| Basic Information | |
|---|---|
| Family ID | F009994 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 310 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MKRVALLCLGLALGAANAAEAQLTMQMSNGWSFTFAGNVNAF |
| Number of Associated Samples | 264 |
| Number of Associated Scaffolds | 310 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 99.35 % |
| % of genes near scaffold ends (potentially truncated) | 98.06 % |
| % of genes from short scaffolds (< 2000 bps) | 94.52 % |
| Associated GOLD sequencing projects | 250 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.226 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil (16.129 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.065 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.871 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 22.86% β-sheet: 20.00% Coil/Unstructured: 57.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 310 Family Scaffolds |
|---|---|---|
| PF06525 | SoxE | 19.35 |
| PF13360 | PQQ_2 | 12.58 |
| PF01011 | PQQ | 5.48 |
| PF07690 | MFS_1 | 1.29 |
| PF13570 | PQQ_3 | 0.65 |
| PF07715 | Plug | 0.65 |
| PF01266 | DAO | 0.32 |
| PF13795 | HupE_UreJ_2 | 0.32 |
| PF00593 | TonB_dep_Rec | 0.32 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.23 % |
| Unclassified | root | N/A | 6.77 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2067725002|GPICC_F5MS3JC01CFHUI | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 550 | Open in IMG/M |
| 2067725004|GPKC_F5V46DG04IS8EX | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_105081908 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 517 | Open in IMG/M |
| 3300001661|JGI12053J15887_10244900 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 893 | Open in IMG/M |
| 3300002244|JGI24742J22300_10098280 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 564 | Open in IMG/M |
| 3300002560|JGI25383J37093_10202074 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 523 | Open in IMG/M |
| 3300002914|JGI25617J43924_10257665 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 592 | Open in IMG/M |
| 3300002915|JGI25387J43893_1042637 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 624 | Open in IMG/M |
| 3300002916|JGI25389J43894_1028338 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300003267|soilL1_10008934 | All Organisms → cellular organisms → Bacteria | 7508 | Open in IMG/M |
| 3300004013|Ga0055465_10027900 | All Organisms → cellular organisms → Bacteria | 1369 | Open in IMG/M |
| 3300004062|Ga0055500_10160819 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 536 | Open in IMG/M |
| 3300004081|Ga0063454_101022873 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 667 | Open in IMG/M |
| 3300004463|Ga0063356_104360392 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 609 | Open in IMG/M |
| 3300004479|Ga0062595_100535071 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 892 | Open in IMG/M |
| 3300004479|Ga0062595_100669033 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 826 | Open in IMG/M |
| 3300004800|Ga0058861_10178143 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 981 | Open in IMG/M |
| 3300004803|Ga0058862_10163400 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1159 | Open in IMG/M |
| 3300004808|Ga0062381_10281329 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 606 | Open in IMG/M |
| 3300005172|Ga0066683_10179660 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1304 | Open in IMG/M |
| 3300005179|Ga0066684_10371402 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300005181|Ga0066678_11102802 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 510 | Open in IMG/M |
| 3300005186|Ga0066676_10342347 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 998 | Open in IMG/M |
| 3300005187|Ga0066675_11105360 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 592 | Open in IMG/M |
| 3300005328|Ga0070676_11333704 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 549 | Open in IMG/M |
| 3300005331|Ga0070670_101105143 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 723 | Open in IMG/M |
| 3300005334|Ga0068869_100918819 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300005337|Ga0070682_100609032 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 864 | Open in IMG/M |
| 3300005339|Ga0070660_100743135 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 824 | Open in IMG/M |
| 3300005347|Ga0070668_100981526 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 758 | Open in IMG/M |
| 3300005406|Ga0070703_10076840 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1128 | Open in IMG/M |
| 3300005406|Ga0070703_10350772 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 630 | Open in IMG/M |
| 3300005434|Ga0070709_11330943 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 580 | Open in IMG/M |
| 3300005444|Ga0070694_101246113 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 624 | Open in IMG/M |
| 3300005444|Ga0070694_101350544 | Not Available | 600 | Open in IMG/M |
| 3300005445|Ga0070708_100544737 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
| 3300005518|Ga0070699_101228284 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 687 | Open in IMG/M |
| 3300005518|Ga0070699_101718253 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300005526|Ga0073909_10368965 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 669 | Open in IMG/M |
| 3300005545|Ga0070695_100159015 | Not Available | 1584 | Open in IMG/M |
| 3300005546|Ga0070696_101070590 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 676 | Open in IMG/M |
| 3300005546|Ga0070696_101131065 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 659 | Open in IMG/M |
| 3300005552|Ga0066701_10452067 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 797 | Open in IMG/M |
| 3300005562|Ga0058697_10712334 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 535 | Open in IMG/M |
| 3300005569|Ga0066705_10900173 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 525 | Open in IMG/M |
| 3300005574|Ga0066694_10205714 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 934 | Open in IMG/M |
| 3300005598|Ga0066706_10319505 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
| 3300005616|Ga0068852_102192543 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 574 | Open in IMG/M |
| 3300005618|Ga0068864_101573185 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300005719|Ga0068861_100125372 | Not Available | 2077 | Open in IMG/M |
| 3300005841|Ga0068863_101838689 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300005883|Ga0075299_1018150 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 677 | Open in IMG/M |
| 3300005885|Ga0075284_1013234 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 956 | Open in IMG/M |
| 3300006034|Ga0066656_10034143 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2849 | Open in IMG/M |
| 3300006034|Ga0066656_10506071 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 787 | Open in IMG/M |
| 3300006163|Ga0070715_11069169 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 506 | Open in IMG/M |
| 3300006358|Ga0068871_102240810 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 521 | Open in IMG/M |
| 3300006791|Ga0066653_10139557 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1164 | Open in IMG/M |
| 3300006804|Ga0079221_10544607 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300006854|Ga0075425_100741510 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1127 | Open in IMG/M |
| 3300006854|Ga0075425_101355138 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 806 | Open in IMG/M |
| 3300006880|Ga0075429_101771172 | Not Available | 536 | Open in IMG/M |
| 3300006881|Ga0068865_100396985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1129 | Open in IMG/M |
| 3300006903|Ga0075426_10018634 | All Organisms → cellular organisms → Bacteria | 4958 | Open in IMG/M |
| 3300006904|Ga0075424_101102317 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300006904|Ga0075424_101660730 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 677 | Open in IMG/M |
| 3300006904|Ga0075424_102041259 | Not Available | 605 | Open in IMG/M |
| 3300007255|Ga0099791_10008428 | All Organisms → cellular organisms → Bacteria | 4271 | Open in IMG/M |
| 3300007265|Ga0099794_10130978 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1266 | Open in IMG/M |
| 3300009038|Ga0099829_10344060 | All Organisms → cellular organisms → Bacteria | 1227 | Open in IMG/M |
| 3300009088|Ga0099830_10901188 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300009089|Ga0099828_11891302 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 523 | Open in IMG/M |
| 3300009090|Ga0099827_11930534 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 514 | Open in IMG/M |
| 3300009101|Ga0105247_10671712 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 776 | Open in IMG/M |
| 3300009101|Ga0105247_11732085 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 518 | Open in IMG/M |
| 3300009137|Ga0066709_102267678 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 746 | Open in IMG/M |
| 3300009137|Ga0066709_102337325 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 730 | Open in IMG/M |
| 3300009137|Ga0066709_102652181 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 670 | Open in IMG/M |
| 3300009156|Ga0111538_14138123 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300009802|Ga0105073_1034386 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 608 | Open in IMG/M |
| 3300009813|Ga0105057_1107515 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300009821|Ga0105064_1103157 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 586 | Open in IMG/M |
| 3300010038|Ga0126315_11174201 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 521 | Open in IMG/M |
| 3300010039|Ga0126309_10007659 | All Organisms → cellular organisms → Bacteria | 4303 | Open in IMG/M |
| 3300010040|Ga0126308_10176189 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1364 | Open in IMG/M |
| 3300010040|Ga0126308_10634860 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 730 | Open in IMG/M |
| 3300010044|Ga0126310_10839264 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 710 | Open in IMG/M |
| 3300010081|Ga0127457_1034138 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300010090|Ga0127471_1006187 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300010091|Ga0127485_1052579 | Not Available | 548 | Open in IMG/M |
| 3300010093|Ga0127490_1065545 | Not Available | 567 | Open in IMG/M |
| 3300010100|Ga0127440_1071309 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 529 | Open in IMG/M |
| 3300010108|Ga0127474_1073010 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 564 | Open in IMG/M |
| 3300010115|Ga0127495_1037623 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300010120|Ga0127451_1043792 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 885 | Open in IMG/M |
| 3300010122|Ga0127488_1021200 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 696 | Open in IMG/M |
| 3300010124|Ga0127498_1145565 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 552 | Open in IMG/M |
| 3300010124|Ga0127498_1147404 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 658 | Open in IMG/M |
| 3300010126|Ga0127482_1032879 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 613 | Open in IMG/M |
| 3300010126|Ga0127482_1116015 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 771 | Open in IMG/M |
| 3300010127|Ga0127489_1043240 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 545 | Open in IMG/M |
| 3300010128|Ga0127486_1103536 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 680 | Open in IMG/M |
| 3300010133|Ga0127459_1193803 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 949 | Open in IMG/M |
| 3300010134|Ga0127484_1130120 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 504 | Open in IMG/M |
| 3300010140|Ga0127456_1176924 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 701 | Open in IMG/M |
| 3300010141|Ga0127499_1053073 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 700 | Open in IMG/M |
| 3300010303|Ga0134082_10330342 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 643 | Open in IMG/M |
| 3300010360|Ga0126372_10702111 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300010366|Ga0126379_13178840 | Not Available | 550 | Open in IMG/M |
| 3300010373|Ga0134128_10806547 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1040 | Open in IMG/M |
| 3300010373|Ga0134128_10915497 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 970 | Open in IMG/M |
| 3300010373|Ga0134128_12172103 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 611 | Open in IMG/M |
| 3300010396|Ga0134126_12149144 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 609 | Open in IMG/M |
| 3300011003|Ga0138514_100048642 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 851 | Open in IMG/M |
| 3300011271|Ga0137393_10234171 | All Organisms → cellular organisms → Bacteria | 1556 | Open in IMG/M |
| 3300011333|Ga0127502_10077654 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 517 | Open in IMG/M |
| 3300012189|Ga0137388_11864608 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300012198|Ga0137364_10046612 | All Organisms → cellular organisms → Bacteria | 2868 | Open in IMG/M |
| 3300012206|Ga0137380_10455432 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1131 | Open in IMG/M |
| 3300012207|Ga0137381_10210053 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1688 | Open in IMG/M |
| 3300012207|Ga0137381_11671948 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 527 | Open in IMG/M |
| 3300012210|Ga0137378_10394099 | All Organisms → cellular organisms → Bacteria | 1285 | Open in IMG/M |
| 3300012210|Ga0137378_10549611 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1063 | Open in IMG/M |
| 3300012210|Ga0137378_11760153 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 524 | Open in IMG/M |
| 3300012211|Ga0137377_11481068 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 605 | Open in IMG/M |
| 3300012212|Ga0150985_106263384 | All Organisms → cellular organisms → Bacteria | 1384 | Open in IMG/M |
| 3300012212|Ga0150985_109333580 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 726 | Open in IMG/M |
| 3300012224|Ga0134028_1066834 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 551 | Open in IMG/M |
| 3300012285|Ga0137370_10520838 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 729 | Open in IMG/M |
| 3300012353|Ga0137367_10534901 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300012354|Ga0137366_10567667 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 816 | Open in IMG/M |
| 3300012355|Ga0137369_10417621 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300012357|Ga0137384_10316433 | All Organisms → cellular organisms → Bacteria | 1296 | Open in IMG/M |
| 3300012357|Ga0137384_10606695 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300012374|Ga0134039_1203951 | Not Available | 524 | Open in IMG/M |
| 3300012376|Ga0134032_1103295 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 572 | Open in IMG/M |
| 3300012378|Ga0134025_1048927 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 522 | Open in IMG/M |
| 3300012380|Ga0134047_1051733 | All Organisms → cellular organisms → Bacteria | 1950 | Open in IMG/M |
| 3300012380|Ga0134047_1154685 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300012380|Ga0134047_1224726 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 584 | Open in IMG/M |
| 3300012381|Ga0134026_1108189 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 602 | Open in IMG/M |
| 3300012382|Ga0134038_1138271 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 750 | Open in IMG/M |
| 3300012385|Ga0134023_1260283 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 528 | Open in IMG/M |
| 3300012386|Ga0134046_1116050 | Not Available | 544 | Open in IMG/M |
| 3300012390|Ga0134054_1220212 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300012393|Ga0134052_1009813 | Not Available | 559 | Open in IMG/M |
| 3300012393|Ga0134052_1017054 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 513 | Open in IMG/M |
| 3300012395|Ga0134044_1178222 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 716 | Open in IMG/M |
| 3300012399|Ga0134061_1365992 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 711 | Open in IMG/M |
| 3300012404|Ga0134024_1411514 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 530 | Open in IMG/M |
| 3300012405|Ga0134041_1189254 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 507 | Open in IMG/M |
| 3300012410|Ga0134060_1309245 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300012410|Ga0134060_1450095 | Not Available | 581 | Open in IMG/M |
| 3300012410|Ga0134060_1452219 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 502 | Open in IMG/M |
| 3300012469|Ga0150984_116027461 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 762 | Open in IMG/M |
| 3300012527|Ga0136633_1185256 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 786 | Open in IMG/M |
| 3300012532|Ga0137373_10096737 | All Organisms → cellular organisms → Bacteria | 2591 | Open in IMG/M |
| 3300012532|Ga0137373_10155814 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1922 | Open in IMG/M |
| 3300012532|Ga0137373_10502752 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 926 | Open in IMG/M |
| 3300012678|Ga0136615_10207933 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 893 | Open in IMG/M |
| 3300012884|Ga0157300_1077800 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 575 | Open in IMG/M |
| 3300012899|Ga0157299_10312036 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 525 | Open in IMG/M |
| 3300012927|Ga0137416_10114313 | All Organisms → cellular organisms → Bacteria | 2055 | Open in IMG/M |
| 3300012927|Ga0137416_11820208 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 556 | Open in IMG/M |
| 3300012930|Ga0137407_10619626 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1016 | Open in IMG/M |
| 3300012955|Ga0164298_11514558 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 524 | Open in IMG/M |
| 3300012975|Ga0134110_10065401 | All Organisms → cellular organisms → Bacteria | 1443 | Open in IMG/M |
| 3300012985|Ga0164308_10676457 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 887 | Open in IMG/M |
| 3300012986|Ga0164304_11756353 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 519 | Open in IMG/M |
| 3300012989|Ga0164305_11136652 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 673 | Open in IMG/M |
| 3300013297|Ga0157378_11797565 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 661 | Open in IMG/M |
| 3300014056|Ga0120125_1068688 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 797 | Open in IMG/M |
| 3300014157|Ga0134078_10041770 | All Organisms → cellular organisms → Bacteria | 1553 | Open in IMG/M |
| 3300014157|Ga0134078_10493511 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 568 | Open in IMG/M |
| 3300014254|Ga0075312_1146337 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 521 | Open in IMG/M |
| 3300014263|Ga0075324_1113502 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 594 | Open in IMG/M |
| 3300014308|Ga0075354_1084119 | Not Available | 642 | Open in IMG/M |
| 3300015086|Ga0167655_1053423 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 590 | Open in IMG/M |
| 3300015201|Ga0173478_10213424 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300015356|Ga0134073_10169336 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 704 | Open in IMG/M |
| 3300015359|Ga0134085_10068900 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1437 | Open in IMG/M |
| 3300015359|Ga0134085_10301428 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 705 | Open in IMG/M |
| 3300015374|Ga0132255_103294937 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300017656|Ga0134112_10429644 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 550 | Open in IMG/M |
| 3300017656|Ga0134112_10441190 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 543 | Open in IMG/M |
| 3300017657|Ga0134074_1055813 | All Organisms → cellular organisms → Bacteria | 1337 | Open in IMG/M |
| 3300017787|Ga0183260_10355288 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
| 3300018031|Ga0184634_10317209 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 715 | Open in IMG/M |
| 3300018431|Ga0066655_10319838 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300018432|Ga0190275_11053963 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 886 | Open in IMG/M |
| 3300018432|Ga0190275_13135773 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 535 | Open in IMG/M |
| 3300018482|Ga0066669_10127755 | All Organisms → cellular organisms → Bacteria | 1825 | Open in IMG/M |
| 3300019233|Ga0184645_1236692 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 735 | Open in IMG/M |
| 3300019269|Ga0184644_1405679 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 762 | Open in IMG/M |
| 3300019361|Ga0173482_10411029 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 632 | Open in IMG/M |
| 3300019789|Ga0137408_1016201 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 787 | Open in IMG/M |
| 3300019882|Ga0193713_1056984 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
| 3300020059|Ga0193745_1068059 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 777 | Open in IMG/M |
| 3300020067|Ga0180109_1199311 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 542 | Open in IMG/M |
| 3300020068|Ga0184649_1162349 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 2296 | Open in IMG/M |
| 3300020215|Ga0196963_10591711 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 507 | Open in IMG/M |
| 3300021046|Ga0215015_10985715 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 791 | Open in IMG/M |
| 3300021307|Ga0179585_1142025 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 678 | Open in IMG/M |
| 3300021344|Ga0193719_10179651 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 908 | Open in IMG/M |
| 3300021412|Ga0193736_1041372 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 635 | Open in IMG/M |
| 3300022195|Ga0222625_1589744 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 584 | Open in IMG/M |
| 3300022724|Ga0242665_10035326 | All Organisms → cellular organisms → Bacteria | 1255 | Open in IMG/M |
| 3300022724|Ga0242665_10395013 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 504 | Open in IMG/M |
| 3300025155|Ga0209320_10397054 | All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium | 555 | Open in IMG/M |
| 3300025327|Ga0209751_10460599 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1045 | Open in IMG/M |
| 3300025537|Ga0210061_1102730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 505 | Open in IMG/M |
| 3300025885|Ga0207653_10075874 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1156 | Open in IMG/M |
| 3300025899|Ga0207642_11138669 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 505 | Open in IMG/M |
| 3300025905|Ga0207685_10788330 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 523 | Open in IMG/M |
| 3300025906|Ga0207699_11385159 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 520 | Open in IMG/M |
| 3300025920|Ga0207649_11330870 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 568 | Open in IMG/M |
| 3300025921|Ga0207652_10277720 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1511 | Open in IMG/M |
| 3300025922|Ga0207646_10349254 | All Organisms → cellular organisms → Bacteria | 1336 | Open in IMG/M |
| 3300025934|Ga0207686_11691949 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 523 | Open in IMG/M |
| 3300025936|Ga0207670_10914357 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 735 | Open in IMG/M |
| 3300025942|Ga0207689_10161579 | All Organisms → cellular organisms → Bacteria | 1846 | Open in IMG/M |
| 3300025945|Ga0207679_11457317 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
| 3300026004|Ga0208416_1017364 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 571 | Open in IMG/M |
| 3300026009|Ga0208530_1003752 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1040 | Open in IMG/M |
| 3300026041|Ga0207639_11353676 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 668 | Open in IMG/M |
| 3300026046|Ga0208780_1028077 | Not Available | 526 | Open in IMG/M |
| 3300026053|Ga0208422_1010962 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
| 3300026066|Ga0208290_1004373 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1261 | Open in IMG/M |
| 3300026088|Ga0207641_10697085 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1000 | Open in IMG/M |
| 3300026095|Ga0207676_11649953 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300026298|Ga0209236_1247215 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 591 | Open in IMG/M |
| 3300026300|Ga0209027_1257865 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 559 | Open in IMG/M |
| 3300026301|Ga0209238_1250356 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 527 | Open in IMG/M |
| 3300026313|Ga0209761_1120501 | Not Available | 1275 | Open in IMG/M |
| 3300026317|Ga0209154_1167729 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 894 | Open in IMG/M |
| 3300026325|Ga0209152_10380399 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 548 | Open in IMG/M |
| 3300026332|Ga0209803_1115405 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1080 | Open in IMG/M |
| 3300026342|Ga0209057_1007691 | All Organisms → cellular organisms → Bacteria | 7072 | Open in IMG/M |
| 3300026524|Ga0209690_1017601 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 3666 | Open in IMG/M |
| 3300027388|Ga0208995_1080753 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 569 | Open in IMG/M |
| 3300027543|Ga0209999_1078206 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 637 | Open in IMG/M |
| 3300027577|Ga0209874_1122593 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 604 | Open in IMG/M |
| 3300027643|Ga0209076_1106776 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 793 | Open in IMG/M |
| 3300027840|Ga0209683_10065365 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1612 | Open in IMG/M |
| 3300027874|Ga0209465_10362795 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300027875|Ga0209283_10901259 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 535 | Open in IMG/M |
| 3300027882|Ga0209590_10138814 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1496 | Open in IMG/M |
| 3300027882|Ga0209590_11030374 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 512 | Open in IMG/M |
| 3300027895|Ga0209624_11051237 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 526 | Open in IMG/M |
| 3300028380|Ga0268265_10185002 | All Organisms → cellular organisms → Bacteria | 1794 | Open in IMG/M |
| 3300028381|Ga0268264_11148734 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 786 | Open in IMG/M |
| 3300028711|Ga0307293_10102235 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 909 | Open in IMG/M |
| 3300028713|Ga0307303_10020286 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1268 | Open in IMG/M |
| 3300028714|Ga0307309_10105102 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 678 | Open in IMG/M |
| 3300028715|Ga0307313_10206702 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 609 | Open in IMG/M |
| 3300028719|Ga0307301_10186720 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300028722|Ga0307319_10211407 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 636 | Open in IMG/M |
| 3300028778|Ga0307288_10408251 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 554 | Open in IMG/M |
| 3300028784|Ga0307282_10587205 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 540 | Open in IMG/M |
| 3300028803|Ga0307281_10167160 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 778 | Open in IMG/M |
| 3300028811|Ga0307292_10332114 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 640 | Open in IMG/M |
| 3300028812|Ga0247825_10108092 | Not Available | 1886 | Open in IMG/M |
| 3300028889|Ga0247827_10661791 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300030619|Ga0268386_10706028 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 657 | Open in IMG/M |
| 3300030904|Ga0308198_1005763 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1352 | Open in IMG/M |
| 3300030987|Ga0308155_1003953 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1008 | Open in IMG/M |
| 3300030989|Ga0308196_1032552 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 662 | Open in IMG/M |
| 3300030993|Ga0308190_1046442 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 824 | Open in IMG/M |
| 3300030993|Ga0308190_1077489 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 692 | Open in IMG/M |
| 3300031093|Ga0308197_10048124 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1089 | Open in IMG/M |
| 3300031093|Ga0308197_10218673 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 658 | Open in IMG/M |
| 3300031152|Ga0307501_10203666 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 567 | Open in IMG/M |
| 3300031421|Ga0308194_10034352 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
| 3300031421|Ga0308194_10091409 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300031720|Ga0307469_10348662 | All Organisms → cellular organisms → Bacteria | 1242 | Open in IMG/M |
| 3300031720|Ga0307469_11033093 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 769 | Open in IMG/M |
| 3300031731|Ga0307405_11377131 | Not Available | 616 | Open in IMG/M |
| 3300031820|Ga0307473_10394898 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 904 | Open in IMG/M |
| 3300031820|Ga0307473_10748679 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 691 | Open in IMG/M |
| 3300031820|Ga0307473_11376547 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 531 | Open in IMG/M |
| 3300031852|Ga0307410_10595781 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 921 | Open in IMG/M |
| 3300031854|Ga0310904_10398618 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 900 | Open in IMG/M |
| 3300031911|Ga0307412_12326949 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 500 | Open in IMG/M |
| 3300031943|Ga0310885_10193856 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1000 | Open in IMG/M |
| 3300031944|Ga0310884_10524564 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 698 | Open in IMG/M |
| 3300031965|Ga0326597_10698797 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1067 | Open in IMG/M |
| 3300031995|Ga0307409_101681176 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 663 | Open in IMG/M |
| 3300032002|Ga0307416_100935469 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 968 | Open in IMG/M |
| 3300032004|Ga0307414_11451153 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 638 | Open in IMG/M |
| 3300032013|Ga0310906_11157066 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 561 | Open in IMG/M |
| 3300032075|Ga0310890_11491529 | Not Available | 557 | Open in IMG/M |
| 3300032143|Ga0315292_10733607 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300032180|Ga0307471_100041968 | All Organisms → cellular organisms → Bacteria | 3676 | Open in IMG/M |
| 3300032180|Ga0307471_100461080 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1412 | Open in IMG/M |
| 3300032180|Ga0307471_101391012 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300032180|Ga0307471_102076917 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 714 | Open in IMG/M |
| 3300032205|Ga0307472_100305602 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1281 | Open in IMG/M |
| 3300032397|Ga0315287_10563352 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1351 | Open in IMG/M |
| 3300032893|Ga0335069_11599599 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 698 | Open in IMG/M |
| 3300033412|Ga0310810_11331393 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 560 | Open in IMG/M |
| 3300033501|Ga0326732_1026671 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 979 | Open in IMG/M |
| 3300033502|Ga0326731_1065127 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300034123|Ga0370479_0006047 | All Organisms → cellular organisms → Bacteria | 2599 | Open in IMG/M |
| 3300034157|Ga0370506_097040 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 655 | Open in IMG/M |
| 3300034178|Ga0364934_0397140 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 522 | Open in IMG/M |
| 3300034662|Ga0314783_030808 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 925 | Open in IMG/M |
| 3300034676|Ga0314801_114017 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 16.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.26% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.45% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.16% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.19% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.90% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.58% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.26% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.94% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.94% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.94% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.61% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.29% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.29% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.29% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.29% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.97% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.97% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.97% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.97% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.65% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.65% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.65% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.65% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.65% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.65% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.65% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.65% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.65% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.32% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.32% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.32% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.32% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.32% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.32% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.32% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.32% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.32% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.32% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.32% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.32% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.32% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.32% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.32% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.32% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.32% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.32% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.32% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.32% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.32% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.32% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.32% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2067725002 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 2067725004 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Host-Associated | Open in IMG/M |
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300002915 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002916 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm | Environmental | Open in IMG/M |
| 3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
| 3300004013 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 | Environmental | Open in IMG/M |
| 3300004062 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300004808 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005883 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_302 | Environmental | Open in IMG/M |
| 3300005885 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_401 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009802 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_50_60 | Environmental | Open in IMG/M |
| 3300009813 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 | Environmental | Open in IMG/M |
| 3300009821 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010081 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010090 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010091 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010093 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010100 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010108 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010115 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010120 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010122 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010124 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010126 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010127 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010128 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010133 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010134 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010140 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010141 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011333 | Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012224 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012374 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012376 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012378 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012380 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012381 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012382 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012385 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012386 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012390 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012393 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012395 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012399 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012404 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012405 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012410 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012527 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ83 (22.06) | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012678 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ288 (22.06) | Environmental | Open in IMG/M |
| 3300012884 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 | Environmental | Open in IMG/M |
| 3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014056 | Permafrost microbial communities from Nunavut, Canada - A20_5cm_0M | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014254 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D2 | Environmental | Open in IMG/M |
| 3300014263 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014308 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D1 | Environmental | Open in IMG/M |
| 3300015086 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-5c, rocky medial moraine) | Environmental | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017787 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2) | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019233 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019269 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300020059 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2 | Environmental | Open in IMG/M |
| 3300020067 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT47_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020068 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020215 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_5 | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021307 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021412 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2m1 | Environmental | Open in IMG/M |
| 3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025155 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 4 | Environmental | Open in IMG/M |
| 3300025327 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025537 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026004 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_302 (SPAdes) | Environmental | Open in IMG/M |
| 3300026009 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_401 (SPAdes) | Environmental | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026046 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026053 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026066 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300027388 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027840 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
| 3300028714 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196 | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
| 3300030904 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_202 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030987 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_144 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030989 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_197 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030993 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033501 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF12FN SIP fraction | Environmental | Open in IMG/M |
| 3300033502 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF9FY SIP fraction | Environmental | Open in IMG/M |
| 3300034123 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_15 | Environmental | Open in IMG/M |
| 3300034157 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_18 | Environmental | Open in IMG/M |
| 3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
| 3300034662 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034676 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPICC_02480710 | 2067725002 | Soil | MKRVALLCLGLALGAANAAEAQLTMQMSNGWSFTFAGNVNAFIIY |
| GPKC_03294560 | 2067725004 | Soil | MKRIGLVCLGLALGAASTVHAQGLTMQMSNGWNFTF |
| INPhiseqgaiiFebDRAFT_1050819081 | 3300000364 | Soil | MKKVALLCLGLALGAVNAAEAQLTMQMSNGWSFTFAGNVNAFXXXXQX |
| JGI12053J15887_102449002 | 3300001661 | Forest Soil | MKRLTLLLLGLALGVSATANAQGLTMQMSNGWAFQFGGNVNAFWVF |
| JGI24742J22300_100982801 | 3300002244 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRSALLLGGLLLAAASTANAQLTMQMSNGWTFSFAGNVNIF |
| JGI25383J37093_102020742 | 3300002560 | Grasslands Soil | MKRLTLLLLGLALGVSATASAQGLTMQMSNGWAFSFSGNVNAFWTF |
| JGI25617J43924_102576651 | 3300002914 | Grasslands Soil | MKRLTLLLLGLVLGVAATAKAQGLTMQMSNGWSFSFSGNVNAFWVFS |
| JGI25387J43893_10426371 | 3300002915 | Grasslands Soil | MKRLTLLLLGLALGVTATARAQGLTMQMSNGWAFQFGGNVNAFWVFTKGNNSGP |
| JGI25389J43894_10283382 | 3300002916 | Grasslands Soil | MKRLTLLLLGLALGVTGTARAQGLTMQMSNGWSFAFGGNVNAFWVF |
| soilL1_100089344 | 3300003267 | Sugarcane Root And Bulk Soil | MKRVALLCLGLALGAANAAEAQLTMQMSNGWSFTFAGNVNAFIIYQQ |
| Ga0055465_100279001 | 3300004013 | Natural And Restored Wetlands | MKRVALLCLGLALGAANAAEAQLTMQMSNGWSFTFAGNVNAFIIYQQGKTC |
| Ga0055500_101608192 | 3300004062 | Natural And Restored Wetlands | MKRSALLFGALMLGAASGANAQALSMQMSNGWSFSFSGNVNAFMIYQNAKVLDP |
| Ga0063454_1010228731 | 3300004081 | Soil | MKRVALLCLGLALGAANAAEAQLTMQMSNGWSFTFAGNVN |
| Ga0063356_1043603922 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKRVALLCLGLAVGAANAAEAQLTMQMSNGWSFTFGGNVNAFL |
| Ga0062595_1005350713 | 3300004479 | Soil | MKRVALLCVGLAVGAASAAEAQLTMQMSNGWAFTFSGNVNAFAIYETQSTSGGTNLAL |
| Ga0062595_1006690331 | 3300004479 | Soil | MKRVALLCLGLAVGAASVAEAQLTMQMSNGWSFTFSGNVNAFA |
| Ga0058861_101781433 | 3300004800 | Host-Associated | MKRVALLCMGLAVGAASVAEAQLTMQMSNGWSFTFSGNVNAFA |
| Ga0058862_101634003 | 3300004803 | Host-Associated | MKRVALLCMGLAVGAASVAEAQLTMQMSNGWSFTFSGNVNAFAIYE |
| Ga0062381_102813292 | 3300004808 | Wetland Sediment | MKKVALLCLGLAFGAANAAEAQLTMQMSNGWSFQFAGNVNAFFIY |
| Ga0066683_101796601 | 3300005172 | Soil | MKRLAVLSVAVALLWPAAANAQLTMQMSNGWSFSFAGNVNAFWVFTRGNTALNKLTNSSVRTGLLPAF |
| Ga0066684_103714022 | 3300005179 | Soil | MKRLTLLLLSLALGVTATARAQGLTMQMSNGWSFSFAGNVNVFWS |
| Ga0066678_111028022 | 3300005181 | Soil | MKRLTLLLLGLALGVSATASAQGLTMQMSNGWAFQFSGNVNAFWVFS |
| Ga0066676_103423471 | 3300005186 | Soil | MKRLALLLVAVALLWPAAASAQLTMQMSNGWSFSFAGNVNA |
| Ga0066675_111053603 | 3300005187 | Soil | MKRLALLSVAVALLWPAPANAQLTMQMSNGWSFSFAGNVNAFW |
| Ga0070676_113337042 | 3300005328 | Miscanthus Rhizosphere | MKRVALLCMGLAVGAASVAEAQLTMQMSNGWSFTFSGNVNAFAIYESTSESGGTLGAP |
| Ga0070670_1011051431 | 3300005331 | Switchgrass Rhizosphere | MKRLGLVLAGLALAGAVNTADAQLTMQMSNGWSATFAGNVNAFW |
| Ga0068869_1009188192 | 3300005334 | Miscanthus Rhizosphere | MKRIGLVCLGLALGAANTVHAQGLTMQMSNGWNFTFSGNVN |
| Ga0070682_1006090321 | 3300005337 | Corn Rhizosphere | MKRVALLCMGLAVGAASVAEAQLTMQMSNGWSFTFSGNVNAFAIYESTSD |
| Ga0070660_1007431352 | 3300005339 | Corn Rhizosphere | MKRVALLCLGLALGAANAAEAQLTMQMSNGWSFTFAGNVNAFIIYQQGK |
| Ga0070668_1009815262 | 3300005347 | Switchgrass Rhizosphere | MKRLGLVLAGLALAGAVNTADAQLTMQMSNGWSATFAGNVNAFWI |
| Ga0070703_100768401 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRSALLLGGLLLAAASTANAQLTMQMSNGWTFSFAGNVNIFAQ |
| Ga0070703_103507722 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRLTLLLLGLALGVSATARAQGLTMQMSNGWSFSFSGNVN |
| Ga0070709_113309431 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRIGLVCLGLALGAANTVHAQGLTMQMSNGWNFTFSGNVNTFIYYEQTKTGGNTPVS |
| Ga0070694_1012461131 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRVALLCLGLALGAANAAEAQLTMQMSNGWSFTFAGNVNAFIIYQQGKTCTPP |
| Ga0070694_1013505442 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRLGLVLAGLALAGAVNTADAQLTMQMSNGWSATFAGNV |
| Ga0070708_1005447371 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKVALLCLGLAFGAVNAAEAQLTMQMSNGWSFTFGGNVNSFLYYTKSKTNGTTATIGGL |
| Ga0070699_1012282843 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRLALLSVAVALLWPAAANAQLTMQMSNGWSFSFAGNVNAFWVFTRGNTALNKLTNSSVRTGLLPAFA |
| Ga0070699_1017182532 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKVALLCLGLAMGAANAAEAQLTMQMSNGWSFTFAGNVNAFAI |
| Ga0073909_103689652 | 3300005526 | Surface Soil | MKRLTLLLLGLALGVSATASAQGLTMQMSNGWTFSFSGNVNAFGVFTK |
| Ga0070695_1001590151 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRVALVCLGLALGAANAAEAQLTMQMSNGWSFTFAGNVNSFLYY |
| Ga0070696_1010705902 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRVALLCVGLAVGAASVAEAQLTMQMSNGWSFTFSGNVNAF |
| Ga0070696_1011310651 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRVLGAVLFVALGLAGSARAQGLTMQMSNGWSFSFAGNVNAFLAYQ |
| Ga0066701_104520672 | 3300005552 | Soil | MKRLTLLLLGLALGVSATAGAQGLTMQMSNGWSFSFS |
| Ga0058697_107123341 | 3300005562 | Agave | MKRVALLCVGLAVGAASAAEAQLTMQMSNGWSFTFSGNVNAFAIYESTSDE |
| Ga0066705_109001731 | 3300005569 | Soil | MKRLAVLSVAVALLWPAAANAQLTMQMSNGWSFSFAGNVN |
| Ga0066694_102057141 | 3300005574 | Soil | MKRLALLLLAVAVLLPAAASAQLTMQMSNGWSFAFSGNVNAFWVFSKVNNSGPAN |
| Ga0066706_103195051 | 3300005598 | Soil | MKRLTLLLLGLALGVSATANAQGLTMQMSNGWSFTFAGNVNVFW |
| Ga0068852_1021925431 | 3300005616 | Corn Rhizosphere | MKRVALLCMGLAVGAASVAEAQLTMQMSNGWSFTFSGNVNAFAIYENT |
| Ga0068864_1015731851 | 3300005618 | Switchgrass Rhizosphere | MKRIGLVCLGLALGAANTVHAQGLTMQMSNGWNFTFSGNVNTFIYYEESKSGGN |
| Ga0068861_1001253721 | 3300005719 | Switchgrass Rhizosphere | MKRIGLVCLGLALGAANTVHAQGLTMQMSNGWNFTFSGNVNTFIYYEESKS |
| Ga0068863_1018386891 | 3300005841 | Switchgrass Rhizosphere | MKRIGLVCLGLALGAANTVHAQGLTMQMSNGWSFTFSGNVNSFL |
| Ga0075299_10181501 | 3300005883 | Rice Paddy Soil | MKRVALLCMGLAFGAANVAEAQLTMQMSNGWAFTFSGNVNAFMIYQTSK |
| Ga0075284_10132343 | 3300005885 | Rice Paddy Soil | MKRVALLCMGLAFGAANVAEAQLTMQMSNGWAFTFSGNVNAFMIYQTSKTAGGVTT |
| Ga0066656_100341434 | 3300006034 | Soil | MKRLTLLLLGLALGVSATAGAQGLTMQMSNGWAFQFSG |
| Ga0066656_105060711 | 3300006034 | Soil | MKRLALLLVAVALLLPAAANAQLTMQMSNGWSFSFAGNVNAFWVFSKVNNS |
| Ga0070715_110691691 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRIGLVCLGLALGAASTVHAQGLTMQMSNGWNFTFSGNVNTFLYYEK |
| Ga0068871_1022408101 | 3300006358 | Miscanthus Rhizosphere | MKRIGLLGLALLFAVTRSAGAQGLTMQMSNGWNFSFSGNVNGFLIYHHGDN |
| Ga0066653_101395573 | 3300006791 | Soil | MKRLTLLLVAVALLWPAAANAQLTMQMSNGWSFTFAGNVNVFWVFT |
| Ga0079221_105446071 | 3300006804 | Agricultural Soil | MKRIGLVCLGLALGAANTVHAQGLTMQMSNGWNFTFSGNVNT |
| Ga0075425_1007415101 | 3300006854 | Populus Rhizosphere | MKKVALLCLGLAFGAVNAAEAQLTMQMSNGWSFTFA |
| Ga0075425_1013551383 | 3300006854 | Populus Rhizosphere | MKKVALLCMGLALGAANVAQAQLTMQMSNGWSFTFA |
| Ga0075429_1017711721 | 3300006880 | Populus Rhizosphere | MKRIALLCMGLVLGAATAAEAQLSMQMSNGWSFTFAGN |
| Ga0068865_1003969851 | 3300006881 | Miscanthus Rhizosphere | MKRLGLVLAGLALAGAVNTADAQLTMQMSNGWSATFAGNVNAFWIYTDNQTAT |
| Ga0075426_100186345 | 3300006903 | Populus Rhizosphere | MKRMPKLLLGLLVALPAMAAAQGLSMQMSNGWKFSFAGNVN |
| Ga0075424_1011023173 | 3300006904 | Populus Rhizosphere | MKRVALLCLGLALGAANAAEAQLTMQMSNGWSFTFAGNVNAFMIYSQGKTCAG |
| Ga0075424_1016607302 | 3300006904 | Populus Rhizosphere | MKRVALLCVGLAVGAASVAEAQLTMQMSNGWAFTFSGNVNAFAIYETQ |
| Ga0075424_1020412591 | 3300006904 | Populus Rhizosphere | MKRVALLCLGLALGAATAAEAQLTMQMSNGWSFTFA |
| Ga0099791_100084281 | 3300007255 | Vadose Zone Soil | MKRLTLLLLGLALGVSATASAQGLTMQMSKGWSFSFSGNVNAFWVFSKVNNSG |
| Ga0099794_101309783 | 3300007265 | Vadose Zone Soil | MKRLTLLLLGLALGVSATAGAQGLTMQMSNGWAFSFSGNVNAFWTFTHQDSTA |
| Ga0099829_103440603 | 3300009038 | Vadose Zone Soil | MKRLTLLLLGLALGVSATASAQGLTMQMSNGWSFSF |
| Ga0099830_109011881 | 3300009088 | Vadose Zone Soil | MKRIGLVCLGLALGAASTVHAQGLTMQMSNGWNFTFSGNVNSFLYYTQTNTGG |
| Ga0099828_118913022 | 3300009089 | Vadose Zone Soil | MKRLTLLCLAVALLLPATANAQLTMQMSNGWAFTFAGNVNVFWSFTKQTNSGP |
| Ga0099827_119305341 | 3300009090 | Vadose Zone Soil | MKRLTLLLLGLALGVSATAGAQGLTMQMSNGWAFQFSGN |
| Ga0105247_106717121 | 3300009101 | Switchgrass Rhizosphere | MKRSALLLGGLLLAAASTANAQLTMQMSNGWTFSFAGNVNIFAQYQSQE |
| Ga0105247_117320851 | 3300009101 | Switchgrass Rhizosphere | MKRVALLCLGLALGAANAAEAQLTMQMSNGWSFTFAGNVNAFIIYQQGKT |
| Ga0066709_1022676782 | 3300009137 | Grasslands Soil | MKRLTLLLLGLALGVSATASAQGLTMQMSNGWAFQFSGNVNAFWVFSK |
| Ga0066709_1023373251 | 3300009137 | Grasslands Soil | MKRLTLLLLGLTLGVSATASAQGLTMQMSNGWAFQFGGN |
| Ga0066709_1026521812 | 3300009137 | Grasslands Soil | MKRLTLLLLGLALGVSATAGAQGLTMQMSNGWAFQFGGN |
| Ga0111538_141381232 | 3300009156 | Populus Rhizosphere | MKRIGLVCLGLALGAANTVHAQGLTMQMSNGWNFTFSG |
| Ga0105073_10343861 | 3300009802 | Groundwater Sand | MGLALGAATVAEAQLTMQMSNGWSFTFAGNVNAFVTYETFGDDGAT |
| Ga0105057_11075151 | 3300009813 | Groundwater Sand | MKRLALLLVAVALLWPAAANAQLTMQMSNGWTFAFAGNVNVFLVYEKEDDAGLT |
| Ga0105064_11031572 | 3300009821 | Groundwater Sand | MKRLALVLLVAALVVPGMAQAQGLTMQMGNGWKFTFAGNVNVFWVYTSDENGPSNSS |
| Ga0126315_111742012 | 3300010038 | Serpentine Soil | MKRVALLCVGLAVGAASVAEAQLTMQMSNGWSFTFSGNVNAFAIYEST |
| Ga0126309_100076591 | 3300010039 | Serpentine Soil | MKRVALLCLGLALGAANAAEAQLTMQMSNGWSFTFAGNVNAFFVY |
| Ga0126309_113137942 | 3300010039 | Serpentine Soil | MGAAGSAQGQLTMQMGNGWSFTFAGNVNAFAVYEKES |
| Ga0126308_101761893 | 3300010040 | Serpentine Soil | MRRVALLCLGLVVGAASAAEAQLTMQMGNGWSFTFAGNVNAFLVYDDINDAGTDPLGGKGASGI |
| Ga0126308_106348602 | 3300010040 | Serpentine Soil | MKRVALLCLGLAVGAASAAEAQLTMQMTNGWSFTFSGNVNAFAIYESTDDEGGTIGA |
| Ga0126310_108392643 | 3300010044 | Serpentine Soil | MRRVALLCLGLAVGAASAAEAQLTMQMGNGWSFTFAGNVNAFLVYDDINDAGI |
| Ga0127457_10341381 | 3300010081 | Grasslands Soil | MKRLALLSVAVALLWPAAANAQLTMQMSNGWSFSFAGNVNAFWVFTKENTNLTPLSKISNSSL |
| Ga0127471_10061871 | 3300010090 | Grasslands Soil | MKRLALLSVAVALLWPAAANAQLTMQMSNGWSFSFAGNVNAFWVFTRGNTALNKVTNSSV |
| Ga0127485_10525791 | 3300010091 | Grasslands Soil | MKRLALLSVAVALLWPAPANAQLTMQMSNGWSFSFAGNVNAFWVFTRGNTALNKL |
| Ga0127490_10655451 | 3300010093 | Grasslands Soil | MKRLALLSVAVALLWPAPANAQLTMQMSNGWSFSFAGNVNAFWVFTRGNTALNK |
| Ga0127440_10713091 | 3300010100 | Grasslands Soil | MKRLAVLSVAVALLWPAAANAQLTMQMSNGWSFSFAGNVNAFWVFTRGN |
| Ga0127474_10730102 | 3300010108 | Grasslands Soil | MKRLTLLLVAVALLWPAAANAQLTMQMSNGWSFTFAGNVNVFWVFTKENTTAGD |
| Ga0127495_10376231 | 3300010115 | Grasslands Soil | MKRLALLSVAVALLWPAAANAQLTMQMSNGWSFSFAGNVNAFWVF |
| Ga0127451_10437922 | 3300010120 | Grasslands Soil | MKRLTLLLLGLALGVSATASAQGLTMQMSNGRAFQFSGNV |
| Ga0127488_10212002 | 3300010122 | Grasslands Soil | MKRLALLSVAVALLWPAPANAQLTMQMSNGWSFSFAGNVNAFWVFTRG |
| Ga0127498_11455651 | 3300010124 | Grasslands Soil | MKRLAVLSVAVALLWPAAANAQLTMQMSNGWSFSFAGNVNAFWV |
| Ga0127498_11474041 | 3300010124 | Grasslands Soil | MKRLTLLLVAVALLWPAAANAQLTMQMSNGWSFTFAGNVNVFWVFTKEN |
| Ga0127482_10328791 | 3300010126 | Grasslands Soil | MKRLAVLSVAVALLWPAAANAQLTMQMSNGWSFSFAGNVNAFWVFTRGNTALNKLTNSSVRTGLLPAFA |
| Ga0127482_11160151 | 3300010126 | Grasslands Soil | RMKRLTLLLLGLALGVSATAGAQGLTMQMSNGWAFQFSGN* |
| Ga0127489_10432401 | 3300010127 | Grasslands Soil | MKRLAVLSVAVALLWPAAANAQLTMQMSNGWSFSFAGNVNAFWVFTRGNTALNKL |
| Ga0127486_11035362 | 3300010128 | Grasslands Soil | MKRLALLSVAVALLWPAPANAQLTMQMSNGWSFSFAGNVNAFWVFTRGNTALNKVTNSSVRT |
| Ga0127459_11938031 | 3300010133 | Grasslands Soil | MKRLTLLLLGLALGVSATANAQGLTMQMSNGWTFTFAGNVNVFWVFSKANVN |
| Ga0127484_11301201 | 3300010134 | Grasslands Soil | MKRLALLLVAVALLWPAGASAQLTMQMSNGWSFAFSGNVNAFWVFSKVNNSGPANSSV |
| Ga0127456_11769241 | 3300010140 | Grasslands Soil | MKRLTLLLVASLLWPAAANAQLTMQMSNGWSFTFAGNVNVFWVFTKENTAAGDAANSNV |
| Ga0127499_10530733 | 3300010141 | Grasslands Soil | MKRLTLLLVAVALLWPAAANAQLTMQMSNGWSFTFAGNVNVFWVFTKENTAAGDAANSNV |
| Ga0134082_103303421 | 3300010303 | Grasslands Soil | MKRLTLLLLGLALGVAATASAQGLTMQMSNGWAFQFSGNVNVFMVF |
| Ga0126372_107021113 | 3300010360 | Tropical Forest Soil | MRRVLGALLFVALGLAGSARAQGLTMQMSNGWSFSFAGNVNAFLAY |
| Ga0126379_131788401 | 3300010366 | Tropical Forest Soil | MKRSALLFGGLLLAAASTANAQGLSMQMSNGWTFSF |
| Ga0134128_108065471 | 3300010373 | Terrestrial Soil | MKRLTLLLLGLALGVSATASAQGLTMQMSNGWSFSFSGNVNVFWVFSK |
| Ga0134128_109154971 | 3300010373 | Terrestrial Soil | MKRVALVCLGLALGAANAAEAQLTMQMSNGWSFTFAGN |
| Ga0134128_121721032 | 3300010373 | Terrestrial Soil | MKKVALLCLGLALGAANAAEAQLTMQMSNGWSFTFAGNVNAFYIY |
| Ga0134126_121491441 | 3300010396 | Terrestrial Soil | MGLAVGAASVAEAQLTMQMSNGWSFTFSGNVNAFAIYE |
| Ga0138514_1000486423 | 3300011003 | Soil | MRRVALLCLGLVVGAASAAEAQLTMQMGNGWSFTFAGNVNAFLVYDDINSAGVDPLGGKGASGIRTGLLP |
| Ga0137393_102341712 | 3300011271 | Vadose Zone Soil | MKRLTLLLLGLALGVATTAKAQGLTMQMSNGWSFSFSGNVNAFWVFSSDS |
| Ga0127502_100776542 | 3300011333 | Soil | MGLVMGAASAAEAQLTMQMSNGWSFTFGGNVNAFLVYE |
| Ga0137388_118646081 | 3300012189 | Vadose Zone Soil | MKRILGALLLVALGLAGSARAQGLTMQMSNGWTFSFA |
| Ga0137364_100466123 | 3300012198 | Vadose Zone Soil | MKRLTLLLLGLALGVTATAKAQGLTMQMSNGWSFAFS |
| Ga0137380_104554322 | 3300012206 | Vadose Zone Soil | MKRLALLSVAVALLWPAAANAQLTMQMSNGWSFSFAGNVNAFWVFTRGNTALNKLTNSSVRT |
| Ga0137381_102100533 | 3300012207 | Vadose Zone Soil | MKRLTLLLLGLALGVSATASAQGLTMQMSNGWSFSFSGNVNAFWVFSSRDSGPQGP |
| Ga0137381_116719481 | 3300012207 | Vadose Zone Soil | MKRLTLLLLGLALGVSATAGAQGLTMQMSNGWSFAFSGNVNVFWSFSKGNTVAGDQTNSN |
| Ga0137378_103940993 | 3300012210 | Vadose Zone Soil | MKRLLLLLVAVALLWPGAASAQLTMQMSNGWSFAFSGNVNAF |
| Ga0137378_105496113 | 3300012210 | Vadose Zone Soil | MKRLTLLLVAVALLWPAAANAQLTMQMSNGWSFTFAGNVNVFWVFTKENTTAGDASNSSV |
| Ga0137378_117601531 | 3300012210 | Vadose Zone Soil | MKRLTLLLLGLAVGVSATASAQGLTMQMSNGWAFTFGGNVNA |
| Ga0137377_114810682 | 3300012211 | Vadose Zone Soil | MKRIALLCMGLALGAVNAAEAQLTMQMSNGWSFTF |
| Ga0150985_1062633841 | 3300012212 | Avena Fatua Rhizosphere | MKKVALLCLGLAMGAANAAEAQLTMQMSNGWSFTFAGNVNAFA |
| Ga0150985_1093335801 | 3300012212 | Avena Fatua Rhizosphere | MKRVALLCVGLAVGAASVAEAQLTMQMSNGWSFTFS |
| Ga0134028_10668341 | 3300012224 | Grasslands Soil | MKRLAVLSVAVALLWPAAANAQLTMQMSNGWSFSFAGNVNAFWVFTRGNTALNKP |
| Ga0137370_105208382 | 3300012285 | Vadose Zone Soil | MKRLTLLLLGLALGVTATAKAQGLTMQMSNGWSFAFGGNVNAFWVFTKGNNSGP |
| Ga0137367_105349011 | 3300012353 | Vadose Zone Soil | MKKVALLCLGLAMGAANAAEAQLTMQMSNGWSFTFAGNVNA |
| Ga0137366_105676672 | 3300012354 | Vadose Zone Soil | MKRLTLLLLGLALGVASTARAQGLTMQMSNGWTFSFAGNVNVFWSF |
| Ga0137369_104176213 | 3300012355 | Vadose Zone Soil | MKRIALLCMGLALGAANAAEAQLTMQMSNGWSFTFAGNVNSFLYYTKSN |
| Ga0137384_103164331 | 3300012357 | Vadose Zone Soil | MKRLTLLLLGLALGVSATANAQGLTMQMSNGWAFTFAGNVNV |
| Ga0137384_106066952 | 3300012357 | Vadose Zone Soil | MKRLALLSVAVALLWPAAANAQLTMQMSNGWSFSFAGNVNAFWVFSKENTNGTPLSKVS |
| Ga0134039_12039511 | 3300012374 | Grasslands Soil | MKRLTLLLLGLALGVSATAGAQGLTMQMSNGWSFSFSGNVNAFWVFSKVNNSGP |
| Ga0134032_11032951 | 3300012376 | Grasslands Soil | MKRLAVLSVAVALLWPAAANAQLTMQMSNGWSFSFAGNVNAFWVFTRGNTALNKLTNSSVRTG |
| Ga0134025_10489271 | 3300012378 | Grasslands Soil | MKRLTLLLLGLALGVSATANAQGLTMQMSNGWSFTFAGNVNVFWVFTKVNNDGPS |
| Ga0134047_10517331 | 3300012380 | Grasslands Soil | MKRLAVLSVAVALLWPAAANAQLTMQMSNGWSFSFAGT* |
| Ga0134047_11546851 | 3300012380 | Grasslands Soil | MKRLALLSVAVALLWPAPANAQLTMQMSNGWSFSFAGNVNAFWVFTRGNTA |
| Ga0134047_12247262 | 3300012380 | Grasslands Soil | MKRLTLLLLGLALGVSATASAQGLTMQMSNGWSFSFSGNVNVFWSFS |
| Ga0134026_11081891 | 3300012381 | Grasslands Soil | MKRLALLLVAVALLLPAAANAQLTMQMSNGWSFSFAGNVNAFWVFTKRNSSGGADSNTANSSVRT |
| Ga0134038_11382712 | 3300012382 | Grasslands Soil | MKRLALLLVAVALLWPAAASAQLTMQMSNGWSFSFAGNVNAFWSFTKEN |
| Ga0134023_12602832 | 3300012385 | Grasslands Soil | MKRLAVLSVAVALLWPAAANAQLTMQMSNGWSFSFAGNVNAFWVFTRGNTA |
| Ga0134046_11160501 | 3300012386 | Grasslands Soil | MKRLALLSVAVALLWPAPANAQLTMQMSNGWSFSFAGNVN |
| Ga0134054_12202121 | 3300012390 | Grasslands Soil | MKRLALLSVAVALLWPAAANAQLTMQMSNGWSFSFAGNVNAFWVFTRGNTALNKLTNSSV |
| Ga0134052_10098131 | 3300012393 | Grasslands Soil | MKRLALLSVAVALLWPAPANAQLTMQMSNGWSFSFAGNVNAFWVFTRGN |
| Ga0134052_10170541 | 3300012393 | Grasslands Soil | MKRLTLLLLGLAFGVSATAGAQALTMQMSNGWTFSFAGNVN |
| Ga0134044_11782221 | 3300012395 | Grasslands Soil | MKRLTLLLVAVALLWPAAANAQLTMQMSNGWSFTFAGNVNVFWVFTKENTTAGDAANSSVRTG |
| Ga0134061_13659922 | 3300012399 | Grasslands Soil | MKRLTLLLLGLALGVTATARAQGLTMQMSNGWSFSFAGNVN |
| Ga0134024_14115141 | 3300012404 | Grasslands Soil | MKRLALLLLAVAVLLPAAASAQLTMQMSNGWSFSFAGNVNAFWSFTKIN |
| Ga0134041_11892542 | 3300012405 | Grasslands Soil | MKRLTLLLVAVVLLWPAAANAQLTMQMSNGWSFTFAGNVNAFWSFTKVNNSGPANSSV |
| Ga0134060_13092451 | 3300012410 | Grasslands Soil | MKRLALLSVAVALLWPAAANAQLTMQMSNGWSFSFAGNVNAFWVFTRGNTALN |
| Ga0134060_14500951 | 3300012410 | Grasslands Soil | MKRLALLSVAVALLWPAPANAQLTMQMSNGWSFSFAGNVNAFWVFTRGNTALN |
| Ga0134060_14522191 | 3300012410 | Grasslands Soil | MKRLTLLLLGLAFGVSATAGAQGLTMQMSNGWAFTFSGNVNVFWSF |
| Ga0150984_1160274611 | 3300012469 | Avena Fatua Rhizosphere | MGLVLGAASAANAQLTMQMTNGWSFTFSGNVNAFAIYESQSDNGGTV |
| Ga0136633_11852563 | 3300012527 | Polar Desert Sand | MKRVALLCLGLVMGAASAAEAQLTMQMSNGWSFTFGGNVNAFLVYEKPSD |
| Ga0137373_100967372 | 3300012532 | Vadose Zone Soil | MKRLAVLLVAVALAWPAAASAQLTMQMSNGWTFSFAGNVNAFWVF |
| Ga0137373_101558141 | 3300012532 | Vadose Zone Soil | MKRLTLLLLGLALGVASTARAQGLTMQMSNGWTFSFAGNVNVFWSFTKQNTAAGDAA |
| Ga0137373_105027522 | 3300012532 | Vadose Zone Soil | MKRLTLLLLGLALGVSATAGAQGLTMQMSNGWSFSFSGNVNVFWVFTKENTAAGDAANS |
| Ga0136615_102079333 | 3300012678 | Polar Desert Sand | MKRVALLCLGLVMGAASAAEAQLTMQMSNGWSFTFGG |
| Ga0157300_10778001 | 3300012884 | Soil | MGLVLGAATAAEAQLTMQMSNGWSFTFGGNVNAFLVYEKPSDN |
| Ga0157299_103120362 | 3300012899 | Soil | MKRVALLCLGLAVGAASVAEAQLTMQMSNGWSFTFSG |
| Ga0137416_101143133 | 3300012927 | Vadose Zone Soil | MKRLTLLLLGLALGVSTTASAQGLTMQMSNGWSFSF |
| Ga0137416_118202082 | 3300012927 | Vadose Zone Soil | MKRLTLLLLGLALGVSATASAQGLTMQMSNGWAFQFSGNVNVFWVFTHQDSS |
| Ga0137407_106196263 | 3300012930 | Vadose Zone Soil | MKKVALLCLGLAFGAVNAAEAQLTMQMSNGWSFTFAGNV |
| Ga0164298_115145581 | 3300012955 | Soil | MLCVGLAVGAASAAEAQLTMQMSNGWAFTFSGNVNAFAIYESQSETGGTNLATTPGGLIG |
| Ga0134110_100654013 | 3300012975 | Grasslands Soil | MKRLALLLVAVALLLPAAANAQLTMQMSNGWSFSFAGNVNAFWVFSKVNNSGPANSSVR |
| Ga0164308_106764571 | 3300012985 | Soil | MKRVALLCLGLALGAANAAEAQLTMQMSNGWSFTFAGNVNAFIIYQQGKTCVP |
| Ga0164304_117563531 | 3300012986 | Soil | MRRITLVWLVLAAGAAGTVQAQGLTMQMSNGWNFTFS |
| Ga0164305_111366522 | 3300012989 | Soil | MKKVALLCLGLALGAVNAAEAQLTMQMSNGWAFTFAGNVNAFYIYQTGKDCAGS |
| Ga0157378_117975652 | 3300013297 | Miscanthus Rhizosphere | MKKVALLCLCLALGAANAAEAQLTMQMSNGWSFTFACNVN |
| Ga0120125_10686881 | 3300014056 | Permafrost | MKRIALLCLGLALGAANAAEAQLTMQMSNGWSFTFAGNVNAFFIYQ |
| Ga0134078_100417701 | 3300014157 | Grasslands Soil | MKRLTLLLLGLALGVTATAKAQGLTMQMSNGWSFAFA |
| Ga0134078_104935111 | 3300014157 | Grasslands Soil | MKRLTLLLLGLALGVSATAGAQGLTMQMSNGWSFSFSG |
| Ga0075312_11463371 | 3300014254 | Natural And Restored Wetlands | MGLVMGAAGAAEAQLTMQMSNGWSFTFGGNVNAFLVYEKQSDVAVPTGTL |
| Ga0075324_11135021 | 3300014263 | Natural And Restored Wetlands | MGLVLGAATAAEAQLTMQMSNGWAFTFSGNVNAFFIYQNSKTNTGGGT |
| Ga0075354_10841192 | 3300014308 | Natural And Restored Wetlands | MKRSALLLASLALATAGTANAQLTMQMSNGWSFSFSG |
| Ga0167655_10534232 | 3300015086 | Glacier Forefield Soil | MKKVALLCLGLAFGAANAAEAQLTMQMSNGWSFTFAGNVHA |
| Ga0173478_102134241 | 3300015201 | Soil | MGLAVGAANAAEAQLTMQMSNGWSFTFAGNVNAFIIYQQGKTCTPPGGD |
| Ga0134073_101693361 | 3300015356 | Grasslands Soil | MKRLTLLLLGLALGVTATARAQGLTMQMSNGWSFSFAGNVNVFWSFTK |
| Ga0134085_100689003 | 3300015359 | Grasslands Soil | MKRLTLLLLGLALGVSATASAQGLTMQMSNGWAFQFSGNV |
| Ga0134085_103014282 | 3300015359 | Grasslands Soil | MKRLTLLLLSLALGVTATARAQGLTMQMSNGWSFSFAGNVNVFWSFTKENTTAGS |
| Ga0132255_1032949372 | 3300015374 | Arabidopsis Rhizosphere | MKRIGLVCLGLALGAANTVHAQGLTMQMSNGWNFTFSGNVNTF |
| Ga0134112_104296441 | 3300017656 | Grasslands Soil | MKRLLLLLVAVALLVPAGANAQLTMQMSNGWSFTFAGNVNAFWSFTKVNNSGPANSSVRT |
| Ga0134112_104411902 | 3300017656 | Grasslands Soil | MRRVALLCMGLAVGAASAAEAQLTMQMSNGWSFTFAGNVNAFFIYQTSKTNTAGGFV |
| Ga0134074_10558131 | 3300017657 | Grasslands Soil | MKRLLLLLVAVALLWPAAASAQLTMQMSNGWSFAFSGNVNAFWVFSKVNNSGPANS |
| Ga0183260_103552883 | 3300017787 | Polar Desert Sand | MLCMGLVMGAASAAEAQLTMQMSNGWSFTFGGNVNAFLVYAKENDGTTTAT |
| Ga0187775_100952303 | 3300017939 | Tropical Peatland | MKRTIVLGVLALAALVSRAEAQLTMQMSNGWTFSFSGNVNAF |
| Ga0184634_103172091 | 3300018031 | Groundwater Sediment | MKRVALLCLGLAVGAASTAEAQLTMQMSNGWSFTFGGNVNSFLYYTKSKSDGTTATPG |
| Ga0066655_103198381 | 3300018431 | Grasslands Soil | MKRLTLLLLSLALGVTATARAQGLTMQMSNGWSFSFAGNVNVFWSFTKENTTAGSA |
| Ga0190275_110539631 | 3300018432 | Soil | MKRVALLCMGLALGAAQAAEAQLTMQMSNGWTFSFAGNVNAFLTYESFGDDGET |
| Ga0190275_131357732 | 3300018432 | Soil | MRRVALLCMGLAVGAASAAEAQLTMQMSNGWSFTFGGNVNAFLVYEKPD |
| Ga0066669_101277552 | 3300018482 | Grasslands Soil | MKRLTLLLLSLALGVTATARAQGLTMQMSNGWSFSFAGNVNVFWSFTKEN |
| Ga0184645_12366921 | 3300019233 | Groundwater Sediment | MKRVALLCLGLAVGAASTAEAQLTMQMSNGWSFTFGGNVNAFFVYDDVSG |
| Ga0184644_14056791 | 3300019269 | Groundwater Sediment | MRRVALLCLGLVVGAASAAEAQLTMQMGNGWSFTFAGNVNAFLVYDD |
| Ga0173482_104110292 | 3300019361 | Soil | MKRSALLLGGLLLAAASTANAQLTMQMSNGWTFSFAGNVNIFAQYQS |
| Ga0137408_10162011 | 3300019789 | Vadose Zone Soil | MKRLTLLLLGLALGVSATAGAQGLTMQMSNGWAFQFSGNSGNVNAFWVFS |
| Ga0193713_10569841 | 3300019882 | Soil | MRRVALLCLGLVVGAASAAEAQLTMQMGNGWSFTFAGNVNAFLVY |
| Ga0193745_10680592 | 3300020059 | Soil | MKRVALLCLGLAVGAASAAEAQLTMQMSNGWSFTFGGNVNAFFVYDDVNSAGVDPL |
| Ga0180109_11993111 | 3300020067 | Groundwater Sediment | MKRSALLFGALMLGAASGANAQALTMQMSNGWTFGFAGNVNI |
| Ga0184649_11623493 | 3300020068 | Groundwater Sediment | MKRVALLCMGLALGAASVAEAQLSMQMSNGWSFTFAGNVNSFI |
| Ga0196963_105917112 | 3300020215 | Soil | MKRVALLCMGLVLGAASAAEAQLTMQMSNGWSFTFAGNVNAFALYDDVSAG |
| Ga0215015_109857151 | 3300021046 | Soil | MKRLTLLLLGLALGVATTADAQGLTMQMSNGWTFSFSGNVNAFWVFSAD |
| Ga0179585_11420252 | 3300021307 | Vadose Zone Soil | MKRLTLLLLGLALGVSATASAQGLTMQMSNGWSFSFSGNVN |
| Ga0193719_101796513 | 3300021344 | Soil | MRRVALLCLGLVVGAASAAEAQLTMQMGNGWSFTFAGNVNAFLVYDDINSAG |
| Ga0193736_10413721 | 3300021412 | Soil | MKRVAMLCLGLAMGAASVAEAQLTMQMSNGWSFTFAGNVNSF |
| Ga0222625_15897442 | 3300022195 | Groundwater Sediment | MKRVAMLCLGLAMGAASVAEAQLTMQMSNGWSFTFAGNVNSFIYY |
| Ga0242665_100353262 | 3300022724 | Soil | MKRIGLVCLGLALGAANTVHAQGLTMQMSNGWNFTFSGNVNTFIY |
| Ga0242665_103950131 | 3300022724 | Soil | MKRLTLLLLGLALGVATTAKAQGLTMQMSNGWSFSFSGNVNAFWVFTAQNN |
| Ga0209320_103970541 | 3300025155 | Soil | MKRVALLCMGLALGAASVAEAQLTMQMSNGWSFTFAGNVNAFVTYENFDDQGTT |
| Ga0209751_104605991 | 3300025327 | Soil | MKRVALLCMGLVMGAANAAEAQLTMQMSNGWSFTFGGNVN |
| Ga0210061_11027301 | 3300025537 | Natural And Restored Wetlands | MKRVAMLCMGLVLGAATAAEAQLTMQMSNGWSFTFAGNVNAFAVYDDVS |
| Ga0207653_100758743 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRSALLLGGLLLAAASTANAQLTMQMSNGWTFSFAGNVNIFAQYQHQ |
| Ga0207642_111386691 | 3300025899 | Miscanthus Rhizosphere | MKRVALLCVGLAVGAASVAEAQLTMQMSNGWSFTFSGNVNVFDNYETT |
| Ga0207685_107883302 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKVALLCLGLALGAVNAAEAQLTMQMSNGWSFTFAGN |
| Ga0207699_113851591 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKVALLCMGLALGAANVAQAQLTMQMSNGWSFTFAGNVNAFMIYSNAKAN |
| Ga0207649_113308701 | 3300025920 | Corn Rhizosphere | MKRVALLCMGLAVGAASVAEAQLTMQMSNGWSFTFSGNVNAFAIYKKTS |
| Ga0207652_102777203 | 3300025921 | Corn Rhizosphere | MKRVALLCLGLALGAANAAEAQLTMQMSNGWSFTFAGNVNAFIIYQQGKTCAGDTCT |
| Ga0207646_103492541 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKVALLCLGLAFGAVNAAEAQLTMQMSNGWSFTFAGNVNSFLYYTKSKTN |
| Ga0207686_116919491 | 3300025934 | Miscanthus Rhizosphere | MKRVAMLCVGLAVGAASAAEAQLTMQMTNGWSFTFSGNVNAFGIYESQ |
| Ga0207670_109143572 | 3300025936 | Switchgrass Rhizosphere | MKRVALLCLGLALGAANAAEAQLTMQMSNGWSFTF |
| Ga0207689_101615793 | 3300025942 | Miscanthus Rhizosphere | MKRVALLCVGLAVGAASVAEAQLTMQMSNGWSFTFSGNVNAFAIYESTSDDGGTLGAPGG |
| Ga0207679_114573172 | 3300025945 | Corn Rhizosphere | MRRVALLCLGLAVGAASVAEAQLTMQMSNGWAFTFSGNVNAFAIYESTSE |
| Ga0208416_10173641 | 3300026004 | Rice Paddy Soil | MKKVALLCMGLAFGAANAAEAQLTMQMSNGWSFTFSGNVNAFYIYQQAKSG |
| Ga0208530_10037521 | 3300026009 | Rice Paddy Soil | MKRVALLCMGLAFGAANVAEAQLTMQMSNGWAFTFSGNVNAFMIYQTSKTAGG |
| Ga0207639_113536761 | 3300026041 | Corn Rhizosphere | MKRVALLCVGLAVGAASVAEAQLTMQMSNGWSFTFSGNVNAFA |
| Ga0208780_10280771 | 3300026046 | Natural And Restored Wetlands | MKRVAMLCMGLVLGAATAAEAQLTMQMSNGWSFTFAG |
| Ga0208422_10109621 | 3300026053 | Natural And Restored Wetlands | MKRVALLCMGLALGAATAAEAQLTMQMSNGWNFTFAGNVNAFYIYQQGKA |
| Ga0208290_10043731 | 3300026066 | Natural And Restored Wetlands | MKRVAMLCMGLVLGAATAAEAQLTMQMSNGWSFTFAGNVNAFA |
| Ga0207641_106970851 | 3300026088 | Switchgrass Rhizosphere | MKRVALLCLGLALGAANAAEAQLTMQMSNGWSFTFAGNVNAFMIYS |
| Ga0207676_116499531 | 3300026095 | Switchgrass Rhizosphere | MKRIGLVCLGLALGAANTVHAQGLTMQMSNGWSFT |
| Ga0209236_12472151 | 3300026298 | Grasslands Soil | MKRLALLLLAVAVLLPAAASAQLTMQMSNGWSFAFS |
| Ga0209027_12578651 | 3300026300 | Grasslands Soil | MKRLTLLLLGLALGVTGTARAQGLTMQMSNGWSFAFGGNVNAFWVFTK |
| Ga0209238_12503561 | 3300026301 | Grasslands Soil | MKRLTLLLLGLALGVSATAGAQGLTMQMSNGWAFQFSGNV |
| Ga0209761_11205011 | 3300026313 | Grasslands Soil | MKRLTLLLLGLALGVSATAGAQGLTMQMSNGWSFSFSGNV |
| Ga0209154_11677292 | 3300026317 | Soil | MKRLTLLLLGLALGVSATAGAQGLTMQMSNGWAFQFGGNVNAFW |
| Ga0209152_103803991 | 3300026325 | Soil | MKRLTLLLVAVALLWPAAANAQLTMQMSNGWSFTFAGNVNVFWVFTKA |
| Ga0209803_11154052 | 3300026332 | Soil | MKRLTLLLLGLALGVSATASAQGLTMQMSNGWAFQFSGNVNAFWVFSKV |
| Ga0209057_10076911 | 3300026342 | Soil | MKRLTLLLLGLALGVSATADAQGLTMQMSNGWAFQFSGNVNAFWTFSHEDSS |
| Ga0209690_10176014 | 3300026524 | Soil | MKRLTLLLLGLALGVSATAGAQGLTMQMSNGWSFSFSGNVNA |
| Ga0208995_10807532 | 3300027388 | Forest Soil | MKRLTLLLLGLALGVNTTARAQGLTMQMSNGWSFQFGGNVNAFWVFSK |
| Ga0209999_10782062 | 3300027543 | Arabidopsis Thaliana Rhizosphere | MRRVALLCLGLVVGAASAAEAQLTMQMGNGWSFTFAGNVNAFLVYDDINDAGIDPLGGEGATGIRTGLL |
| Ga0209874_11225931 | 3300027577 | Groundwater Sand | MKRVAMLCMGLALGAANAAEAQLTMQMSNGWSFTFAGNVNSFLYY |
| Ga0209076_11067761 | 3300027643 | Vadose Zone Soil | MKRLALLLLAVAVLLPAAASAQLTMQMSNGWSFSFAGNVNAFWSFTKVNNNGP |
| Ga0209683_100653652 | 3300027840 | Wetland Sediment | MKKVALLCLGLAMGAANAAEAQLTMQMSNGWSFTFAGNVN |
| Ga0209465_103627952 | 3300027874 | Tropical Forest Soil | MKRVLGALLCVALGLAGSARAQGLTMQMSNGWSFSFAGNV |
| Ga0209283_109012591 | 3300027875 | Vadose Zone Soil | MKRLTLLLVAVALLWPAAANAQLTMQMSNGWSFTFAGNVNVFWVFTKENTNATAG |
| Ga0209590_101388144 | 3300027882 | Vadose Zone Soil | MKRFTLLCLAVALLLPATANAQLTMQMSNGWTFSFAGNVNVFWSFTKRNNSGPA |
| Ga0209590_110303741 | 3300027882 | Vadose Zone Soil | MKRIALLCMGLALGAANAAEAQLTMQMSNGWSFTFAGNVNAFLIYQTSK |
| Ga0209624_110512372 | 3300027895 | Forest Soil | MKRIAIVTCALAMAAGTANAQGLTMQMSNGWNFSFSG |
| Ga0268265_101850021 | 3300028380 | Switchgrass Rhizosphere | MKRVALLCLGLALGAANAAEAQLTMQMSNGWSFTFAGNVNAFIIYQ |
| Ga0268264_111487342 | 3300028381 | Switchgrass Rhizosphere | MKRVAMLCVGLAVGAASAAEAQLTMQMTNGWSFTFSGNVNAFGI |
| Ga0307293_101022351 | 3300028711 | Soil | MKRVALLCLGLAVGAASVAEAQLTMQMSNGWSFTFGGNVNAFL |
| Ga0307303_100202863 | 3300028713 | Soil | MKRVALLCLGLAVGAASAAEAQLTMQMSNGWSFTFAGNVNAFFVYDDVNSAGVDPLGG |
| Ga0307309_101051022 | 3300028714 | Soil | MRRVALLCLGLVVGAASAAEAQLTMQMGNGWSFTFAGNVNAFLVYDDINSAGVDPLGGKGAAGIRTGL |
| Ga0307313_102067022 | 3300028715 | Soil | MLCMGLALGAASAAEAQLTMQMSNGWSFTFGGNVNA |
| Ga0307301_101867202 | 3300028719 | Soil | MKKVALLCLGLAMGAANAAEAQLTMQMSNGWSFTFA |
| Ga0307319_102114072 | 3300028722 | Soil | MKRVAMLCLGLAMGAASVAEAQLTMQMSNGWSFTFAGNVNSFIYYTKSNTDGTVT |
| Ga0307288_104082511 | 3300028778 | Soil | MKRVALLCLGLALGAANAAEAQLTMQMSNGWSFTFAGNVNAFIIYQQAKTCV |
| Ga0307282_105872051 | 3300028784 | Soil | MRRVALLCLGLVVGAASAAEAQLTMQMGNGWSFTFA |
| Ga0307281_101671603 | 3300028803 | Soil | MKRVALLCLGLAVGAANAAEAQLTMQMSNGWSFTFGGNVN |
| Ga0307292_103321142 | 3300028811 | Soil | MKRVALLCLGLAVGAASVAEAQLTMQMSNGWSFTFGGNVNAFLVYDDVSGGGTDFFGG |
| Ga0247825_101080922 | 3300028812 | Soil | MKRVALLCMGLVLGAATAAEAQLTMQMSNGWSFTFAGNVNAFAVYDD |
| Ga0247827_106617911 | 3300028889 | Soil | MKRIGLVCLGLVLAANTANAQLTMQMSNGWTFSFAGNVNAFIFY |
| Ga0268386_107060281 | 3300030619 | Soil | MKRVALLCMGLALGAATAAEAQLTMQMSNGWAFTFA |
| Ga0308198_10057631 | 3300030904 | Soil | MKRVALLCLGLALGAANAAEAQLTMQMSNGWSFTFAGNVNAFMI |
| Ga0308155_10039533 | 3300030987 | Soil | MRRVALLCLGLVVGAASAAEAQLTMQMGNGWSFTFAGNVNAFLVYDDINSAGVDPLGG |
| Ga0308196_10325521 | 3300030989 | Soil | MKRVALLCLGLALGAANAAEAQLTMQMSNGWSFTFAGNVNA |
| Ga0308190_10464421 | 3300030993 | Soil | MKRVALLCLGLAVGAASAAEAQLTMQMTNGWSFTF |
| Ga0308190_10774892 | 3300030993 | Soil | MKRVALFCLGLAVGAASTAEAQLTMQMSNGWSFTFGGNVNAFFVYDDVSGGGTD |
| Ga0308197_100481243 | 3300031093 | Soil | MKRVALLCLGLALGAANAAEAQLTMQMSNGWSFTFAGNVNAF |
| Ga0308197_102186732 | 3300031093 | Soil | MKRVALLCVGLAVGAASVAEAQLTMQMTNGWSFTFSGNVN |
| Ga0307501_102036661 | 3300031152 | Soil | MKRVALLCLGLALGAANAAEAQLTMQMSNGWSFTFAGNVNAFFVYDDVNEAGVDPLG |
| Ga0308194_100343522 | 3300031421 | Soil | MKKVALLCIGLAFGAANAAEAQLTMQMSNGWSFTFAGNVNAFAIYESQSSSGATVT |
| Ga0308194_100914091 | 3300031421 | Soil | MKKVALLCLGLAMGAANAAEAQLTMQMSNGWSFTFAGNVNAFAIYE |
| Ga0307469_103486621 | 3300031720 | Hardwood Forest Soil | MKRIGLVCLGLALGAANTVHAQGLTMQMSNGWSFSFS |
| Ga0307469_110330933 | 3300031720 | Hardwood Forest Soil | MKRLTLLLVAVALLWPAAANAQLTMQMSTGWSFSFAGNVNVFWVFTKGNTAAGDAAN |
| Ga0307405_113771311 | 3300031731 | Rhizosphere | MKRVAMLCLGLALGAASVAEAQLTMQMSNGWSFTF |
| Ga0307473_103948981 | 3300031820 | Hardwood Forest Soil | MKRLTLLLLGLALGVSATASAQGLTMQMSNGWSFSFSGNVNAFGVFTKVNN |
| Ga0307473_107486792 | 3300031820 | Hardwood Forest Soil | MKRLTLLLLGLALGVSATARAQGLTMQMSNGWAFSFSG |
| Ga0307473_113765471 | 3300031820 | Hardwood Forest Soil | MKRLTLLLLGLALGVASTASAQGLTMQMSNGWSFSFGGNVNAFWVFTKVTNS |
| Ga0307410_105957813 | 3300031852 | Rhizosphere | MKRVALLCMGLVMGAASAAEAQLTMQMSNGWSFTFG |
| Ga0310904_103986183 | 3300031854 | Soil | MKRVALLCMGLAVGAASVAEAQLTMQMSNGWSFTFSGNVNAFAIYESTSDNGGTL |
| Ga0307412_123269491 | 3300031911 | Rhizosphere | MKKVALLCMGLAFGAVNAAEAQLTMQMSNGWAFTFSGNVNAFMIYQTSKAAGGGTLSKDL |
| Ga0310885_101938563 | 3300031943 | Soil | MKRVALLCMGLAVGAASVAEAQLTMQMSNGWSFTFSGNVNAFAIYESTSDNGGTLG |
| Ga0310884_105245642 | 3300031944 | Soil | MKRVALLCLGLALGAANAAEAQLTMQMSNGWSFTFAGNVNAFIIYQQNKGCVA |
| Ga0326597_106987971 | 3300031965 | Soil | MKRLTLLLFAAALVVPRMAQAQGLTMHMPNGWDFTFAGNVNVFWVY |
| Ga0307409_1016811762 | 3300031995 | Rhizosphere | MKRVALLCMGLALGAANAAQAQLTMQMSNGWSFTFS |
| Ga0307416_1009354691 | 3300032002 | Rhizosphere | MKKVALLCLGLAMGAAQAAEAQLTMQMSNGWSFTFAGNVNAFA |
| Ga0307414_114511532 | 3300032004 | Rhizosphere | MRRVALLCMGLVMGAASAAEAQLTMQMSNGWSFTFGGNVNAF |
| Ga0310906_111570661 | 3300032013 | Soil | MKRVALLCMGLVLGAATAAEAQLTMQMSNGWSFTFAGNVNAFVTY |
| Ga0310890_114915292 | 3300032075 | Soil | MKRLGLVLAGLALAGAVNTADAQLTMQMSNGWSATFAGNVNA |
| Ga0315292_107336072 | 3300032143 | Sediment | MKRLGLVLAGLALAGAVNTADAQLTMQMSNGWSATFAGNVNAFWIYTAT |
| Ga0307471_1000419681 | 3300032180 | Hardwood Forest Soil | MKRLTLLLLGLALGVSATASAQGLTMQMSNGWTFSFSGNVNVFWSFTKI |
| Ga0307471_1004610801 | 3300032180 | Hardwood Forest Soil | MKRLTLLLVAVALLWPAAANAQLTMQMSNGWSFTFAGNVNVFWVFTKQN |
| Ga0307471_1013910121 | 3300032180 | Hardwood Forest Soil | MKRIGLVCLGLALGAANTVHAQGLTMQMSNGWNFTFSGNVNTFIYYEESKSG |
| Ga0307471_1020769172 | 3300032180 | Hardwood Forest Soil | MKRVALLCLGLALGAANAAEAQLTMQMSNGWSFTFAGNVNAFYI |
| Ga0307472_1003056021 | 3300032205 | Hardwood Forest Soil | MKRIGLVCLGLALGAASTVHAQGLTMQMSNGWNFTFSGNVNSFL |
| Ga0315287_105633523 | 3300032397 | Sediment | MKRLGLVLAGLALAGAVNTADAQLTMQMSNGWSATFAGNVNAF |
| Ga0335082_115000872 | 3300032782 | Soil | MKRSIVLGVLALAALVSRAEAQLTMQMSNGWSFSFSGN |
| Ga0335069_115995992 | 3300032893 | Soil | MKRSALLFGALCLGVASAANAQGLTMQMSNGWNFSFAGNVNI |
| Ga0310810_113313932 | 3300033412 | Soil | LSLAGAGALKAQALTMQMSNGWAFTFSGNVNAFLMYT |
| Ga0326732_10266713 | 3300033501 | Peat Soil | MKRSAMLFGALMVGAASAANAQGLTMQMSNGWMFS |
| Ga0326731_10651273 | 3300033502 | Peat Soil | MKRSALLFGALMLGAASGANAQALTMQMSNGWTFGFAGNVNIFAQFQSQSK |
| Ga0370479_0006047_1_165 | 3300034123 | Untreated Peat Soil | MKRLGLVLAGLALAGAVNTADAQLTMQMSNGWSATFAGNVNAFWIYTDNQIADDL |
| Ga0370506_097040_527_655 | 3300034157 | Untreated Peat Soil | MKRSALLFGALMLGAASAANAQGLSMQMSNGWNFSFAGNVNIF |
| Ga0364934_0397140_1_153 | 3300034178 | Sediment | MKRLALVLLVATLVVPGMAQAQGLTMQMGNGWKFTFAGNVNVFWVFTSDEN |
| Ga0314783_030808_800_925 | 3300034662 | Soil | MGLAVGAASVAEAQLTMQMSNGWSFTFSGNVNAFAIYESTSD |
| Ga0314801_114017_468_617 | 3300034676 | Soil | MGLVLGAASVSEAQLTMQMSNGWSFTFAGNVNAFLTYESFSDDGTTASPV |
| ⦗Top⦘ |