| Basic Information | |
|---|---|
| Family ID | F010035 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 309 |
| Average Sequence Length | 44 residues |
| Representative Sequence | VFSNRPDANHRYMTDRAVRDQMVAKGWLAEGDGPDLVVMCAPQ |
| Number of Associated Samples | 205 |
| Number of Associated Scaffolds | 309 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.97 % |
| % of genes near scaffold ends (potentially truncated) | 95.15 % |
| % of genes from short scaffolds (< 2000 bps) | 94.50 % |
| Associated GOLD sequencing projects | 176 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (89.644 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere (12.298 % of family members) |
| Environment Ontology (ENVO) | Unclassified (60.841 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (62.460 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 12.68% β-sheet: 11.27% Coil/Unstructured: 76.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 309 Family Scaffolds |
|---|---|---|
| PF02321 | OEP | 3.56 |
| PF00171 | Aldedh | 2.91 |
| PF07690 | MFS_1 | 2.91 |
| PF00578 | AhpC-TSA | 1.62 |
| PF01757 | Acyl_transf_3 | 1.62 |
| PF00795 | CN_hydrolase | 1.62 |
| PF00535 | Glycos_transf_2 | 1.29 |
| PF00378 | ECH_1 | 1.29 |
| PF00300 | His_Phos_1 | 1.29 |
| PF01070 | FMN_dh | 1.29 |
| PF13472 | Lipase_GDSL_2 | 0.97 |
| PF02518 | HATPase_c | 0.97 |
| PF01544 | CorA | 0.97 |
| PF02350 | Epimerase_2 | 0.97 |
| PF05532 | CsbD | 0.97 |
| PF00892 | EamA | 0.97 |
| PF01551 | Peptidase_M23 | 0.97 |
| PF08402 | TOBE_2 | 0.97 |
| PF03466 | LysR_substrate | 0.97 |
| PF03887 | YfbU | 0.65 |
| PF00196 | GerE | 0.65 |
| PF09906 | DUF2135 | 0.65 |
| PF04366 | Ysc84 | 0.65 |
| PF13378 | MR_MLE_C | 0.65 |
| PF01370 | Epimerase | 0.65 |
| PF04542 | Sigma70_r2 | 0.65 |
| PF00271 | Helicase_C | 0.65 |
| PF03472 | Autoind_bind | 0.65 |
| PF13517 | FG-GAP_3 | 0.65 |
| PF00072 | Response_reg | 0.65 |
| PF13368 | Toprim_C_rpt | 0.65 |
| PF00293 | NUDIX | 0.65 |
| PF00583 | Acetyltransf_1 | 0.65 |
| PF05193 | Peptidase_M16_C | 0.32 |
| PF00501 | AMP-binding | 0.32 |
| PF00873 | ACR_tran | 0.32 |
| PF11219 | DUF3014 | 0.32 |
| PF01979 | Amidohydro_1 | 0.32 |
| PF03480 | DctP | 0.32 |
| PF16658 | RF3_C | 0.32 |
| PF01220 | DHquinase_II | 0.32 |
| PF00156 | Pribosyltran | 0.32 |
| PF00392 | GntR | 0.32 |
| PF00005 | ABC_tran | 0.32 |
| PF13673 | Acetyltransf_10 | 0.32 |
| PF03575 | Peptidase_S51 | 0.32 |
| PF03704 | BTAD | 0.32 |
| PF13231 | PMT_2 | 0.32 |
| PF13193 | AMP-binding_C | 0.32 |
| PF04397 | LytTR | 0.32 |
| PF00085 | Thioredoxin | 0.32 |
| PF00381 | PTS-HPr | 0.32 |
| PF03144 | GTP_EFTU_D2 | 0.32 |
| PF00561 | Abhydrolase_1 | 0.32 |
| PF03618 | Kinase-PPPase | 0.32 |
| PF02852 | Pyr_redox_dim | 0.32 |
| PF00162 | PGK | 0.32 |
| PF12399 | BCA_ABC_TP_C | 0.32 |
| PF06983 | 3-dmu-9_3-mt | 0.32 |
| PF09459 | EB_dh | 0.32 |
| PF02586 | SRAP | 0.32 |
| PF00012 | HSP70 | 0.32 |
| PF13377 | Peripla_BP_3 | 0.32 |
| PF06146 | PsiE | 0.32 |
| PF05488 | PAAR_motif | 0.32 |
| PF04828 | GFA | 0.32 |
| PF13683 | rve_3 | 0.32 |
| PF08352 | oligo_HPY | 0.32 |
| PF01839 | FG-GAP | 0.32 |
| PF13544 | Obsolete Pfam Family | 0.32 |
| PF04380 | BMFP | 0.32 |
| PF05362 | Lon_C | 0.32 |
| PF00903 | Glyoxalase | 0.32 |
| PF00310 | GATase_2 | 0.32 |
| PF07681 | DoxX | 0.32 |
| PF07992 | Pyr_redox_2 | 0.32 |
| PF00528 | BPD_transp_1 | 0.32 |
| PF01467 | CTP_transf_like | 0.32 |
| PF02595 | Gly_kinase | 0.32 |
| PF01208 | URO-D | 0.32 |
| PF13649 | Methyltransf_25 | 0.32 |
| PF13511 | DUF4124 | 0.32 |
| PF13442 | Cytochrome_CBB3 | 0.32 |
| PF07732 | Cu-oxidase_3 | 0.32 |
| PF11008 | DUF2846 | 0.32 |
| PF01734 | Patatin | 0.32 |
| PF03364 | Polyketide_cyc | 0.32 |
| PF00793 | DAHP_synth_1 | 0.32 |
| PF06742 | DUF1214 | 0.32 |
| PF01163 | RIO1 | 0.32 |
| PF00665 | rve | 0.32 |
| PF00656 | Peptidase_C14 | 0.32 |
| PF13551 | HTH_29 | 0.32 |
| PF07731 | Cu-oxidase_2 | 0.32 |
| PF10049 | DUF2283 | 0.32 |
| PF00268 | Ribonuc_red_sm | 0.32 |
| PF13560 | HTH_31 | 0.32 |
| PF00701 | DHDPS | 0.32 |
| PF02678 | Pirin | 0.32 |
| PF10518 | TAT_signal | 0.32 |
| PF13419 | HAD_2 | 0.32 |
| PF01230 | HIT | 0.32 |
| COG ID | Name | Functional Category | % Frequency in 309 Family Scaffolds |
|---|---|---|---|
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 7.12 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 2.91 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 2.91 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 2.91 |
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 1.29 |
| COG2197 | DNA-binding response regulator, NarL/FixJ family, contains REC and HTH domains | Transcription [K] | 1.29 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 1.29 |
| COG0598 | Mg2+ and Co2+ transporter CorA | Inorganic ion transport and metabolism [P] | 0.97 |
| COG0707 | UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase | Cell wall/membrane/envelope biogenesis [M] | 0.97 |
| COG0381 | UDP-N-acetylglucosamine 2-epimerase | Cell wall/membrane/envelope biogenesis [M] | 0.97 |
| COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 0.97 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.65 |
| COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 0.65 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.65 |
| COG0329 | 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase | Cell wall/membrane/envelope biogenesis [M] | 0.65 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.65 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.65 |
| COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 0.65 |
| COG4104 | Zn-binding Pro-Ala-Ala-Arg (PAAR) domain, involved in Type VI secretion | Intracellular trafficking, secretion, and vesicular transport [U] | 0.32 |
| COG3223 | Phosphate starvation-inducible membrane PsiE (function unknown) | General function prediction only [R] | 0.32 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.32 |
| COG3480 | Predicted secreted protein YlbL, contains PDZ domain | Signal transduction mechanisms [T] | 0.32 |
| COG5402 | Uncharacterized protein, contains DUF1214 domain | Function unknown [S] | 0.32 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.32 |
| COG3629 | DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domain | Transcription [K] | 0.32 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.32 |
| COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 0.32 |
| COG3947 | Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains | Transcription [K] | 0.32 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.32 |
| COG5361 | Uncharacterized conserved protein | Mobilome: prophages, transposons [X] | 0.32 |
| COG4249 | Uncharacterized conserved protein, contains caspase domain | General function prediction only [R] | 0.32 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.32 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.32 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.32 |
| COG0126 | 3-phosphoglycerate kinase | Carbohydrate transport and metabolism [G] | 0.32 |
| COG0208 | Ribonucleotide reductase beta subunit, ferritin-like domain | Nucleotide transport and metabolism [F] | 0.32 |
| COG0407 | Uroporphyrinogen-III decarboxylase HemE | Coenzyme transport and metabolism [H] | 0.32 |
| COG0443 | Molecular chaperone DnaK (HSP70) | Posttranslational modification, protein turnover, chaperones [O] | 0.32 |
| COG0466 | ATP-dependent Lon protease, bacterial type | Posttranslational modification, protein turnover, chaperones [O] | 0.32 |
| COG0757 | 3-dehydroquinate dehydratase | Amino acid transport and metabolism [E] | 0.32 |
| COG1067 | Predicted ATP-dependent protease | Posttranslational modification, protein turnover, chaperones [O] | 0.32 |
| COG1741 | Redox-sensitive bicupin YhaK, pirin superfamily | General function prediction only [R] | 0.32 |
| COG1750 | Predicted archaeal serine protease, S18 family | General function prediction only [R] | 0.32 |
| COG2960 | Ubiquinone biosynthesis accessory factor UbiK | Coenzyme transport and metabolism [H] | 0.32 |
| COG1806 | Regulator of PEP synthase PpsR, kinase-PPPase family (combines ADP:protein kinase and phosphorylase activities) | Signal transduction mechanisms [T] | 0.32 |
| COG1925 | HPr or related phosphotransfer protein | Signal transduction mechanisms [T] | 0.32 |
| COG1929 | Glycerate kinase | Carbohydrate transport and metabolism [G] | 0.32 |
| COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 0.32 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.32 |
| COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 0.32 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.32 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.32 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 89.64 % |
| Unclassified | root | N/A | 10.36 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2162886012|MBSR1b_contig_3339001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 911 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_105588248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1200 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_103053465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 529 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_108020211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 975 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_109042605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 1721 | Open in IMG/M |
| 3300001431|F14TB_104528183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 534 | Open in IMG/M |
| 3300004050|Ga0055491_10140480 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300004155|Ga0066600_10144391 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 980 | Open in IMG/M |
| 3300004155|Ga0066600_10560134 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 565 | Open in IMG/M |
| 3300005327|Ga0070658_10335449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1293 | Open in IMG/M |
| 3300005328|Ga0070676_10774369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 706 | Open in IMG/M |
| 3300005332|Ga0066388_101431567 | All Organisms → cellular organisms → Bacteria | 1203 | Open in IMG/M |
| 3300005333|Ga0070677_10606900 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 607 | Open in IMG/M |
| 3300005335|Ga0070666_10188656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1448 | Open in IMG/M |
| 3300005335|Ga0070666_10909547 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300005336|Ga0070680_101862868 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 521 | Open in IMG/M |
| 3300005339|Ga0070660_101292384 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300005340|Ga0070689_101219102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Achromobacter → Achromobacter marplatensis | 676 | Open in IMG/M |
| 3300005344|Ga0070661_100384604 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
| 3300005344|Ga0070661_100684110 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 835 | Open in IMG/M |
| 3300005344|Ga0070661_101580256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 554 | Open in IMG/M |
| 3300005347|Ga0070668_102187285 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 511 | Open in IMG/M |
| 3300005353|Ga0070669_100628441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans | 902 | Open in IMG/M |
| 3300005353|Ga0070669_100657533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 882 | Open in IMG/M |
| 3300005353|Ga0070669_100818199 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 792 | Open in IMG/M |
| 3300005353|Ga0070669_101123608 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300005354|Ga0070675_100029737 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4408 | Open in IMG/M |
| 3300005354|Ga0070675_101344275 | Not Available | 659 | Open in IMG/M |
| 3300005354|Ga0070675_101948119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 542 | Open in IMG/M |
| 3300005364|Ga0070673_101702193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 597 | Open in IMG/M |
| 3300005365|Ga0070688_101569103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 537 | Open in IMG/M |
| 3300005366|Ga0070659_100686469 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300005366|Ga0070659_101716234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Nitrosococcus | 562 | Open in IMG/M |
| 3300005367|Ga0070667_100738754 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300005367|Ga0070667_101061551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 757 | Open in IMG/M |
| 3300005367|Ga0070667_101606930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 611 | Open in IMG/M |
| 3300005439|Ga0070711_101327963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 624 | Open in IMG/M |
| 3300005439|Ga0070711_101630901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 564 | Open in IMG/M |
| 3300005456|Ga0070678_100535440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → Variovorax paradoxus | 1038 | Open in IMG/M |
| 3300005457|Ga0070662_100549168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 968 | Open in IMG/M |
| 3300005459|Ga0068867_100163055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1759 | Open in IMG/M |
| 3300005468|Ga0070707_100994461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 804 | Open in IMG/M |
| 3300005491|Ga0074212_108274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 821 | Open in IMG/M |
| 3300005539|Ga0068853_100446752 | Not Available | 1216 | Open in IMG/M |
| 3300005539|Ga0068853_101050904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 785 | Open in IMG/M |
| 3300005539|Ga0068853_101973254 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300005539|Ga0068853_102177005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Nitrosococcus | 538 | Open in IMG/M |
| 3300005543|Ga0070672_101006248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 739 | Open in IMG/M |
| 3300005543|Ga0070672_101018651 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300005543|Ga0070672_102060730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 514 | Open in IMG/M |
| 3300005547|Ga0070693_101161977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 591 | Open in IMG/M |
| 3300005547|Ga0070693_101348344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 553 | Open in IMG/M |
| 3300005548|Ga0070665_101093934 | Not Available | 809 | Open in IMG/M |
| 3300005548|Ga0070665_101679124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 643 | Open in IMG/M |
| 3300005548|Ga0070665_102463138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 522 | Open in IMG/M |
| 3300005563|Ga0068855_102318123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 537 | Open in IMG/M |
| 3300005564|Ga0070664_100875962 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300005578|Ga0068854_100238763 | All Organisms → cellular organisms → Bacteria | 1446 | Open in IMG/M |
| 3300005614|Ga0068856_100458163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1296 | Open in IMG/M |
| 3300005614|Ga0068856_102469763 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300005615|Ga0070702_100566608 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 846 | Open in IMG/M |
| 3300005616|Ga0068852_100373706 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1397 | Open in IMG/M |
| 3300005616|Ga0068852_100694477 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
| 3300005617|Ga0068859_100043841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 4496 | Open in IMG/M |
| 3300005618|Ga0068864_101987247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 587 | Open in IMG/M |
| 3300005618|Ga0068864_102132309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 567 | Open in IMG/M |
| 3300005719|Ga0068861_100105037 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2255 | Open in IMG/M |
| 3300005719|Ga0068861_100286673 | All Organisms → cellular organisms → Bacteria | 1420 | Open in IMG/M |
| 3300005834|Ga0068851_11036009 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300005834|Ga0068851_11043663 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 517 | Open in IMG/M |
| 3300005840|Ga0068870_10468843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 833 | Open in IMG/M |
| 3300005841|Ga0068863_100355358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1427 | Open in IMG/M |
| 3300005842|Ga0068858_100855027 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 888 | Open in IMG/M |
| 3300005842|Ga0068858_101858770 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300005842|Ga0068858_102244036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 540 | Open in IMG/M |
| 3300005843|Ga0068860_100906823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 898 | Open in IMG/M |
| 3300005844|Ga0068862_100318533 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1435 | Open in IMG/M |
| 3300005844|Ga0068862_100458726 | Not Available | 1203 | Open in IMG/M |
| 3300005901|Ga0075274_1022935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 855 | Open in IMG/M |
| 3300005937|Ga0081455_10233765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 1355 | Open in IMG/M |
| 3300005940|Ga0073913_10088736 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 529 | Open in IMG/M |
| 3300006224|Ga0079037_101884459 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300006237|Ga0097621_100534970 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300006237|Ga0097621_100599590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1007 | Open in IMG/M |
| 3300006237|Ga0097621_100815720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 865 | Open in IMG/M |
| 3300006358|Ga0068871_102019946 | Not Available | 549 | Open in IMG/M |
| 3300006606|Ga0074062_12824197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 799 | Open in IMG/M |
| 3300006846|Ga0075430_100683852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Nitrosococcus → Nitrosococcus oceani | 846 | Open in IMG/M |
| 3300006852|Ga0075433_10164806 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1973 | Open in IMG/M |
| 3300006852|Ga0075433_11604379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 561 | Open in IMG/M |
| 3300006881|Ga0068865_100426663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1091 | Open in IMG/M |
| 3300006881|Ga0068865_100830443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 799 | Open in IMG/M |
| 3300006904|Ga0075424_100839159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 980 | Open in IMG/M |
| 3300006904|Ga0075424_101385069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 747 | Open in IMG/M |
| 3300006904|Ga0075424_102002085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 611 | Open in IMG/M |
| 3300006914|Ga0075436_101122437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 592 | Open in IMG/M |
| 3300006954|Ga0079219_11256923 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 647 | Open in IMG/M |
| 3300007076|Ga0075435_100476971 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1077 | Open in IMG/M |
| 3300007076|Ga0075435_101478626 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300009011|Ga0105251_10180693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 950 | Open in IMG/M |
| 3300009075|Ga0105090_10790732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 576 | Open in IMG/M |
| 3300009087|Ga0105107_11075147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 560 | Open in IMG/M |
| 3300009098|Ga0105245_12029926 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300009148|Ga0105243_13057425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 507 | Open in IMG/M |
| 3300009167|Ga0113563_10277986 | All Organisms → cellular organisms → Bacteria | 1722 | Open in IMG/M |
| 3300009167|Ga0113563_12355035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 641 | Open in IMG/M |
| 3300009176|Ga0105242_12676696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 548 | Open in IMG/M |
| 3300009177|Ga0105248_12073145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 646 | Open in IMG/M |
| 3300009177|Ga0105248_12714201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 565 | Open in IMG/M |
| 3300009430|Ga0114938_1020346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2737 | Open in IMG/M |
| 3300009455|Ga0114939_10005239 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8194 | Open in IMG/M |
| 3300009455|Ga0114939_10080580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1387 | Open in IMG/M |
| 3300009540|Ga0073899_11104071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 555 | Open in IMG/M |
| 3300009553|Ga0105249_13529659 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300010154|Ga0127503_10415481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 1137 | Open in IMG/M |
| 3300010397|Ga0134124_11339415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 740 | Open in IMG/M |
| 3300010397|Ga0134124_12053497 | Not Available | 609 | Open in IMG/M |
| 3300010397|Ga0134124_12759486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 535 | Open in IMG/M |
| 3300010400|Ga0134122_12724274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 546 | Open in IMG/M |
| 3300010403|Ga0134123_10035634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 3657 | Open in IMG/M |
| 3300011106|Ga0151489_1337156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 552 | Open in IMG/M |
| 3300012211|Ga0137377_11903974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 512 | Open in IMG/M |
| 3300012212|Ga0150985_115642542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 648 | Open in IMG/M |
| 3300012357|Ga0137384_10948908 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300012533|Ga0138256_11186723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 567 | Open in IMG/M |
| 3300012923|Ga0137359_11529788 | Not Available | 555 | Open in IMG/M |
| 3300013105|Ga0157369_10841449 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300013296|Ga0157374_11044445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 837 | Open in IMG/M |
| 3300013296|Ga0157374_11415489 | Not Available | 718 | Open in IMG/M |
| 3300013297|Ga0157378_10017253 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6331 | Open in IMG/M |
| 3300013297|Ga0157378_10075504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. URHB0020 | 3035 | Open in IMG/M |
| 3300013297|Ga0157378_10204365 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1870 | Open in IMG/M |
| 3300013297|Ga0157378_10509408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1203 | Open in IMG/M |
| 3300013306|Ga0163162_11539044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Achromobacter → Achromobacter marplatensis | 758 | Open in IMG/M |
| 3300013307|Ga0157372_10935646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Arenicellales → Arenicellaceae → Arenicella → Arenicella xantha | 1005 | Open in IMG/M |
| 3300013308|Ga0157375_10358003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1625 | Open in IMG/M |
| 3300013308|Ga0157375_11489874 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300013308|Ga0157375_11933605 | Not Available | 700 | Open in IMG/M |
| 3300013308|Ga0157375_12398801 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300013308|Ga0157375_13491973 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300014157|Ga0134078_10512153 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 560 | Open in IMG/M |
| 3300014303|Ga0075358_1099509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 571 | Open in IMG/M |
| 3300014312|Ga0075345_1133079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 586 | Open in IMG/M |
| 3300014323|Ga0075356_1224199 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 516 | Open in IMG/M |
| 3300014325|Ga0163163_11674464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 697 | Open in IMG/M |
| 3300014325|Ga0163163_11917607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 652 | Open in IMG/M |
| 3300014325|Ga0163163_12457672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 579 | Open in IMG/M |
| 3300014968|Ga0157379_10175232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1936 | Open in IMG/M |
| 3300014968|Ga0157379_11644999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium GR16-43 | 628 | Open in IMG/M |
| 3300014968|Ga0157379_11653740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 626 | Open in IMG/M |
| 3300014968|Ga0157379_12538548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 513 | Open in IMG/M |
| 3300014969|Ga0157376_10718930 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| 3300014969|Ga0157376_11187898 | Not Available | 791 | Open in IMG/M |
| 3300015371|Ga0132258_12602120 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1264 | Open in IMG/M |
| 3300015374|Ga0132255_102010810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 880 | Open in IMG/M |
| 3300016357|Ga0182032_10365906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45 | 1158 | Open in IMG/M |
| 3300016357|Ga0182032_10682867 | Not Available | 861 | Open in IMG/M |
| 3300016387|Ga0182040_10284327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1258 | Open in IMG/M |
| 3300016422|Ga0182039_11091720 | Not Available | 718 | Open in IMG/M |
| 3300016445|Ga0182038_10312804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1288 | Open in IMG/M |
| 3300016445|Ga0182038_10579484 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
| 3300017936|Ga0187821_10313817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 625 | Open in IMG/M |
| 3300017947|Ga0187785_10643182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Phenylobacterium → unclassified Phenylobacterium → Phenylobacterium sp. | 550 | Open in IMG/M |
| 3300017959|Ga0187779_10320255 | Not Available | 996 | Open in IMG/M |
| 3300018468|Ga0066662_10791315 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
| 3300018476|Ga0190274_13482482 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 531 | Open in IMG/M |
| 3300020004|Ga0193755_1192731 | Not Available | 588 | Open in IMG/M |
| 3300021432|Ga0210384_10923883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 773 | Open in IMG/M |
| 3300021445|Ga0182009_10378280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 728 | Open in IMG/M |
| 3300021445|Ga0182009_10441773 | Not Available | 678 | Open in IMG/M |
| 3300025130|Ga0209594_1010616 | All Organisms → cellular organisms → Bacteria | 3665 | Open in IMG/M |
| 3300025321|Ga0207656_10695087 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300025900|Ga0207710_10777020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 503 | Open in IMG/M |
| 3300025903|Ga0207680_11041566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 586 | Open in IMG/M |
| 3300025907|Ga0207645_10915687 | Not Available | 595 | Open in IMG/M |
| 3300025908|Ga0207643_10259917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1072 | Open in IMG/M |
| 3300025923|Ga0207681_10930830 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300025923|Ga0207681_11189772 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300025923|Ga0207681_11400492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 587 | Open in IMG/M |
| 3300025923|Ga0207681_11426991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 581 | Open in IMG/M |
| 3300025925|Ga0207650_10233915 | All Organisms → cellular organisms → Bacteria | 1483 | Open in IMG/M |
| 3300025925|Ga0207650_10717349 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 845 | Open in IMG/M |
| 3300025926|Ga0207659_10052561 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2903 | Open in IMG/M |
| 3300025926|Ga0207659_11453153 | Not Available | 587 | Open in IMG/M |
| 3300025927|Ga0207687_10562711 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300025927|Ga0207687_10944633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Arenicellales → Arenicellaceae → Arenicella → Arenicella xantha | 739 | Open in IMG/M |
| 3300025930|Ga0207701_10699761 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300025931|Ga0207644_10449202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Arenicellales → Arenicellaceae → Arenicella → Arenicella xantha | 1059 | Open in IMG/M |
| 3300025931|Ga0207644_11875241 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300025932|Ga0207690_10933333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 721 | Open in IMG/M |
| 3300025933|Ga0207706_10175421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Arenicellales → Arenicellaceae → Arenicella → Arenicella xantha | 1883 | Open in IMG/M |
| 3300025933|Ga0207706_10543053 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1001 | Open in IMG/M |
| 3300025933|Ga0207706_11439567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 564 | Open in IMG/M |
| 3300025937|Ga0207669_10969238 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 713 | Open in IMG/M |
| 3300025938|Ga0207704_10076223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 2148 | Open in IMG/M |
| 3300025938|Ga0207704_10957273 | Not Available | 722 | Open in IMG/M |
| 3300025940|Ga0207691_10525315 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300025940|Ga0207691_11306844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 599 | Open in IMG/M |
| 3300025949|Ga0207667_11713831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 595 | Open in IMG/M |
| 3300025960|Ga0207651_11129691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 703 | Open in IMG/M |
| 3300025960|Ga0207651_11743993 | Not Available | 561 | Open in IMG/M |
| 3300025972|Ga0207668_10132921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Oxalobacter → Oxalobacter formigenes | 1902 | Open in IMG/M |
| 3300025972|Ga0207668_10161936 | All Organisms → cellular organisms → Bacteria | 1744 | Open in IMG/M |
| 3300025972|Ga0207668_10439396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1111 | Open in IMG/M |
| 3300025972|Ga0207668_10528855 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
| 3300025972|Ga0207668_10679845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 903 | Open in IMG/M |
| 3300025986|Ga0207658_10226701 | All Organisms → cellular organisms → Bacteria | 1575 | Open in IMG/M |
| 3300025986|Ga0207658_10443792 | Not Available | 1148 | Open in IMG/M |
| 3300025986|Ga0207658_11018909 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300025986|Ga0207658_11629071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Caenimonas → Caenimonas soli | 590 | Open in IMG/M |
| 3300025986|Ga0207658_11734007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 570 | Open in IMG/M |
| 3300025986|Ga0207658_11898124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 543 | Open in IMG/M |
| 3300026023|Ga0207677_12289180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 503 | Open in IMG/M |
| 3300026035|Ga0207703_11656637 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300026035|Ga0207703_11969437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. BMG5.36 | 560 | Open in IMG/M |
| 3300026041|Ga0207639_10264248 | All Organisms → cellular organisms → Bacteria | 1506 | Open in IMG/M |
| 3300026041|Ga0207639_10761835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 900 | Open in IMG/M |
| 3300026067|Ga0207678_10177644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1818 | Open in IMG/M |
| 3300026078|Ga0207702_11123962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 780 | Open in IMG/M |
| 3300026078|Ga0207702_12290128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 528 | Open in IMG/M |
| 3300026088|Ga0207641_10417614 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1291 | Open in IMG/M |
| 3300026088|Ga0207641_10483725 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
| 3300026088|Ga0207641_12131665 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 561 | Open in IMG/M |
| 3300026088|Ga0207641_12513556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 513 | Open in IMG/M |
| 3300026089|Ga0207648_10009975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dyella | 9041 | Open in IMG/M |
| 3300026089|Ga0207648_10507973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax | 1103 | Open in IMG/M |
| 3300026095|Ga0207676_10769223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 938 | Open in IMG/M |
| 3300026121|Ga0207683_11103189 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300026121|Ga0207683_11412471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera → Thauera aromatica → Thauera aromatica K172 | 643 | Open in IMG/M |
| 3300026142|Ga0207698_10782586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 955 | Open in IMG/M |
| 3300026142|Ga0207698_12242274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 559 | Open in IMG/M |
| 3300027691|Ga0209485_1074303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 916 | Open in IMG/M |
| 3300027850|Ga0209591_10008439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 11223 | Open in IMG/M |
| 3300027871|Ga0209397_10031704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1802 | Open in IMG/M |
| 3300027876|Ga0209974_10403117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 537 | Open in IMG/M |
| 3300027877|Ga0209293_10105595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1282 | Open in IMG/M |
| 3300027878|Ga0209181_10122761 | Not Available | 2482 | Open in IMG/M |
| 3300027885|Ga0209450_10848744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geomonas → unclassified Geomonas → Geomonas sp. Red32 | 656 | Open in IMG/M |
| 3300027885|Ga0209450_11189530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 530 | Open in IMG/M |
| 3300027897|Ga0209254_10831957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 621 | Open in IMG/M |
| 3300027899|Ga0209668_10406181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 892 | Open in IMG/M |
| 3300027900|Ga0209253_11054904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 557 | Open in IMG/M |
| 3300027909|Ga0209382_10754750 | Not Available | 1041 | Open in IMG/M |
| 3300028379|Ga0268266_10126927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2278 | Open in IMG/M |
| 3300028379|Ga0268266_12053403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 545 | Open in IMG/M |
| 3300028380|Ga0268265_10587258 | Not Available | 1063 | Open in IMG/M |
| 3300028380|Ga0268265_11308145 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300028380|Ga0268265_11729428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 631 | Open in IMG/M |
| 3300028381|Ga0268264_10823624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 928 | Open in IMG/M |
| 3300028381|Ga0268264_12231059 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300028590|Ga0247823_10651582 | Not Available | 792 | Open in IMG/M |
| 3300028592|Ga0247822_11763066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 528 | Open in IMG/M |
| 3300029987|Ga0311334_10304385 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1246 | Open in IMG/M |
| 3300029990|Ga0311336_10915920 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 759 | Open in IMG/M |
| 3300030000|Ga0311337_10557481 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 983 | Open in IMG/M |
| 3300030002|Ga0311350_11851441 | Not Available | 532 | Open in IMG/M |
| 3300030019|Ga0311348_11028971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 613 | Open in IMG/M |
| 3300031521|Ga0311364_12478714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 505 | Open in IMG/M |
| 3300031538|Ga0310888_10239218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1014 | Open in IMG/M |
| 3300031547|Ga0310887_10501200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylovulum | 731 | Open in IMG/M |
| 3300031547|Ga0310887_10683099 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300031561|Ga0318528_10729503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 530 | Open in IMG/M |
| 3300031562|Ga0310886_10409871 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300031726|Ga0302321_100901743 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1002 | Open in IMG/M |
| 3300031769|Ga0318526_10439660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 533 | Open in IMG/M |
| 3300031771|Ga0318546_10260255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45 | 1195 | Open in IMG/M |
| 3300031777|Ga0318543_10141338 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
| 3300031792|Ga0318529_10285049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 769 | Open in IMG/M |
| 3300031805|Ga0318497_10621264 | Not Available | 606 | Open in IMG/M |
| 3300031847|Ga0310907_10613812 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 594 | Open in IMG/M |
| 3300031858|Ga0310892_10394445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 899 | Open in IMG/M |
| 3300031901|Ga0307406_11836068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 539 | Open in IMG/M |
| 3300031902|Ga0302322_100619318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 1275 | Open in IMG/M |
| 3300031902|Ga0302322_102318764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 661 | Open in IMG/M |
| 3300031938|Ga0308175_100234588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1831 | Open in IMG/M |
| 3300031939|Ga0308174_10150875 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1729 | Open in IMG/M |
| 3300031939|Ga0308174_10669864 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 864 | Open in IMG/M |
| 3300031939|Ga0308174_11640254 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300031939|Ga0308174_11659404 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 549 | Open in IMG/M |
| 3300031939|Ga0308174_11961243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 504 | Open in IMG/M |
| 3300031947|Ga0310909_10515285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1002 | Open in IMG/M |
| 3300031995|Ga0307409_100448059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 1245 | Open in IMG/M |
| 3300032005|Ga0307411_11659666 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300032013|Ga0310906_11261607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 539 | Open in IMG/M |
| 3300032042|Ga0318545_10193452 | Not Available | 727 | Open in IMG/M |
| 3300032044|Ga0318558_10098829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45 | 1364 | Open in IMG/M |
| 3300032052|Ga0318506_10457957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 565 | Open in IMG/M |
| 3300032089|Ga0318525_10281985 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
| 3300032143|Ga0315292_11425035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 563 | Open in IMG/M |
| 3300032164|Ga0315283_11998874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 577 | Open in IMG/M |
| 3300032275|Ga0315270_11060088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 538 | Open in IMG/M |
| 3300032276|Ga0316188_10514986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 640 | Open in IMG/M |
| 3300032770|Ga0335085_11116565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 844 | Open in IMG/M |
| 3300032954|Ga0335083_10001525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 31684 | Open in IMG/M |
| 3300033289|Ga0310914_10439365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45 | 1181 | Open in IMG/M |
| 3300033408|Ga0316605_10943022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 826 | Open in IMG/M |
| 3300033413|Ga0316603_11007831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 786 | Open in IMG/M |
| 3300033414|Ga0316619_12157861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 509 | Open in IMG/M |
| 3300033418|Ga0316625_100146748 | All Organisms → cellular organisms → Bacteria | 1447 | Open in IMG/M |
| 3300033418|Ga0316625_100286159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 1162 | Open in IMG/M |
| 3300033481|Ga0316600_10746641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 689 | Open in IMG/M |
| 3300033482|Ga0316627_100268904 | Not Available | 1374 | Open in IMG/M |
| 3300033482|Ga0316627_100341967 | Not Available | 1253 | Open in IMG/M |
| 3300033483|Ga0316629_10935252 | Not Available | 676 | Open in IMG/M |
| 3300033513|Ga0316628_103430652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 573 | Open in IMG/M |
| 3300033550|Ga0247829_11062660 | Not Available | 672 | Open in IMG/M |
| 3300034177|Ga0364932_0365513 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 544 | Open in IMG/M |
| 3300034691|Ga0370488_129455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 731 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 12.30% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 7.77% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 6.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.18% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 4.53% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 4.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.21% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.21% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.24% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.24% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.94% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.94% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.62% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.62% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.62% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 1.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.29% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.29% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.29% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.97% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.97% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.97% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.97% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.97% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.97% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.65% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.65% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.65% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.65% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.65% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.65% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.65% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.65% |
| Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Sediment | 0.32% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.32% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.32% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 0.32% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.32% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.32% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.32% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.32% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.32% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.32% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.32% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.32% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.32% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.32% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.32% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.32% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.32% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.32% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.32% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.32% |
| Active Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge | 0.32% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300004050 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D2 | Environmental | Open in IMG/M |
| 3300004155 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005491 | Sediment ecosystem from Lake Washington, Seattle, Washington, USA - Formaldehyde enrichment | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005901 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_201 | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005940 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 | Environmental | Open in IMG/M |
| 3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009430 | Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Big Spring | Environmental | Open in IMG/M |
| 3300009455 | Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Crystal Spring | Environmental | Open in IMG/M |
| 3300009540 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB5-Ph | Engineered | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011106 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012533 | Active sludge microbial communities from wastewater in Klosterneuburg, Austria - KNB2014incub_MG | Engineered | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014303 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014312 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D1 | Environmental | Open in IMG/M |
| 3300014323 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailB_D1 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300025130 | Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Crystal Spring (SPAdes) | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027691 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027850 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01 (SPAdes) | Environmental | Open in IMG/M |
| 3300027871 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027877 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027878 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-05 (SPAdes) | Environmental | Open in IMG/M |
| 3300027885 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes) | Environmental | Open in IMG/M |
| 3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028590 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30 | Environmental | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300030000 | I_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030019 | II_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
| 3300032276 | Coastal sediment microbial communities from Maine, United States - Phippsburg worm burrow 1 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
| 3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
| 3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033481 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CT | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033483 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300034177 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17 | Environmental | Open in IMG/M |
| 3300034691 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_04D_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| MBSR1b_0951.00006730 | 2162886012 | Miscanthus Rhizosphere | NRPDANHRYMTDRAVRDQMVMKGWLAEGDGPDLVVMCAPQ |
| INPhiseqgaiiFebDRAFT_1055882481 | 3300000364 | Soil | FSNRADANHRYMTERAIRDQMVGMGWLAEGDGPDLVVMCAPS* |
| JGIcombinedJ13530_1030534652 | 3300001213 | Wetland | FSNRADANHRYTTDRATRDQMVGKGWLAEGDGPDFVVMCAPQ* |
| JGIcombinedJ13530_1080202113 | 3300001213 | Wetland | FSARPDANHRYMTDRAVRDQMVLNGWLAEGDGPDLVVMCAPL* |
| JGIcombinedJ13530_1090426051 | 3300001213 | Wetland | HRYMTDRTVRDQMVAKGWLAEGDGPDLVVMCAPQ* |
| F14TB_1045281831 | 3300001431 | Soil | TTPIYRVFSNRPDANHRYMIDRAVRTEMTSKGWLAEGDGPDRVVMCGP* |
| Ga0055491_101404802 | 3300004050 | Natural And Restored Wetlands | GTVPVYRVFSNRPDANHRYMVDRTVREQMAARGWLVEGDGPDAVVLCAPQ* |
| Ga0066600_101443912 | 3300004155 | Freshwater | VFSNRPDANHRYMTDRAVRDQMVAKGWLAEGDGPDLVVMCAPQ* |
| Ga0066600_105601342 | 3300004155 | Freshwater | TTPVYRVFSNRPDANHRYMTDRVVRDQMIARGWLAEGDGPELVVMCAPP* |
| Ga0070658_103354491 | 3300005327 | Corn Rhizosphere | ACPAGSVAIYRLFNNRPDANHRYITDSFARDQMAARGWIAEGDGPDRVVMCAPQ* |
| Ga0070676_107743693 | 3300005328 | Miscanthus Rhizosphere | VAIYRLFNNRPDANHRYITDSFARDQMAARGWIAEGDGPDRVVMCAPQ* |
| Ga0066388_1014315671 | 3300005332 | Tropical Forest Soil | RADANHRYMTDPALRDQMVAQNWIAEGDGPDKVVMCAPG* |
| Ga0070677_106069002 | 3300005333 | Miscanthus Rhizosphere | TSIYRAFSNRTDANHRYMTDRAIRSQMVAAGWLAEGDGPDLVVMCAQ* |
| Ga0070666_101886563 | 3300005335 | Switchgrass Rhizosphere | NRSDANHRYTTERTVRESMITRGWLAEGDGEDHVVMCTPAAI* |
| Ga0070666_109095472 | 3300005335 | Switchgrass Rhizosphere | PGTRNVYRVFSGRADANHRYMVDAGIRAAMVGKGWIAEGDGVDLVVMCAPA* |
| Ga0070680_1018628682 | 3300005336 | Corn Rhizosphere | VYRAFDNRPDANHRYMTDRAIRDQMVALGWIAEGDGPDLVVMCAPA* |
| Ga0070660_1012923842 | 3300005339 | Corn Rhizosphere | SNRPDANHRYMTDKTVRDQMVTKGWLAEGDGPDLVVMCAPQ* |
| Ga0070689_1012191021 | 3300005340 | Switchgrass Rhizosphere | SNRADVNHRYMTSRALRDQMAAQGWIAEGDGPDRVAMCVPV* |
| Ga0070661_1003846042 | 3300005344 | Corn Rhizosphere | RADANHRYMVDRAIRDQMVARGWLAEGDGADLVVMCAPA* |
| Ga0070661_1006841101 | 3300005344 | Corn Rhizosphere | GTTQIYRVFSNRPDANHRYMTSSALRDQMVAMGWLAEGDGPDQVVMCAPA* |
| Ga0070661_1015802562 | 3300005344 | Corn Rhizosphere | IYRVFSNRPDANHRYMTHRAVRDQMVARGWLAEGDGPDLVVMCAV* |
| Ga0070668_1021872851 | 3300005347 | Switchgrass Rhizosphere | TTQVYRVFSNRSDANHRYMTDRAIRDQMVAQGWLVEGDGPDAVVMCAPQ* |
| Ga0070669_1006284412 | 3300005353 | Switchgrass Rhizosphere | DANHRYTIDPQVRDQMVAMGWIAEGDGPDLVVMCAPAAP* |
| Ga0070669_1006575331 | 3300005353 | Switchgrass Rhizosphere | VYRVYSNRADANHRYMTSRAVRDTMVAKGWLAEGDGPDVVVMCAP* |
| Ga0070669_1008181992 | 3300005353 | Switchgrass Rhizosphere | FSGRPDANHRYMTDKLVRSVMVAKGWLVEGDGPDAVVMCAPQ* |
| Ga0070669_1011236081 | 3300005353 | Switchgrass Rhizosphere | PASTTPIYRVFSNRPDANHRYMTEKAVRDQMVSAGWLAEGDGSDLVVMCAPV* |
| Ga0070675_1000297374 | 3300005354 | Miscanthus Rhizosphere | MVAGTRPAATRPVYRVFSNRADVNHRYMTSRALRDQMAAQGWIAEGDGPDRVAMCVPV* |
| Ga0070675_1013442752 | 3300005354 | Miscanthus Rhizosphere | FSNRVDANHRYTTDRATRDLMVTKGWIAEGDGADTVVMCAPQ* |
| Ga0070675_1019481191 | 3300005354 | Miscanthus Rhizosphere | RMDANHRYMTDRLLRDQMVMMGWLAEGDGPDLVVMCAPPEP* |
| Ga0070673_1017021932 | 3300005364 | Switchgrass Rhizosphere | VFSNRADANHRYTTDRTTRDQMVAKGWLAEGDGPDRVVMCAP* |
| Ga0070688_1015691032 | 3300005365 | Switchgrass Rhizosphere | YRVFSNRPDANHRYMTDRAVRDQMVMKGWLAEGDGPDLVVMCAPQ* |
| Ga0070659_1006864691 | 3300005366 | Corn Rhizosphere | FSNRPDANHRYMTDRVVRDQMVARGWLAEGDGPDLVVMCAV* |
| Ga0070659_1017162341 | 3300005366 | Corn Rhizosphere | FSNRPDANHRYMTDRAVRDQMVAKGWIAEGDGPDLVVMCAPG* |
| Ga0070667_1007387541 | 3300005367 | Switchgrass Rhizosphere | YSNRADANHRYTTDRATRDLMVTRGWIAEGDGADIVVMCAPQ* |
| Ga0070667_1010615512 | 3300005367 | Switchgrass Rhizosphere | SIYRAFSNRTDANHRYMTDRAIRSQMVAAGWLAEGDGPDLVVMCAQ* |
| Ga0070667_1016069301 | 3300005367 | Switchgrass Rhizosphere | TEVYRVFDNRPDANHRYMTDKAVRDQMVAKGWLAEGDGPNMVVMCAPQ* |
| Ga0070711_1013279631 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VFSNRADANHRYMTDKAVRDAMVALGWLAEGDGPNLVAMCAPQ* |
| Ga0070711_1016309012 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | FRVFSNRPDANHRYMTDTQTRDQMVEAGWLAEGDGPDLVVMCAPQ* |
| Ga0070678_1005354403 | 3300005456 | Miscanthus Rhizosphere | TTQIYRVFSNRPDANHRYMTSSALRDQMVAMGWLAEGDGPDQVVMCAPA* |
| Ga0070662_1005491681 | 3300005457 | Corn Rhizosphere | VYRVFSNRADVNHRYMTSRALRDQMAAQGWIAEGDGPDRVAMCVPV* |
| Ga0068867_1001630551 | 3300005459 | Miscanthus Rhizosphere | FSNRPDANHRYMTDRAVRDQMVMKGWLAEGDGPDLVVMCAPQ* |
| Ga0070707_1009944612 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | RVFSNRPDANHRYMIVRTLRDQMVVLGWLAEGDGADLVVMCVPL* |
| Ga0074212_1082741 | 3300005491 | Sediment | SDANHRYMTDRAVRDQMVAKGWLAEGDGPDLVVMCAPQ* |
| Ga0068853_1004467522 | 3300005539 | Corn Rhizosphere | SNRPDANHRYMTSKLIRDQMVALGWLAEGDGPDLVVMCAPA* |
| Ga0068853_1010509041 | 3300005539 | Corn Rhizosphere | TTPVYRAFNNRADANHRYMTSVYQRDQMGAAGWILEGDGPDRVVMCAPGP* |
| Ga0068853_1019732541 | 3300005539 | Corn Rhizosphere | GRADANHRYMVDAGIRAAMVGKGWIAEGDGVDLVVMCAPA* |
| Ga0068853_1021770051 | 3300005539 | Corn Rhizosphere | VYRVFSNRPDANHRYMTDKNVRDQMVAAGWLAEGDGPDLVVMCAPQ* |
| Ga0070672_1010062482 | 3300005543 | Miscanthus Rhizosphere | TEVYRVFDNRPDANHRYMTDKAVRDQMVAKGWLAEGDGANMVVMCAPQ* |
| Ga0070672_1010186512 | 3300005543 | Miscanthus Rhizosphere | VFSNRSDANHRYTTNAQLRDRMVNLGWLAEGDGSDLVVMCAPS* |
| Ga0070672_1020607302 | 3300005543 | Miscanthus Rhizosphere | DANHRYMTEAALRDAMVSGGWIAEGDGADRVALCAPA* |
| Ga0070693_1011619772 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | FSNRADANHRYVTDPAVRNQMAMKGWLAEGDGPDLVVMCAPQ* |
| Ga0070693_1013483442 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | RADANHRYITDETTRAQMAASGWVVEGDGPDSVVMCAPL* |
| Ga0070665_1010939342 | 3300005548 | Switchgrass Rhizosphere | ANHRYMVNATIRDEMVAKHWLAEGDGPDLVVMCSPV* |
| Ga0070665_1016791243 | 3300005548 | Switchgrass Rhizosphere | VAIYRLFNNRPDANHRYVTDSFARDQMAARGWIAEGDGPDRVVMCAPQ* |
| Ga0070665_1024631381 | 3300005548 | Switchgrass Rhizosphere | LYRVFSNRADANHRYMIDRATRDFMLTLGWLAEGDGPNLVVMCMPA* |
| Ga0068855_1023181232 | 3300005563 | Corn Rhizosphere | ANHRYTTERSVREQMIARGWTAEGDGPDLVVMCAPQ* |
| Ga0070664_1008759621 | 3300005564 | Corn Rhizosphere | NHRYMVDAGIRAAMVGKGWIAEGDGVDLVVMCAPA* |
| Ga0068854_1002387631 | 3300005578 | Corn Rhizosphere | RVFSNRPDANHRYMTDKTVRDQMVTKGWLAEGDGPDLVVMCAPQ* |
| Ga0068856_1004581631 | 3300005614 | Corn Rhizosphere | NHRYMVDRAIRDQMVARGWLAEGDGADLVVMCAPA* |
| Ga0068856_1024697632 | 3300005614 | Corn Rhizosphere | EDPAFMHVYMTDRAFRDQMVARGWIAEGGGPDLVVMCSPS* |
| Ga0070702_1005666082 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | YRVFSNRADANHRYMTDRAVRAQMVAKGWLAEGDGPDLVVMCAPQ* |
| Ga0068852_1003737061 | 3300005616 | Corn Rhizosphere | TCPDNITPVYRVFSNRADANHRYMTDPALRDAMVATGWLAEGDGPDRVVMCAP* |
| Ga0068852_1006944772 | 3300005616 | Corn Rhizosphere | PSNTAQVYRVFSNRVDANHRYMTDPIMRDQMVTKGWIAEGDGPDRVVMCAPL* |
| Ga0068859_1000438411 | 3300005617 | Switchgrass Rhizosphere | RADANHRYTTSRAVRDTMVAKGWLAEGDGPDVVVMCAP* |
| Ga0068864_1019872472 | 3300005618 | Switchgrass Rhizosphere | NHRYMTDKAVRDQMVAKGWLAEGDGPNMVVMCAPQ* |
| Ga0068864_1021323092 | 3300005618 | Switchgrass Rhizosphere | DANHRYMTDRAVRDQMVARGWLAEGDGPDLVVMCAA* |
| Ga0068861_1001050371 | 3300005719 | Switchgrass Rhizosphere | VFNNRPDANHRYTIERGLRDLMVEGGWIAEGDGDDRVVMCVAL* |
| Ga0068861_1002866731 | 3300005719 | Switchgrass Rhizosphere | RVFSNRPDANHRYTIERAVRDDMVAHGWIAEGDGPDRVVMCAPS* |
| Ga0068851_110360092 | 3300005834 | Corn Rhizosphere | QIYRVFSNRPDANHRYMTSRALRDQMVAMGWLSEGDGPDQVVMCAPA* |
| Ga0068851_110436632 | 3300005834 | Corn Rhizosphere | ANSTQVYRVFSNRPDANHRYMTDKTVRDQMVTKGWLAEGDGPDLVVMCAPQ* |
| Ga0068870_104688433 | 3300005840 | Miscanthus Rhizosphere | DANHRYVTDPAVRNQMAMKGWLAEGDGPDLVVMCAPQ* |
| Ga0068863_1003553583 | 3300005841 | Switchgrass Rhizosphere | TAGVCPPFTTQVYRVFSNRPDANHRYMTEKTVRDLMAASGWLVEGDGPDLVVMCAPA* |
| Ga0068858_1008550273 | 3300005842 | Switchgrass Rhizosphere | FSNRPDANHRYMTDRAIRDEMVARGWLAEGDGANLVVMCAPAS* |
| Ga0068858_1018587702 | 3300005842 | Switchgrass Rhizosphere | SGRADANHRYMVDPAIRAAMVTTGWIAEGDGADMVVMCAPA* |
| Ga0068858_1022440362 | 3300005842 | Switchgrass Rhizosphere | QIYRVFSNRADANHRYMTDKAIRSQMTSKGWLEEGDGPDLVVMCEPTAPPGP* |
| Ga0068860_1009068231 | 3300005843 | Switchgrass Rhizosphere | SNRADANHRYMTDRATRDQMVAMGWVAEGDGPDLVVMCAPQ* |
| Ga0068862_1003185331 | 3300005844 | Switchgrass Rhizosphere | NHRYTTERAVRDEMAAKGWLVEGDGADAVVMCAPG* |
| Ga0068862_1004587262 | 3300005844 | Switchgrass Rhizosphere | VYRAFSNRADANHRYMVNPTIRDEMVAKHWLAEGDGPDLVVMCSPV* |
| Ga0075274_10229352 | 3300005901 | Rice Paddy Soil | VFSDRADANHRYMVDRSLRDQMVARGWLAEGDGPDLVVMCAPL* |
| Ga0081455_102337653 | 3300005937 | Tabebuia Heterophylla Rhizosphere | VFRVFSNRADANHRYMIDAAIRSQMVAQGWLAEGDGAQQIVMCGPE* |
| Ga0073913_100887362 | 3300005940 | Sand | APVYRVFSNRGDANHRYMTDRTIRDQMVAKGWLAEGDGPDLVVMCAPQ* |
| Ga0079037_1018844592 | 3300006224 | Freshwater Wetlands | VPVYRVFSNRPDANHRYMVDRTVREQMAARGWLVEGDGPDAVVMCAPQ* |
| Ga0097621_1005349701 | 3300006237 | Miscanthus Rhizosphere | FSNRADANHRYMTDRSIRDQMVAQGWLAEGDGPDLVVMCAPL* |
| Ga0097621_1005995902 | 3300006237 | Miscanthus Rhizosphere | IYRVFSNRADANHRYMTDKALRDQMVTQGWLAEGDGPNLVVMCAPQ* |
| Ga0097621_1008157201 | 3300006237 | Miscanthus Rhizosphere | NHRYMTDKAVRDQMVAKGWLAEGDGANMVVMCAPQ* |
| Ga0068871_1020199461 | 3300006358 | Miscanthus Rhizosphere | ANHRYMNNAMLRDQMVMMGWVAEGDGPDMVVMCGATISP* |
| Ga0074062_128241971 | 3300006606 | Soil | YRVFSNRADANHRYMTDKAVRQMMVDKGWLAEGDGPNLVVMCAPA* |
| Ga0075430_1006838522 | 3300006846 | Populus Rhizosphere | PAGTTSIYRVFSNRVDANHRYMTDRNVRNQMVAKGWIAEGDGPDLVVMCAPG* |
| Ga0075433_101648061 | 3300006852 | Populus Rhizosphere | RPDANHRYMTSRSVRNDMTARGWLAEGDGADLVVMCSPG* |
| Ga0075433_116043792 | 3300006852 | Populus Rhizosphere | FSNRLDANHRYMIDRAVRDAMIAAGWLAEGDGPDLVVMCAPA* |
| Ga0068865_1004266632 | 3300006881 | Miscanthus Rhizosphere | RPDANHRYMTVRGLRDQMVADGWLAEGDGPDLVVMCAPQ* |
| Ga0068865_1008304431 | 3300006881 | Miscanthus Rhizosphere | VKVYRVFSNRADANHRYMTDVATRAQMAALGWIIEGDGPDAVVMCGPA* |
| Ga0075424_1008391591 | 3300006904 | Populus Rhizosphere | GTTAIYRVFTNRPDANHRYMTDRSVRDQMVAKGWLAEGDGPDLVVMCAP* |
| Ga0075424_1013850691 | 3300006904 | Populus Rhizosphere | SNRPDANHRYTIERAVRDQMVASGWLAEGDGPDIVVMCAPA* |
| Ga0075424_1020020851 | 3300006904 | Populus Rhizosphere | MASIYRVFSNRADANHRYMTDKALRDQMVAKGWIAEGDGPDIVAMCAPQ* |
| Ga0075436_1011224372 | 3300006914 | Populus Rhizosphere | LSGLPSCRAFDNRRDANHGYMSKAMRDEMVAKGWIAEGDGPDLVVMCSPG* |
| Ga0079219_112569232 | 3300006954 | Agricultural Soil | TPIYRVFSNRPDANHRYMTDRSVRDQMVAKGWLTEGDGPDLVVMCAP* |
| Ga0075435_1004769711 | 3300007076 | Populus Rhizosphere | VYRVYTIRADANHRYTTDRATRDAMVAKGWIAEGDGADTVAMCAPQ* |
| Ga0075435_1014786261 | 3300007076 | Populus Rhizosphere | CAPGTTPVYRVFDQRRDANHRYVVERSVRDRMVGNGWLAEGDGEDRVAMCAPL* |
| Ga0105251_101806931 | 3300009011 | Switchgrass Rhizosphere | RPDANHRYMTDKTIRDQMVAKGWLAEGDGPDLVVMCAPR* |
| Ga0105090_107907322 | 3300009075 | Freshwater Sediment | NRPDANHRYMVDRTVREQMAARGWLVEGDGPDAVVMCAPQ* |
| Ga0105107_110751471 | 3300009087 | Freshwater Sediment | CPQGTVPVYRVFDGRTDANHRYMIERSVRDQMVTQGWIAEGDGPDFVVMCAPP* |
| Ga0105245_120299262 | 3300009098 | Miscanthus Rhizosphere | RPDANHRYMTDKTVRDQMVTKGWLAEGDGPDLVVMCAPQ* |
| Ga0105243_130574251 | 3300009148 | Miscanthus Rhizosphere | VFSNRPDANHRYMTVRGLRDQMVADGWLAEGDGPDLVVMCAPQ* |
| Ga0113563_102779864 | 3300009167 | Freshwater Wetlands | RVFSNRADANHRYTTDRAVRDRMVAKGWLAEGDGADLVVMCAPQ* |
| Ga0113563_123550352 | 3300009167 | Freshwater Wetlands | HRYTTDRAVRDQMTARGWMAEGDGPDLVVMCAPR* |
| Ga0105242_126766961 | 3300009176 | Miscanthus Rhizosphere | VPIYRVFSNRADANHRYMTDRAVRAQMVAKGWLAEGDGPDLVVMCATQ* |
| Ga0105248_120731451 | 3300009177 | Switchgrass Rhizosphere | GTVAVYRVFSNRPDANHRYTIEQATRAAMVALGWLAEGDGPDLVVMCAP* |
| Ga0105248_127142012 | 3300009177 | Switchgrass Rhizosphere | FNNRPDANHRYITDSFARDQMVAKGWIAEGDGADRVVMCAPQ* |
| Ga0114938_10203462 | 3300009430 | Groundwater | VSSNRPDANHRHMVDRTVREQTAARGWLVEGDGPDAVVMCAPR* |
| Ga0114939_100052393 | 3300009455 | Groundwater | VSNNRPDANHRHMVDRTVREQTAARGWLVEGDGPDAVVMCAPR* |
| Ga0114939_100805803 | 3300009455 | Groundwater | VFTNRRDANHRYTIESAVREEMVARGWLAEGDGPDLVVMCAPK* |
| Ga0073899_111040711 | 3300009540 | Activated Sludge | RYVTERTVRDGMVAQGWLAEGDGPDLVVMCAPGS* |
| Ga0105249_135296591 | 3300009553 | Switchgrass Rhizosphere | PIYRGFSNRPDASHRYMISTATRNQMVAQGWLAEGDGPDLVVMCVPAV* |
| Ga0127503_104154811 | 3300010154 | Soil | ANHRYMTERTVRDLMVTSGWLAEGDGPDLVVMCAPM* |
| Ga0134124_113394152 | 3300010397 | Terrestrial Soil | RPDANHRYTTDRALRAEMMAKGWLAEGDGPDLVVMCAPQ* |
| Ga0134124_120534971 | 3300010397 | Terrestrial Soil | NTTQIYRVFSNRPDANHRYMTSKIIRDQMAAKGWLVEGDGPDSVVMCAPM* |
| Ga0134124_127594861 | 3300010397 | Terrestrial Soil | PVYRVFSNRPDANHRYMTDKAVRDQMAAKGWLVEGDGPDAVVMCAPQ* |
| Ga0134122_127242741 | 3300010400 | Terrestrial Soil | NRPDANHRYMTDKAVRDQMVAKGWLAEGDGPNMVVMCAPQ* |
| Ga0134123_100356341 | 3300010403 | Terrestrial Soil | YRVFSNRADANHRYVTDPAVRNQMAMKGWLAEGDGPDLVVMCAPQ* |
| Ga0151489_13371562 | 3300011106 | Soil | DANHRYMTDKAVRQMMVDKGWLAEGDGPNLVVMCAPA* |
| Ga0137377_119039742 | 3300012211 | Vadose Zone Soil | VFSNRADANHRYMIDRTLRDQMAAMGWTIEGDGPDFVVMCAPPAPATV |
| Ga0150985_1156425422 | 3300012212 | Avena Fatua Rhizosphere | TSPIHRVFSNRGGANHRYMSDSALRDAMVNRRWLAEGDGPDLVVMCAPR* |
| Ga0137384_109489081 | 3300012357 | Vadose Zone Soil | NRPDANHRYMTDKAIRDQMAAKGWLIEGDGPDRVVMCAPQ* |
| Ga0138256_111867231 | 3300012533 | Active Sludge | HRYTTNRALRDAMVARGWLAEGDGPDTVLMCAPAPGA* |
| Ga0137359_115297882 | 3300012923 | Vadose Zone Soil | RADSNHRYTTDRATRDEMVDKGWIAEGDGPDRIAFCASW* |
| Ga0157369_108414492 | 3300013105 | Corn Rhizosphere | FSDRADANHRYMVDRAIRDQMVARGWLAEGDGADLVVMCAPA* |
| Ga0157374_110444454 | 3300013296 | Miscanthus Rhizosphere | ANHRYTTDRATRDLMVSKGWLAEGDGADIVVMCAPQ* |
| Ga0157374_114154891 | 3300013296 | Miscanthus Rhizosphere | NRADVNHRSTTDRGVRDAMVAKGWIAEGDGPDRVVMCAPQ* |
| Ga0157378_100172536 | 3300013297 | Miscanthus Rhizosphere | FSNRMDANHRYMTDRLLRDQMVMMGWVAEGDGPDLVVMCAPPAP* |
| Ga0157378_100755041 | 3300013297 | Miscanthus Rhizosphere | AQVYRVFSNRPDANHRYMTDKTVRDQMVTKGWLAEGDGPDLVVMCAPQ* |
| Ga0157378_102043654 | 3300013297 | Miscanthus Rhizosphere | VFSNRYDANHRYMTDKATRDQMVAKGWLAEGDGPDLVVMCAPD* |
| Ga0157378_105094081 | 3300013297 | Miscanthus Rhizosphere | IYRVFSNRGDANHRYMTDKALRDQMVAKGWLAEGDGPDRVVMCAPQ* |
| Ga0163162_115390442 | 3300013306 | Switchgrass Rhizosphere | CPAATRPVYRVFSNRADVNPRYMTSRALRDQMAAQGWIAEGDGPDRVAMCVPV* |
| Ga0163162_120198452 | 3300013306 | Switchgrass Rhizosphere | ANHRYVTDRTVRTQMVAAGWIAEGDGPDMVAMCVPG* |
| Ga0157372_109356461 | 3300013307 | Corn Rhizosphere | FSNRADANHRYMTDRATRDQVVGMGWLAEGDGPDLVVMCAPQ* |
| Ga0157375_103580033 | 3300013308 | Miscanthus Rhizosphere | FSNRPDANHRYMIVRTLRDQMVVLGWLAEGDGADLVVMCVPL* |
| Ga0157375_114898742 | 3300013308 | Miscanthus Rhizosphere | VFRGRADANHRYMVDAGIRAAMVGKGWIAEGDGVDLVVMCAPA* |
| Ga0157375_119336051 | 3300013308 | Miscanthus Rhizosphere | ANHRYMTSRSVRNDMTARGWLAEGDGADLVVMCSPG* |
| Ga0157375_123988012 | 3300013308 | Miscanthus Rhizosphere | PDANHRYMTDRALRDQMVAKGWLAEGDGPDLVVMCAPT* |
| Ga0157375_134919731 | 3300013308 | Miscanthus Rhizosphere | NRPDTNHRYMTDKAVRYQMVAKGWLAEGDGPNMVVMCAPQ* |
| Ga0134078_105121531 | 3300014157 | Grasslands Soil | VFSNRADANHRYTTDPATRDQMAAMGWTVEGDGPDFVVMCAPPAM* |
| Ga0075358_10995091 | 3300014303 | Natural And Restored Wetlands | NRPDANHRYTVDKSVLAKMVASGWLAEGDGADLVVMCAPQ* |
| Ga0075345_11330792 | 3300014312 | Natural And Restored Wetlands | VFSNRADANHRYTTDRVMREQMVGMGWLAEGDGPDLVVMCAPQ* |
| Ga0075356_12241991 | 3300014323 | Natural And Restored Wetlands | SNRPDANHRYMTDRAVRDAMVAKGWLAEGDGPDLVVMCAP* |
| Ga0163163_116744641 | 3300014325 | Switchgrass Rhizosphere | HRYMTDKLIRAAMVAKGWLAEGDGADLTVMCAPL* |
| Ga0163163_119176071 | 3300014325 | Switchgrass Rhizosphere | FNGRPDANHRYTIERGIRDLMVEAGWIAEGDGDDRVVMCVAL* |
| Ga0163163_124576722 | 3300014325 | Switchgrass Rhizosphere | ANHRYMTDRATRDQMVAMGWVAEGDGPDLVVMCAPQ* |
| Ga0157379_101752324 | 3300014968 | Switchgrass Rhizosphere | AAGQTPVYRVYSNRPDANHRYVTSRQVRDTMVAKGWLAEGDGPDAVVMCAP* |
| Ga0157379_116449991 | 3300014968 | Switchgrass Rhizosphere | TRNLYRVFNNRPDANHRYTIERGIRDLMVEGGWVAEGDGEDRVAMCVAL* |
| Ga0157379_116537401 | 3300014968 | Switchgrass Rhizosphere | VFSNRYDANHRYMTDKATRDQMVAKGWLAEGDGPDLVVMCAPQ* |
| Ga0157379_125385482 | 3300014968 | Switchgrass Rhizosphere | VFSNRADANHRYMVDPAVRDFMVGQGWLAEGDGPNLVVMCAPT* |
| Ga0157376_107189301 | 3300014969 | Miscanthus Rhizosphere | NRPDANHRYMTDRSVRDQMVAKGWLAEGDGPDLVVMCAPN* |
| Ga0157376_111878981 | 3300014969 | Miscanthus Rhizosphere | NHRYMTDKSVRSVMVAKGWLIEGDGPDAVVMCAPQ* |
| Ga0132258_126021203 | 3300015371 | Arabidopsis Rhizosphere | CPLFTQPVYRLFDGRSDANHRFTTSAALRDAMKARGWIAEGYGTDAVAMCVPQ* |
| Ga0132255_1020108101 | 3300015374 | Arabidopsis Rhizosphere | VYRVFSNRADVNHRYMTSRALRDQMAAQGWIAEGDGPDR |
| Ga0182032_103659061 | 3300016357 | Soil | PVGTTNVYRVFDGRPDANHRYMTDKAIRDQMVAKGWIAEGDGPDLVVMCAPQ |
| Ga0182032_106828672 | 3300016357 | Soil | RPDANHRYMTDKTVRDQMVAKGWVAEGDGPDLVVMCAP |
| Ga0182040_102843271 | 3300016387 | Soil | PDANHRYMTDKSLRDQMVAKGWIAEGDGPDLVVMCAPQ |
| Ga0182039_110917202 | 3300016422 | Soil | CPAGTINVYRVFDNRPDANHRYMIDPAVRAQMVAKGWIAEGDGPDMVVMCAPQ |
| Ga0182038_103128042 | 3300016445 | Soil | ANHRYMTDPAIEEQMIAKGWIPEGDGPGLVVMCAPQ |
| Ga0182038_105794842 | 3300016445 | Soil | FDNRPDANHRYVTDRTIRDQMVATGWVAEGDGPDTVAMCAPQ |
| Ga0187821_103138171 | 3300017936 | Freshwater Sediment | NHRFTTDRATRDQMVTLGWVAEGNGPDIIFACVPQ |
| Ga0187785_106431821 | 3300017947 | Tropical Peatland | PVYRLFNSRPDANHRYTIERETRDAMVAKGWIAEGDGPEHVAMCAPN |
| Ga0187779_103202551 | 3300017959 | Tropical Peatland | QGIHFSQRSSDLDANHRYMTDKAIRTPMTGKGWVAEGDGPDVVVMCAPQ |
| Ga0066662_107913151 | 3300018468 | Grasslands Soil | RAFDNRADANHRYMTDSTVLAQMVTRGWIAEGDGPDLVAMCAPQ |
| Ga0190274_134824821 | 3300018476 | Soil | DANHRYTTDRATRDEMVAKGWLAEGDGPDRVVMCAP |
| Ga0193755_11927311 | 3300020004 | Soil | DANHRYMTDRTVRDQMMAKGWLAEGDGPDLVVMCAPA |
| Ga0210384_109238831 | 3300021432 | Soil | TEVYRVFSNRADANHRYMTDKDLRDQMVAMGWLAEGDGPDLVVMCAPQ |
| Ga0182009_103782801 | 3300021445 | Soil | SPLYRVFSNRADANHRYMVDRATRDAMVARGWLAEGDGPDLVVMCVPQ |
| Ga0182009_104417731 | 3300021445 | Soil | SNRADANHRYMTDRAVRDMMVSRGWVAEGDGPDLVVMCAPG |
| Ga0209594_10106164 | 3300025130 | Groundwater | VHRVSNNRPDANHRHMVDRTVREQTAARGWLVEGDGPDAVVMCAPR |
| Ga0207656_106950871 | 3300025321 | Corn Rhizosphere | CPANSTQVYRVFSNRPDANHRYMTDKTVRDQMVTKGWLAEGDGPDLVVMCAPQ |
| Ga0207710_107770201 | 3300025900 | Switchgrass Rhizosphere | VSCPFGLTPIYRVFSNRPDANHRYLTDRATRTQMVSKGWLAEGDGPDMVVMCGGAL |
| Ga0207680_110415662 | 3300025903 | Switchgrass Rhizosphere | QQIFRVFSNRADANHRYITDKTTRAQMASRGWVVEGDGPDAVVMCAPP |
| Ga0207645_109156872 | 3300025907 | Miscanthus Rhizosphere | SNRIDANHRYTIDPLVRDQMVVMGWIAEGDGPDLVAMCAPVAP |
| Ga0207643_102599173 | 3300025908 | Miscanthus Rhizosphere | DANHRYVTDPAVRNQMAMKGWLAEGDGPDLVVMCAPQ |
| Ga0207681_109308301 | 3300025923 | Switchgrass Rhizosphere | SGRADANHRYMVDPAIRAAMVTTGWIAEGDGADMVVMCAPA |
| Ga0207681_111897721 | 3300025923 | Switchgrass Rhizosphere | VYRVFSNRADVNHRYMTSRALRDQMAAQGWIAEGDGPDRVAMCVPV |
| Ga0207681_114004921 | 3300025923 | Switchgrass Rhizosphere | YRVFDNRPDANHRYMTDKAVRDQMVAKGWLAEGDGANMVVMCAPQ |
| Ga0207681_114269911 | 3300025923 | Switchgrass Rhizosphere | CPAGTITIYRVFSNRADANHRYMTDRAIRDQMVARGWLAEGDGADLVVMCGAG |
| Ga0207650_102339151 | 3300025925 | Switchgrass Rhizosphere | RVFSNRPDANHRYTIERAVRDDMVAHGWIAEGDGPDRVVMCAPS |
| Ga0207650_107173491 | 3300025925 | Switchgrass Rhizosphere | YRVFNNRPDANHRYTIERGLRDLMVEGGWIAEGDGDDRVVMCVAL |
| Ga0207659_100525611 | 3300025926 | Miscanthus Rhizosphere | MVAGTRPAATRPVYRVFSNRADVNHRYMTSRALRDQMAAQGWIAEGDGPDRVAMCVPV |
| Ga0207659_114531531 | 3300025926 | Miscanthus Rhizosphere | ADANHRYMVNASIRDLMVTKRWVAEGDGPDLVVMCSPV |
| Ga0207687_105627112 | 3300025927 | Miscanthus Rhizosphere | RPDANHRYMTDKTVRDQMVTKGWLAEGDGPDLVVMCAPQ |
| Ga0207687_109446331 | 3300025927 | Miscanthus Rhizosphere | NRADANHRYMTDRATRDQMVGMGWLAEGDGPDLVVMCAPQ |
| Ga0207701_106997612 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | ANHRYMTDRAVRDQMVAKGWIAEGDGPDLVVMCAPG |
| Ga0207644_104492021 | 3300025931 | Switchgrass Rhizosphere | VFSNRMDANHRYMTDRATRDQMVGMGWLAEGDGPDLVVMCAPQ |
| Ga0207644_118752411 | 3300025931 | Switchgrass Rhizosphere | TAQVYRVFSNRPDANHRYMTDKTVRDQMVTKGWLAEGDGPDLVVMCAPQ |
| Ga0207690_109333332 | 3300025932 | Corn Rhizosphere | PIYRVFSNRPDANHRYMTDRAVRNQMVARGWLAEGDGPDLVVMCAV |
| Ga0207706_101754213 | 3300025933 | Corn Rhizosphere | RADANNRYMTDRATRDQMVGMGWLAEGDGPDLVVMCAPQ |
| Ga0207706_105430531 | 3300025933 | Corn Rhizosphere | VFSNRADANHRYTIERAVRDDMVAHGWLAEGDGPDLVVMCAPT |
| Ga0207706_114395671 | 3300025933 | Corn Rhizosphere | RTDANHRYMIDRALRDQMVALGWIAEGDGPDLVVMCAPA |
| Ga0207669_109692381 | 3300025937 | Miscanthus Rhizosphere | DANHRYMTSSALRDQMVAMGWLAEGDGPDQVVMCAPA |
| Ga0207704_100762234 | 3300025938 | Miscanthus Rhizosphere | TNAVYRVFSNRADANHRYVTDPAVRNQMAMKGWLAEGDGPDLVVMCAPQ |
| Ga0207704_109572731 | 3300025938 | Miscanthus Rhizosphere | TTPIYRVFSNRADANHRYMTDRAVRDQMVAKGWIAEGDGPDLVVMCAPG |
| Ga0207691_105253151 | 3300025940 | Miscanthus Rhizosphere | IYRVFNQRAGSANHRYMTDRTVREQMIAKGWVAEGDGPDLVVMCGPA |
| Ga0207691_113068441 | 3300025940 | Miscanthus Rhizosphere | VYRVFSNRADVNHRYMTSRALRDQMAAQGWIAEGDGPDRVAMCAPV |
| Ga0207667_117138312 | 3300025949 | Corn Rhizosphere | RPDANHRYTTERSVREQMIARGWTAEGDGPDLVVMCAPQ |
| Ga0207651_111296912 | 3300025960 | Switchgrass Rhizosphere | YSVFSNRPDANHRYMTDRAVRDQMAAKGWLVEGDGPDAVVMCAPQ |
| Ga0207651_117439931 | 3300025960 | Switchgrass Rhizosphere | RNVHRAFSNRADANHRYMVNPTIRDEMVAKHWLAEGDGPDLVVMCSPV |
| Ga0207668_101329211 | 3300025972 | Switchgrass Rhizosphere | VCPANSTQVYRVFSNRPDANHRYMTDKTVRDQMVTKGWLAEGDGPDLVVMCAPQ |
| Ga0207668_101619361 | 3300025972 | Switchgrass Rhizosphere | HRYMTDKAIRSQMTSKGWLEEGDGPDLVVMCEPTAPPGP |
| Ga0207668_104393963 | 3300025972 | Switchgrass Rhizosphere | VCPPNATEVYRVFDNRPDANHRYMTDKAVRDQMVAKGWLAEGDGPNMVVMCAPQ |
| Ga0207668_105288552 | 3300025972 | Switchgrass Rhizosphere | YRVFSGRADANHRYMVDAGIRAAMVGKGWIAEGDGVDLVVMCAPA |
| Ga0207668_106798451 | 3300025972 | Switchgrass Rhizosphere | NLYRVFNNRPDANHRYTIERGLRDLMVEGGWIAEGDGDDRVVMCVAL |
| Ga0207658_102267013 | 3300025986 | Switchgrass Rhizosphere | FSGRADANHRYMVDPAIRAAMVTTGWIAEGDGADMVVMCAPA |
| Ga0207658_104437922 | 3300025986 | Switchgrass Rhizosphere | NHRYMTDKSVRSVMVAKGWLIEGDGPDAVVMCAPQ |
| Ga0207658_110189091 | 3300025986 | Switchgrass Rhizosphere | IYRAFSNRTDANHRYMTDRAIRSQMVAAGWLAEGDGPDLVVMCAQ |
| Ga0207658_116290711 | 3300025986 | Switchgrass Rhizosphere | SNRPDANHRYMTEKAVRDQMVSAGWLAEGDGSDLVVMCAPV |
| Ga0207658_117340072 | 3300025986 | Switchgrass Rhizosphere | RCPEGTTAIYRAFSNRADANHRYMTETALRDRMVSKGWLAEGDGADLVVMCGPQ |
| Ga0207658_118981241 | 3300025986 | Switchgrass Rhizosphere | YSNRADANHRYTTDRATRDLMVTRGWIAEGDGADIVVMCAPQ |
| Ga0207677_122891801 | 3300026023 | Miscanthus Rhizosphere | DANHRYMTDKATRDQMVAKGWLAEGDGPDLVVMCAPD |
| Ga0207703_116566371 | 3300026035 | Switchgrass Rhizosphere | TRNVYRVFSGRADANHRYMVDPAIRAAMVTTGWIAEGDGADMVVMCAPA |
| Ga0207703_119694372 | 3300026035 | Switchgrass Rhizosphere | GGTNQIYRVFSNRADANHRYMTDKAIRSQMTSKGWLEEGDGPDLVVMCEPTAPPGP |
| Ga0207639_102642482 | 3300026041 | Corn Rhizosphere | PANTAQVYRVFSNRPDANHRYMTDKTVRDQMVTKGWLAEGDGPDLVVMCAPQ |
| Ga0207639_107618351 | 3300026041 | Corn Rhizosphere | ASTTPVYRAFNNRADANHRYMTSVYQRDQMGAAGWILEGDGPDRVVMCAPGP |
| Ga0207678_101776441 | 3300026067 | Corn Rhizosphere | NHRYTTSVQVRDEMVANGWLAEGDGPDRVVMCAPA |
| Ga0207702_111239622 | 3300026078 | Corn Rhizosphere | AFMHVYMTDRAFRDQMVARGWIAEGGGPDLVVMCSPS |
| Ga0207702_122901282 | 3300026078 | Corn Rhizosphere | NHRYMVDRAIRDQMVARGWLAEGDGADLVVMCAPA |
| Ga0207641_104176141 | 3300026088 | Switchgrass Rhizosphere | CPTATTPVYRVFSNRADANHRYMTDKSVRSVMVAKGWLIEGDGPDAVVMCAPQ |
| Ga0207641_104837254 | 3300026088 | Switchgrass Rhizosphere | ANHRYMTDRSVRDQMVAKGWLAEGDGPDLVVMCAP |
| Ga0207641_121316651 | 3300026088 | Switchgrass Rhizosphere | NRPDANHRYMTDRVVRDQMVARGWLAEGDGPDLVVMCAV |
| Ga0207641_125135561 | 3300026088 | Switchgrass Rhizosphere | TNQIYRVFSNRADANHRYMTDKAIRSQMTSKGWLEEGDGPDLVVMCEPTAPPGP |
| Ga0207648_100099759 | 3300026089 | Miscanthus Rhizosphere | FSNRPDANHRYMTDRAVRDQMVMKGWLAEGDGPDLVVMCAPQ |
| Ga0207648_105079731 | 3300026089 | Miscanthus Rhizosphere | TQIYRVFSNRADANHRYMTSRTLRDQMVAMGWLSEGDGPDQVVMCAPA |
| Ga0207676_107692231 | 3300026095 | Switchgrass Rhizosphere | VFSNRADANHRYTTERAVRDEMAAKGWLVEGDGADAVVMCAPA |
| Ga0207683_111031892 | 3300026121 | Miscanthus Rhizosphere | NHRYMTDRALRDQMVMMGWLAEGDGDDLVVMCAPPAP |
| Ga0207683_114124711 | 3300026121 | Miscanthus Rhizosphere | VAGNCLAGTAQVYRAFNNRPDANHRYMNTLYTRDQMAAANWILEGDGDDRVVMCAPGA |
| Ga0207698_107825861 | 3300026142 | Corn Rhizosphere | PAATGEIYRVFSNRSDANHRYMTDKTLRDQMVAQGWLAEGDGPNLVVMCAPQ |
| Ga0207698_122422742 | 3300026142 | Corn Rhizosphere | NHRYMTDRAIRDEMVARGWLAEGDGANLVVMCAPAS |
| Ga0209485_10743031 | 3300027691 | Agricultural Soil | YRVFSNRSDANHRYAVDRAVRDTMTGRGWLAEGDGPDLVVMCSPQ |
| Ga0209591_1000843910 | 3300027850 | Freshwater | PSGSTPVYRVFSNRADANHRTMTDRATRDQMVGNGWLAEGDGPDFVVMCAPL |
| Ga0209397_100317041 | 3300027871 | Wetland | ANHRYTVDPAIRDQMVGRGWVAEGDGPDLVVMCAPL |
| Ga0209974_104031171 | 3300027876 | Arabidopsis Thaliana Rhizosphere | MRGECPAGMRPVYRVFSNRPDANHRYMVDRTLRNQMVATGWLAEGDGSDLVVMCVPQ |
| Ga0209293_101055953 | 3300027877 | Wetland | FSNRPDANHRYMVDRTVREQMAARGWLVEGDGPDAVVMCAPQ |
| Ga0209181_101227611 | 3300027878 | Freshwater | FSNRVDANHRYTTSRTVRDQMVTKGWLAEGDGPDIVVMCAPA |
| Ga0209450_108487441 | 3300027885 | Freshwater Lake Sediment | TAGICPANTTQVYRVFSNRPDANHRYMTDNAVRDQMVVKEWLAEGDGPDLVVMCAPQ |
| Ga0209450_111895302 | 3300027885 | Freshwater Lake Sediment | VYRVFSNRPDANHRYMTDKGVRDQMVAKGWLAEGDGPNLVVMCAPR |
| Ga0209254_108319572 | 3300027897 | Freshwater Lake Sediment | TDTTQVYRVFSNRPDANHRYMTSKAVRDQMVAKGWLAEGDGPDLVVMCAPQ |
| Ga0209668_104061811 | 3300027899 | Freshwater Lake Sediment | TVQVYRVFSNRPDANHRYMTDKAVRDQMVAKGWLAEGDGPDLVVMCAPQ |
| Ga0209253_110549042 | 3300027900 | Freshwater Lake Sediment | TVQVYRVFSNRPDANHRYMTDRAVRDQMVARGWLAEGDGPDLVVMCAPQ |
| Ga0209382_107547501 | 3300027909 | Populus Rhizosphere | ATTSIYRVFSNRPDANHRYMTDKAVRDSMVAKGWIAEGDGPDLVVMCAP |
| Ga0268266_101269273 | 3300028379 | Switchgrass Rhizosphere | LFNNRADANHRYITDSFARDQMAARGWIAEGDGPDRVVMCAPQ |
| Ga0268266_120534032 | 3300028379 | Switchgrass Rhizosphere | SNRADANHRYVTDPAVRNQMAMKGWLAEGDGPDLVVMCAPQ |
| Ga0268265_105872582 | 3300028380 | Switchgrass Rhizosphere | PVYRVFSNRGDANHRYMTDKAVRGQMVAKGWLIEGDGPDAVVMCAPQ |
| Ga0268265_113081452 | 3300028380 | Switchgrass Rhizosphere | ADANHRYMVDPAIRAAMVTTGWIAEGDGADMVVMCAPA |
| Ga0268265_117294281 | 3300028380 | Switchgrass Rhizosphere | NHRYTTERAVRDEMAAKGWLVEGDGADAVVMCAPA |
| Ga0268264_108236242 | 3300028381 | Switchgrass Rhizosphere | RADANHRYMTDRATRDQMVAMGWVAEGDGPDLVVMCAPQ |
| Ga0268264_122310592 | 3300028381 | Switchgrass Rhizosphere | RSDANHRYTIERGIRDLMVETGWIAEGDGDDRVAMCVLL |
| Ga0247823_106515821 | 3300028590 | Soil | ANHRYTTDPAVRDAMKARGWTPEGDGPNMVAMCAPA |
| Ga0247822_117630662 | 3300028592 | Soil | IVYRVFSNRPDANHRYMTDRALRDFMVTRGWLAEGDGPDLVVMCVP |
| Ga0311334_103043851 | 3300029987 | Fen | YRVFSNRADANHRYMTDKSVRDQMAGLGWLIEGDGPDAVVMCAPQ |
| Ga0311336_109159201 | 3300029990 | Fen | NRADANHRYMTDKSVRDQMAGLGWLIEGDGPDAVVMCAPQ |
| Ga0311337_105574812 | 3300030000 | Fen | NSSPVYRVFSNRADVNHRYLNDLATRNQMVAQGWLAEGDGPDRVTMCAPL |
| Ga0311350_118514412 | 3300030002 | Fen | RVDTNHRYTTSRTVRDQMVEKGWIAEGAGPEAVVMCAPAP |
| Ga0311348_110289711 | 3300030019 | Fen | CPANTTQVYRVFSNRADANHRYMTDKSVRDQMAGLGWLIEGDGPDAVVMCAPQ |
| Ga0311364_124787142 | 3300031521 | Fen | NRADANHRYTTDRATRDQMVAKGWLAEGDGPDLVVMCAPQ |
| Ga0310888_102392182 | 3300031538 | Soil | SNRPDANHRYMTVRGLRDQMVADGWLAEGDGPDLVVMCAPQ |
| Ga0310887_105012002 | 3300031547 | Soil | ANHRYITDKTTRAQMASRGWVVEGDGPDAVVMCAPP |
| Ga0310887_106830992 | 3300031547 | Soil | RVFSNRADANHRYMTDRAIRDQMVARGWLAEGDGADLVVMCGAS |
| Ga0318528_107295032 | 3300031561 | Soil | TTNVYRVFDGRPDANHRYMTDKAIRDQMVAKGWIAEGDGPDLVVMCAPQ |
| Ga0310886_104098711 | 3300031562 | Soil | ITIYRVFSNRADANHRYMTDRAIRDQMVARGWLAEGDGADLVVMCGAS |
| Ga0302321_1009017431 | 3300031726 | Fen | FSNRADANHRYMTDKSVRDQMAGLGWLIEGDGPDAVVMCAPQ |
| Ga0318526_104396602 | 3300031769 | Soil | YRVFDGRLDANHRYMTDKAIRDQMVAKGWIAEGDGPDLVVMCAPQ |
| Ga0318546_102602552 | 3300031771 | Soil | DANHRYMTDKAIRDQMVAKGWIAEGDGPDLVVMCAPQ |
| Ga0318543_101413382 | 3300031777 | Soil | TEVHRVFSNRPDANHRYMTDPAIEAQMVAKGWVAEGDGPDLVVMCAPQ |
| Ga0318529_102850491 | 3300031792 | Soil | CPERTTEVHRVFDNRPDANHRYMTDPAIEEQMIAKGWIPEGDGPGLVVMCAPQ |
| Ga0318497_106212641 | 3300031805 | Soil | GTINVYRVFDNRPDANHRYMIDPAVRAQMVAKGWIAEGDGPDMVVMCAPQ |
| Ga0310907_106138122 | 3300031847 | Soil | IYRVFSNRADANHRYMTERAVRDYMVGVGWLAEGDGADLIVMCAP |
| Ga0310892_103944451 | 3300031858 | Soil | AIYRVFSNRPDANHRYMTDRAIRDQMVARGWLAEGDGPDLVVMCAPQ |
| Ga0307406_118360682 | 3300031901 | Rhizosphere | PTGTRNVYRVFSNRADANHRYMIDAALRDQLTCRGWIAEGDGPDLVIMCAPLQ |
| Ga0302322_1006193181 | 3300031902 | Fen | EVYRVFSNRPDANHRYMTDKAIRTQMVAKGWLAEGDGPDLVVMCAPP |
| Ga0302322_1023187641 | 3300031902 | Fen | VFSNRADANHRYTTDRATRDQMVARNWVAEGDGPDTVVMCAPQ |
| Ga0308175_1002345883 | 3300031938 | Soil | NRPDANHRYTIERSVRDDMVARGWIAEGDGPDLVVMCAPA |
| Ga0308174_101508751 | 3300031939 | Soil | RPDANHRYMTDRSVREQMVARGWLAEGDGPDLVVMCSA |
| Ga0308174_106698641 | 3300031939 | Soil | HRYTTDRAVRDAMLTRGWLAEGDGDDHVVMCTPAPV |
| Ga0308174_116402541 | 3300031939 | Soil | YRAFSNRADANHRYTTDRATRDRMVALGWIAEGDGPDAVAMCAP |
| Ga0308174_116594042 | 3300031939 | Soil | DANHRYMIDRAVRDQMVARGWLAEGDGPDLVVMCAPA |
| Ga0308174_119612432 | 3300031939 | Soil | DANHRYMTDAATRDAMVSLGWLAEGDGPDLVVMCAPQ |
| Ga0310909_105152851 | 3300031947 | Soil | EVYRVFDNRPDANHRYMTDKSLRDQMVAKGWIAEGDGPDLVVMCAPQ |
| Ga0307409_1004480591 | 3300031995 | Rhizosphere | SDANHRYVTDKATRAAMVSKGWLAEGDGPDLVVMCAGP |
| Ga0307411_116596662 | 3300032005 | Rhizosphere | AGTRNVYRVFSGRADANHRYMVDATIRATMVGKNWLAEGDGDDLVVMCAPT |
| Ga0310906_112616072 | 3300032013 | Soil | NHRYMTDKAVRDQMVAKGWLAEGDGPNMVVMCAPQ |
| Ga0318545_101934521 | 3300032042 | Soil | YRVFSNRPDANHRYMTDKTVRDQMVAKGWVAEGDGPDLVVMCAP |
| Ga0318558_100988292 | 3300032044 | Soil | NVYRVFDGRPDANHRYMTDKAIRDQMVAKGWIAEGDGPDLVVMCAPQ |
| Ga0318506_104579571 | 3300032052 | Soil | TEVYRVFDNRPDANHRYMTDKSLRDQMVAKGWIAEGDGPDLVVMCAPQ |
| Ga0318525_102819852 | 3300032089 | Soil | NRPDANHRYVTDRTIRDQMVATGWVAEGDGPDTVAMCAPQ |
| Ga0315292_114250351 | 3300032143 | Sediment | YRVFTNRADANHRYTTSRATRDEMVAKGWIAEGDGADTVTMCAPQ |
| Ga0315283_119988742 | 3300032164 | Sediment | AAATTPVYRVFSNRPDANHRYMTSRAIRDQMVAKGWLAEGDGPDLVVMCSPN |
| Ga0315270_110600882 | 3300032275 | Sediment | NRQDANHRYMTDKAVRDEMVAKGWIAEGDGPNLVVMCAPQ |
| Ga0316188_105149863 | 3300032276 | Worm Burrow | NRPDANHRYMTDPALRDQMVSRGWLAEGDGPDRVVMCGPQ |
| Ga0335085_111165651 | 3300032770 | Soil | PVYRVFDNRTDVNHRYTTDRATRDAMVARGWIAEGDGPDQVVMCAPQ |
| Ga0335083_100015251 | 3300032954 | Soil | NHRYTIERAVRDQMVAKGWIAEGDGPDLVVMCAPAGVS |
| Ga0310914_104393651 | 3300033289 | Soil | GRLDANHRYMTDKAIRDQMVAKGWIAEGDGPDLVVMCAPQ |
| Ga0316605_109430221 | 3300033408 | Soil | GTVPVYRVFSNRPDANHRYMVDRTVREQMAARGWLVEGDGPDAVVMCAPQ |
| Ga0316603_110078311 | 3300033413 | Soil | VFSNRPDANHRYMVDRTVREQMAARGWLVEGDGPDAVVMCAPP |
| Ga0316619_121578612 | 3300033414 | Soil | VFSNRTDANHRYTTDRAARDQMTARGWMAEGDGPDLVVMCAPR |
| Ga0316625_1001467482 | 3300033418 | Soil | TTSVYRVFSNRPDANHRYMTDRTLRDQMVAKGWLAEGDGPDRVVMCAPM |
| Ga0316625_1002861592 | 3300033418 | Soil | NRADANHRYTTDRAVRDQMTARGWMAEGDGPDLVVMCAPR |
| Ga0316600_107466412 | 3300033481 | Soil | SNRPDANHRYMVDRTVREQMAARGWLVEGDGPDAVVMCAPQ |
| Ga0316627_1002689041 | 3300033482 | Soil | VFNNRADANHRYTTDRAVRDLMVSRGGTAEGYGGDVVIMCAPPGVVAAQ |
| Ga0316627_1003419672 | 3300033482 | Soil | DANHRYMTSKVVRDQMVAKGWLAEGDGPDLVVMCAPQ |
| Ga0316629_109352521 | 3300033483 | Soil | PDANHRYMTDRALRDQMVARNWLAEGDGPDLVVMCAPQ |
| Ga0316628_1034306521 | 3300033513 | Soil | YRVFSNRPDANHRYMTDRALRDAMVARGWLAEGDGPDLVVMCAPQ |
| Ga0247829_110626602 | 3300033550 | Soil | HRYTIDRAVRDQMVSQGWLAEGDGADAVAMCVPVTP |
| Ga0364932_0365513_389_526 | 3300034177 | Sediment | VYRVFSNRADANHRYMTDRAERDAMQAKGWVAEGDGPDLVVMCAP |
| Ga0370488_129455_572_730 | 3300034691 | Untreated Peat Soil | CPAGTTQVYRVFSNRPDANHRYMTDPAIRASMVAKGWLAEGDGADLVVMCAP |
| ⦗Top⦘ |