752411	3300025931	Switchgrass Rhizosphere	TAQVYRVFSNRPDANHRYMTDKTVRDQMVTKGWLAEGDGPDLVVMCAPQ
Ga0207690_109333332	3300025932	Corn Rhizosphere	PIYRVFSNRPDANHRYMTDRAVRNQMVARGWLAEGDGPDLVVMCAV
Ga0207706_101754213	3300025933	Corn Rhizosphere	RADANNRYMTDRATRDQMVGMGWLAEGDGPDLVVMCAPQ
Ga0207706_105430531	3300025933	Corn Rhizosphere	VFSNRADANHRYTIERAVRDDMVAHGWLAEGDGPDLVVMCAPT
Ga0207706_114395671	3300025933	Corn Rhizosphere	RTDANHRYMIDRALRDQMVALGWIAEGDGPDLVVMCAPA
Ga0207669_109692381	3300025937	Miscanthus Rhizosphere	DANHRYMTSSALRDQMVAMGWLAEGDGPDQVVMCAPA
Ga0207704_100762234	3300025938	Miscanthus Rhizosphere	TNAVYRVFSNRADANHRYVTDPAVRNQMAMKGWLAEGDGPDLVVMCAPQ
Ga0207704_109572731	3300025938	Miscanthus Rhizosphere	TTPIYRVFSNRADANHRYMTDRAVRDQMVAKGWIAEGDGPDLVVMCAPG
Ga0207691_105253151	3300025940	Miscanthus Rhizosphere	IYRVFNQRAGSANHRYMTDRTVREQMIAKGWVAEGDGPDLVVMCGPA
Ga0207691_113068441	3300025940	Miscanthus Rhizosphere	VYRVFSNRADVNHRYMTSRALRDQMAAQGWIAEGDGPDRVAMCAPV
Ga0207667_117138312	3300025949	Corn Rhizosphere	RPDANHRYTTERSVREQMIARGWTAEGDGPDLVVMCAPQ
Ga0207651_111296912	3300025960	Switchgrass Rhizosphere	YSVFSNRPDANHRYMTDRAVRDQMAAKGWLVEGDGPDAVVMCAPQ
Ga0207651_117439931	3300025960	Switchgrass Rhizosphere	RNVHRAFSNRADANHRYMVNPTIRDEMVAKHWLAEGDGPDLVVMCSPV
Ga0207668_101329211	3300025972	Switchgrass Rhizosphere	VCPANSTQVYRVFSNRPDANHRYMTDKTVRDQMVTKGWLAEGDGPDLVVMCAPQ
Ga0207668_101619361	3300025972	Switchgrass Rhizosphere	HRYMTDKAIRSQMTSKGWLEEGDGPDLVVMCEPTAPPGP
Ga0207668_104393963	3300025972	Switchgrass Rhizosphere	VCPPNATEVYRVFDNRPDANHRYMTDKAVRDQMVAKGWLAEGDGPNMVVMCAPQ
Ga0207668_105288552	3300025972	Switchgrass Rhizosphere	YRVFSGRADANHRYMVDAGIRAAMVGKGWIAEGDGVDLVVMCAPA
Ga0207668_106798451	3300025972	Switchgrass Rhizosphere	NLYRVFNNRPDANHRYTIERGLRDLMVEGGWIAEGDGDDRVVMCVAL
Ga0207658_102267013	3300025986	Switchgrass Rhizosphere	FSGRADANHRYMVDPAIRAAMVTTGWIAEGDGADMVVMCAPA
Ga0207658_104437922	3300025986	Switchgrass Rhizosphere	NHRYMTDKSVRSVMVAKGWLIEGDGPDAVVMCAPQ
Ga0207658_110189091	3300025986	Switchgrass Rhizosphere	IYRAFSNRTDANHRYMTDRAIRSQMVAAGWLAEGDGPDLVVMCAQ
Ga0207658_116290711	3300025986	Switchgrass Rhizosphere	SNRPDANHRYMTEKAVRDQMVSAGWLAEGDGSDLVVMCAPV
Ga0207658_117340072	3300025986	Switchgrass Rhizosphere	RCPEGTTAIYRAFSNRADANHRYMTETALRDRMVSKGWLAEGDGADLVVMCGPQ
Ga0207658_118981241	3300025986	Switchgrass Rhizosphere	YSNRADANHRYTTDRATRDLMVTRGWIAEGDGADIVVMCAPQ
Ga0207677_122891801	3300026023	Miscanthus Rhizosphere	DANHRYMTDKATRDQMVAKGWLAEGDGPDLVVMCAPD
Ga0207703_116566371	3300026035	Switchgrass Rhizosphere	TRNVYRVFSGRADANHRYMVDPAIRAAMVTTGWIAEGDGADMVVMCAPA
Ga0207703_119694372	3300026035	Switchgrass Rhizosphere	GGTNQIYRVFSNRADANHRYMTDKAIRSQMTSKGWLEEGDGPDLVVMCEPTAPPGP
Ga0207639_102642482	3300026041	Corn Rhizosphere	PANTAQVYRVFSNRPDANHRYMTDKTVRDQMVTKGWLAEGDGPDLVVMCAPQ
Ga0207639_107618351	3300026041	Corn Rhizosphere	ASTTPVYRAFNNRADANHRYMTSVYQRDQMGAAGWILEGDGPDRVVMCAPGP
Ga0207678_101776441	3300026067	Corn Rhizosphere	NHRYTTSVQVRDEMVANGWLAEGDGPDRVVMCAPA
Ga0207702_111239622	3300026078	Corn Rhizosphere	AFMHVYMTDRAFRDQMVARGWIAEGGGPDLVVMCSPS
Ga0207702_122901282	3300026078	Corn Rhizosphere	NHRYMVDRAIRDQMVARGWLAEGDGADLVVMCAPA
Ga0207641_104176141	3300026088	Switchgrass Rhizosphere	CPTATTPVYRVFSNRADANHRYMTDKSVRSVMVAKGWLIEGDGPDAVVMCAPQ
Ga0207641_104837254	3300026088	Switchgrass Rhizosphere	ANHRYMTDRSVRDQMVAKGWLAEGDGPDLVVMCAP
Ga0207641_121316651	3300026088	Switchgrass Rhizosphere	NRPDANHRYMTDRVVRDQMVARGWLAEGDGPDLVVMCAV
Ga0207641_125135561	3300026088	Switchgrass Rhizosphere	TNQIYRVFSNRADANHRYMTDKAIRSQMTSKGWLEEGDGPDLVVMCEPTAPPGP
Ga0207648_100099759	3300026089	Miscanthus Rhizosphere	FSNRPDANHRYMTDRAVRDQMVMKGWLAEGDGPDLVVMCAPQ
Ga0207648_105079731	3300026089	Miscanthus Rhizosphere	TQIYRVFSNRADANHRYMTSRTLRDQMVAMGWLSEGDGPDQVVMCAPA
Ga0207676_107692231	3300026095	Switchgrass Rhizosphere	VFSNRADANHRYTTERAVRDEMAAKGWLVEGDGADAVVMCAPA
Ga0207683_111031892	3300026121	Miscanthus Rhizosphere	NHRYMTDRALRDQMVMMGWLAEGDGDDLVVMCAPPAP
Ga0207683_114124711	3300026121	Miscanthus Rhizosphere	VAGNCLAGTAQVYRAFNNRPDANHRYMNTLYTRDQMAAANWILEGDGDDRVVMCAPGA
Ga0207698_107825861	3300026142	Corn Rhizosphere	PAATGEIYRVFSNRSDANHRYMTDKTLRDQMVAQGWLAEGDGPNLVVMCAPQ
Ga0207698_122422742	3300026142	Corn Rhizosphere	NHRYMTDRAIRDEMVARGWLAEGDGANLVVMCAPAS
Ga0209485_10743031	3300027691	Agricultural Soil	YRVFSNRSDANHRYAVDRAVRDTMTGRGWLAEGDGPDLVVMCSPQ
Ga0209591_1000843910	3300027850	Freshwater	PSGSTPVYRVFSNRADANHRTMTDRATRDQMVGNGWLAEGDGPDFVVMCAPL
Ga0209397_100317041	3300027871	Wetland	ANHRYTVDPAIRDQMVGRGWVAEGDGPDLVVMCAPL
Ga0209974_104031171	3300027876	Arabidopsis Thaliana Rhizosphere	MRGECPAGMRPVYRVFSNRPDANHRYMVDRTLRNQMVATGWLAEGDGSDLVVMCVPQ
Ga0209293_101055953	3300027877	Wetland	FSNRPDANHRYMVDRTVREQMAARGWLVEGDGPDAVVMCAPQ
Ga0209181_101227611	3300027878	Freshwater	FSNRVDANHRYTTSRTVRDQMVTKGWLAEGDGPDIVVMCAPA
Ga0209450_108487441	3300027885	Freshwater Lake Sediment	TAGICPANTTQVYRVFSNRPDANHRYMTDNAVRDQMVVKEWLAEGDGPDLVVMCAPQ
Ga0209450_111895302	3300027885	Freshwater Lake Sediment	VYRVFSNRPDANHRYMTDKGVRDQMVAKGWLAEGDGPNLVVMCAPR
Ga0209254_108319572	3300027897	Freshwater Lake Sediment	TDTTQVYRVFSNRPDANHRYMTSKAVRDQMVAKGWLAEGDGPDLVVMCAPQ
Ga0209668_104061811	3300027899	Freshwater Lake Sediment	TVQVYRVFSNRPDANHRYMTDKAVRDQMVAKGWLAEGDGPDLVVMCAPQ
Ga0209253_110549042	3300027900	Freshwater Lake Sediment	TVQVYRVFSNRPDANHRYMTDRAVRDQMVARGWLAEGDGPDLVVMCAPQ
Ga0209382_107547501	3300027909	Populus Rhizosphere	ATTSIYRVFSNRPDANHRYMTDKAVRDSMVAKGWIAEGDGPDLVVMCAP
Ga0268266_101269273	3300028379	Switchgrass Rhizosphere	LFNNRADANHRYITDSFARDQMAARGWIAEGDGPDRVVMCAPQ
Ga0268266_120534032	3300028379	Switchgrass Rhizosphere	SNRADANHRYVTDPAVRNQMAMKGWLAEGDGPDLVVMCAPQ
Ga0268265_105872582	3300028380	Switchgrass Rhizosphere	PVYRVFSNRGDANHRYMTDKAVRGQMVAKGWLIEGDGPDAVVMCAPQ
Ga0268265_113081452	3300028380	Switchgrass Rhizosphere	ADANHRYMVDPAIRAAMVTTGWIAEGDGADMVVMCAPA
Ga0268265_117294281	3300028380	Switchgrass Rhizosphere	NHRYTTERAVRDEMAAKGWLVEGDGADAVVMCAPA
Ga0268264_108236242	3300028381	Switchgrass Rhizosphere	RADANHRYMTDRATRDQMVAMGWVAEGDGPDLVVMCAPQ
Ga0268264_122310592	3300028381	Switchgrass Rhizosphere	RSDANHRYTIERGIRDLMVETGWIAEGDGDDRVAMCVLL
Ga0247823_106515821	3300028590	Soil	ANHRYTTDPAVRDAMKARGWTPEGDGPNMVAMCAPA
Ga0247822_117630662	3300028592	Soil	IVYRVFSNRPDANHRYMTDRALRDFMVTRGWLAEGDGPDLVVMCVP
Ga0311334_103043851	3300029987	Fen	YRVFSNRADANHRYMTDKSVRDQMAGLGWLIEGDGPDAVVMCAPQ
Ga0311336_109159201	3300029990	Fen	NRADANHRYMTDKSVRDQMAGLGWLIEGDGPDAVVMCAPQ
Ga0311337_105574812	3300030000	Fen	NSSPVYRVFSNRADVNHRYLNDLATRNQMVAQGWLAEGDGPDRVTMCAPL
Ga0311350_118514412	3300030002	Fen	RVDTNHRYTTSRTVRDQMVEKGWIAEGAGPEAVVMCAPAP
Ga0311348_110289711	3300030019	Fen	CPANTTQVYRVFSNRADANHRYMTDKSVRDQMAGLGWLIEGDGPDAVVMCAPQ
Ga0311364_124787142	3300031521	Fen	NRADANHRYTTDRATRDQMVAKGWLAEGDGPDLVVMCAPQ
Ga0310888_102392182	3300031538	Soil	SNRPDANHRYMTVRGLRDQMVADGWLAEGDGPDLVVMCAPQ
Ga0310887_105012002	3300031547	Soil	ANHRYITDKTTRAQMASRGWVVEGDGPDAVVMCAPP
Ga0310887_106830992	3300031547	Soil	RVFSNRADANHRYMTDRAIRDQMVARGWLAEGDGADLVVMCGAS
Ga0318528_107295032	3300031561	Soil	TTNVYRVFDGRPDANHRYMTDKAIRDQMVAKGWIAEGDGPDLVVMCAPQ
Ga0310886_104098711	3300031562	Soil	ITIYRVFSNRADANHRYMTDRAIRDQMVARGWLAEGDGADLVVMCGAS
Ga0302321_1009017431	3300031726	Fen	FSNRADANHRYMTDKSVRDQMAGLGWLIEGDGPDAVVMCAPQ
Ga0318526_104396602	3300031769	Soil	YRVFDGRLDANHRYMTDKAIRDQMVAKGWIAEGDGPDLVVMCAPQ
Ga0318546_102602552	3300031771	Soil	DANHRYMTDKAIRDQMVAKGWIAEGDGPDLVVMCAPQ
Ga0318543_101413382	3300031777	Soil	TEVHRVFSNRPDANHRYMTDPAIEAQMVAKGWVAEGDGPDLVVMCAPQ
Ga0318529_102850491	3300031792	Soil	CPERTTEVHRVFDNRPDANHRYMTDPAIEEQMIAKGWIPEGDGPGLVVMCAPQ
Ga0318497_106212641	3300031805	Soil	GTINVYRVFDNRPDANHRYMIDPAVRAQMVAKGWIAEGDGPDMVVMCAPQ
Ga0310907_106138122	3300031847	Soil	IYRVFSNRADANHRYMTERAVRDYMVGVGWLAEGDGADLIVMCAP
Ga0310892_103944451	3300031858	Soil	AIYRVFSNRPDANHRYMTDRAIRDQMVARGWLAEGDGPDLVVMCAPQ
Ga0307406_118360682	3300031901	Rhizosphere	PTGTRNVYRVFSNRADANHRYMIDAALRDQLTCRGWIAEGDGPDLVIMCAPLQ
Ga0302322_1006193181	3300031902	Fen	EVYRVFSNRPDANHRYMTDKAIRTQMVAKGWLAEGDGPDLVVMCAPP
Ga0302322_1023187641	3300031902	Fen	VFSNRADANHRYTTDRATRDQMVARNWVAEGDGPDTVVMCAPQ
Ga0308175_1002345883	3300031938	Soil	NRPDANHRYTIERSVRDDMVARGWIAEGDGPDLVVMCAPA
Ga0308174_101508751	3300031939	Soil	RPDANHRYMTDRSVREQMVARGWLAEGDGPDLVVMCSA
Ga0308174_106698641	3300031939	Soil	HRYTTDRAVRDAMLTRGWLAEGDGDDHVVMCTPAPV
Ga0308174_116402541	3300031939	Soil	YRAFSNRADANHRYTTDRATRDRMVALGWIAEGDGPDAVAMCAP
Ga0308174_116594042	3300031939	Soil	DANHRYMIDRAVRDQMVARGWLAEGDGPDLVVMCAPA
Ga0308174_119612432	3300031939	Soil	DANHRYMTDAATRDAMVSLGWLAEGDGPDLVVMCAPQ
Ga0310909_105152851	3300031947	Soil	EVYRVFDNRPDANHRYMTDKSLRDQMVAKGWIAEGDGPDLVVMCAPQ
Ga0307409_1004480591	3300031995	Rhizosphere	SDANHRYVTDKATRAAMVSKGWLAEGDGPDLVVMCAGP
Ga0307411_116596662	3300032005	Rhizosphere	AGTRNVYRVFSGRADANHRYMVDATIRATMVGKNWLAEGDGDDLVVMCAPT
Ga0310906_112616072	3300032013	Soil	NHRYMTDKAVRDQMVAKGWLAEGDGPNMVVMCAPQ
Ga0318545_101934521	3300032042	Soil	YRVFSNRPDANHRYMTDKTVRDQMVAKGWVAEGDGPDLVVMCAP
Ga0318558_100988292	3300032044	Soil	NVYRVFDGRPDANHRYMTDKAIRDQMVAKGWIAEGDGPDLVVMCAPQ
Ga0318506_104579571	3300032052	Soil	TEVYRVFDNRPDANHRYMTDKSLRDQMVAKGWIAEGDGPDLVVMCAPQ
Ga0318525_102819852	3300032089	Soil	NRPDANHRYVTDRTIRDQMVATGWVAEGDGPDTVAMCAPQ
Ga0315292_114250351	3300032143	Sediment	YRVFTNRADANHRYTTSRATRDEMVAKGWIAEGDGADTVTMCAPQ
Ga0315283_119988742	3300032164	Sediment	AAATTPVYRVFSNRPDANHRYMTSRAIRDQMVAKGWLAEGDGPDLVVMCSPN
Ga0315270_110600882	3300032275	Sediment	NRQDANHRYMTDKAVRDEMVAKGWIAEGDGPNLVVMCAPQ
Ga0316188_105149863	3300032276	Worm Burrow	NRPDANHRYMTDPALRDQMVSRGWLAEGDGPDRVVMCGPQ
Ga0335085_111165651	3300032770	Soil	PVYRVFDNRTDVNHRYTTDRATRDAMVARGWIAEGDGPDQVVMCAPQ
Ga0335083_100015251	3300032954	Soil	NHRYTIERAVRDQMVAKGWIAEGDGPDLVVMCAPAGVS
Ga0310914_104393651	3300033289	Soil	GRLDANHRYMTDKAIRDQMVAKGWIAEGDGPDLVVMCAPQ
Ga0316605_109430221	3300033408	Soil	GTVPVYRVFSNRPDANHRYMVDRTVREQMAARGWLVEGDGPDAVVMCAPQ
Ga0316603_110078311	3300033413	Soil	VFSNRPDANHRYMVDRTVREQMAARGWLVEGDGPDAVVMCAPP
Ga0316619_121578612	3300033414	Soil	VFSNRTDANHRYTTDRAARDQMTARGWMAEGDGPDLVVMCAPR
Ga0316625_1001467482	3300033418	Soil	TTSVYRVFSNRPDANHRYMTDRTLRDQMVAKGWLAEGDGPDRVVMCAPM
Ga0316625_1002861592	3300033418	Soil	NRADANHRYTTDRAVRDQMTARGWMAEGDGPDLVVMCAPR
Ga0316600_107466412	3300033481	Soil	SNRPDANHRYMVDRTVREQMAARGWLVEGDGPDAVVMCAPQ
Ga0316627_1002689041	3300033482	Soil	VFNNRADANHRYTTDRAVRDLMVSRGGTAEGYGGDVVIMCAPPGVVAAQ
Ga0316627_1003419672	3300033482	Soil	DANHRYMTSKVVRDQMVAKGWLAEGDGPDLVVMCAPQ
Ga0316629_109352521	3300033483	Soil	PDANHRYMTDRALRDQMVARNWLAEGDGPDLVVMCAPQ
Ga0316628_1034306521	3300033513	Soil	YRVFSNRPDANHRYMTDRALRDAMVARGWLAEGDGPDLVVMCAPQ
Ga0247829_110626602	3300033550	Soil	HRYTIDRAVRDQMVSQGWLAEGDGADAVAMCVPVTP
Ga0364932_0365513_389_526	3300034177	Sediment	VYRVFSNRADANHRYMTDRAERDAMQAKGWVAEGDGPDLVVMCAP
Ga0370488_129455_572_730	3300034691	Untreated Peat Soil	CPAGTTQVYRVFSNRPDANHRYMTDPAIRASMVAKGWLAEGDGADLVVMCAP

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F010035

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences