Metagenome / Metatranscriptome Family F009994

Basic Information
Family ID	F009994
Family Type	Metagenome / Metatranscriptome
Number of Sequences	310
Average Sequence Length	47 residues
Representative Sequence	MKRVALLCLGLALGAANAAEAQLTMQMSNGWSFTFAGNVNAF
Number of Associated Samples	264
Number of Associated Scaffolds	310

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	99.35 %
% of genes near scaffold ends (potentially truncated)	98.06 %
% of genes from short scaffolds (< 2000 bps)	94.52 %
Associated GOLD sequencing projects	250
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.38

Most Common Taxonomy
Group	Bacteria (93.226 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil (16.129 % of family members)
Environment Ontology (ENVO)	Unclassified (28.065 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (43.871 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	Yes	Secondary Structure distribution:	α-helix: 22.86% β-sheet: 20.00% Coil/Unstructured: 57.14%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 310 Family Scaffolds
PF06525	SoxE	19.35
PF13360	PQQ_2	12.58
PF01011	PQQ	5.48
PF07690	MFS_1	1.29
PF13570	PQQ_3	0.65
PF07715	Plug	0.65
PF01266	DAO	0.32
PF13795	HupE_UreJ_2	0.32
PF00593	TonB_dep_Rec	0.32

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	93.23 %
Unclassified	root	N/A	6.77 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	93.23 %
Unclassified	root	N/A	6.77 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	93.23 %
Unclassified	root	N/A	6.77 %

Name	Rank	Taxonomy	Distribution
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	70.00 %
Unclassified	root	N/A	6.77 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	0.32 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.32 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.97 %

Name	Rank	Taxonomy	Distribution
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	70.00 %
Unclassified	root	N/A	6.77 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.32 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	0.32 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	0.32 %
Lentisphaerae	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae	0.32 %

Name	Rank	Taxonomy	Distribution
unclassified Gemmatimonadetes	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes	31.94 %
Gemmatimonadetes	class	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes	31.29 %
Unclassified	root	N/A	6.77 %
unclassified Lentisphaerota	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota	0.32 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.32 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.32 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.32 %

Name	Rank	Taxonomy	Distribution
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	31.94 %
Gemmatimonadales	order	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales	31.29 %
Unclassified	root	N/A	6.77 %
Lentisphaerota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium	0.32 %
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	0.32 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.32 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.32 %

Name	Rank	Taxonomy	Distribution
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	31.94 %
unclassified Gemmatimonadales	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales	30.32 %
Unclassified	root	N/A	6.77 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.32 %
Lentisphaerota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium	0.32 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.32 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.32 %
Gemmatimonadaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae	0.97 %

Name	Rank	Taxonomy	Distribution
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	31.94 %
Gemmatimonadales bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	30.32 %
Unclassified	root	N/A	6.77 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.32 %
Lentisphaerota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium	0.32 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.32 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.32 %
unclassified Gemmatimonadaceae	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae	0.97 %

Name	Rank	Taxonomy	Distribution
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	31.94 %
Gemmatimonadales bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	30.32 %
Unclassified	root	N/A	6.77 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.32 %
Lentisphaerota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium	0.32 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.32 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.32 %
Gemmatimonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	0.97 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2067725002\|GPICC_F5MS3JC01CFHUI	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	550	Open in IMG/M
2067725004\|GPKC_F5V46DG04IS8EX	All Organisms → cellular organisms → Bacteria	525	Open in IMG/M
3300000364\|INPhiseqgaiiFebDRAFT_105081908	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	517	Open in IMG/M
3300001661\|JGI12053J15887_10244900	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	893	Open in IMG/M
3300002244\|JGI24742J22300_10098280	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	564	Open in IMG/M
3300002560\|JGI25383J37093_10202074	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	523	Open in IMG/M
3300002914\|JGI25617J43924_10257665	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	592	Open in IMG/M
3300002915\|JGI25387J43893_1042637	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	624	Open in IMG/M
3300002916\|JGI25389J43894_1028338	All Organisms → cellular organisms → Bacteria	969	Open in IMG/M
3300003267\|soilL1_10008934	All Organisms → cellular organisms → Bacteria	7508	Open in IMG/M
3300004013\|Ga0055465_10027900	All Organisms → cellular organisms → Bacteria	1369	Open in IMG/M
3300004062\|Ga0055500_10160819	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	536	Open in IMG/M
3300004081\|Ga0063454_101022873	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	667	Open in IMG/M
3300004463\|Ga0063356_104360392	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	609	Open in IMG/M
3300004479\|Ga0062595_100535071	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	892	Open in IMG/M
3300004479\|Ga0062595_100669033	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	826	Open in IMG/M
3300004800\|Ga0058861_10178143	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	981	Open in IMG/M
3300004803\|Ga0058862_10163400	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1159	Open in IMG/M
3300004808\|Ga0062381_10281329	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	606	Open in IMG/M
3300005172\|Ga0066683_10179660	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1304	Open in IMG/M
3300005179\|Ga0066684_10371402	All Organisms → cellular organisms → Bacteria	958	Open in IMG/M
3300005181\|Ga0066678_11102802	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	510	Open in IMG/M
3300005186\|Ga0066676_10342347	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	998	Open in IMG/M
3300005187\|Ga0066675_11105360	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	592	Open in IMG/M
3300005328\|Ga0070676_11333704	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	549	Open in IMG/M
3300005331\|Ga0070670_101105143	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	723	Open in IMG/M
3300005334\|Ga0068869_100918819	All Organisms → cellular organisms → Bacteria	758	Open in IMG/M
3300005337\|Ga0070682_100609032	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	864	Open in IMG/M
3300005339\|Ga0070660_100743135	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	824	Open in IMG/M
3300005347\|Ga0070668_100981526	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	758	Open in IMG/M
3300005406\|Ga0070703_10076840	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1128	Open in IMG/M
3300005406\|Ga0070703_10350772	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	630	Open in IMG/M
3300005434\|Ga0070709_11330943	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	580	Open in IMG/M
3300005444\|Ga0070694_101246113	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	624	Open in IMG/M
3300005444\|Ga0070694_101350544	Not Available	600	Open in IMG/M
3300005445\|Ga0070708_100544737	All Organisms → cellular organisms → Bacteria	1095	Open in IMG/M
3300005518\|Ga0070699_101228284	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	687	Open in IMG/M
3300005518\|Ga0070699_101718253	All Organisms → cellular organisms → Bacteria	575	Open in IMG/M
3300005526\|Ga0073909_10368965	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	669	Open in IMG/M
3300005545\|Ga0070695_100159015	Not Available	1584	Open in IMG/M
3300005546\|Ga0070696_101070590	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	676	Open in IMG/M
3300005546\|Ga0070696_101131065	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	659	Open in IMG/M
3300005552\|Ga0066701_10452067	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	797	Open in IMG/M
3300005562\|Ga0058697_10712334	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	535	Open in IMG/M
3300005569\|Ga0066705_10900173	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	525	Open in IMG/M
3300005574\|Ga0066694_10205714	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	934	Open in IMG/M
3300005598\|Ga0066706_10319505	All Organisms → cellular organisms → Bacteria	1226	Open in IMG/M
3300005616\|Ga0068852_102192543	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	574	Open in IMG/M
3300005618\|Ga0068864_101573185	All Organisms → cellular organisms → Bacteria	661	Open in IMG/M
3300005719\|Ga0068861_100125372	Not Available	2077	Open in IMG/M
3300005841\|Ga0068863_101838689	All Organisms → cellular organisms → Bacteria	615	Open in IMG/M
3300005883\|Ga0075299_1018150	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	677	Open in IMG/M
3300005885\|Ga0075284_1013234	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	956	Open in IMG/M
3300006034\|Ga0066656_10034143	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	2849	Open in IMG/M
3300006034\|Ga0066656_10506071	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	787	Open in IMG/M
3300006163\|Ga0070715_11069169	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	506	Open in IMG/M
3300006358\|Ga0068871_102240810	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	521	Open in IMG/M
3300006791\|Ga0066653_10139557	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1164	Open in IMG/M
3300006804\|Ga0079221_10544607	All Organisms → cellular organisms → Bacteria	766	Open in IMG/M
3300006854\|Ga0075425_100741510	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	1127	Open in IMG/M
3300006854\|Ga0075425_101355138	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	806	Open in IMG/M
3300006880\|Ga0075429_101771172	Not Available	536	Open in IMG/M
3300006881\|Ga0068865_100396985	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1129	Open in IMG/M
3300006903\|Ga0075426_10018634	All Organisms → cellular organisms → Bacteria	4958	Open in IMG/M
3300006904\|Ga0075424_101102317	All Organisms → cellular organisms → Bacteria	846	Open in IMG/M
3300006904\|Ga0075424_101660730	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	677	Open in IMG/M
3300006904\|Ga0075424_102041259	Not Available	605	Open in IMG/M
3300007255\|Ga0099791_10008428	All Organisms → cellular organisms → Bacteria	4271	Open in IMG/M
3300007265\|Ga0099794_10130978	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1266	Open in IMG/M
3300009038\|Ga0099829_10344060	All Organisms → cellular organisms → Bacteria	1227	Open in IMG/M
3300009088\|Ga0099830_10901188	All Organisms → cellular organisms → Bacteria	731	Open in IMG/M
3300009089\|Ga0099828_11891302	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	523	Open in IMG/M
3300009090\|Ga0099827_11930534	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	514	Open in IMG/M
3300009101\|Ga0105247_10671712	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	776	Open in IMG/M
3300009101\|Ga0105247_11732085	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	518	Open in IMG/M
3300009137\|Ga0066709_102267678	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	746	Open in IMG/M
3300009137\|Ga0066709_102337325	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	730	Open in IMG/M
3300009137\|Ga0066709_102652181	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	670	Open in IMG/M
3300009156\|Ga0111538_14138123	All Organisms → cellular organisms → Bacteria	501	Open in IMG/M
3300009802\|Ga0105073_1034386	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	608	Open in IMG/M
3300009813\|Ga0105057_1107515	All Organisms → cellular organisms → Bacteria	522	Open in IMG/M
3300009821\|Ga0105064_1103157	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	586	Open in IMG/M
3300010038\|Ga0126315_11174201	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	521	Open in IMG/M
3300010039\|Ga0126309_10007659	All Organisms → cellular organisms → Bacteria	4303	Open in IMG/M
3300010040\|Ga0126308_10176189	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1364	Open in IMG/M
3300010040\|Ga0126308_10634860	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	730	Open in IMG/M
3300010044\|Ga0126310_10839264	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	710	Open in IMG/M
3300010081\|Ga0127457_1034138	All Organisms → cellular organisms → Bacteria	566	Open in IMG/M
3300010090\|Ga0127471_1006187	All Organisms → cellular organisms → Bacteria	555	Open in IMG/M
3300010091\|Ga0127485_1052579	Not Available	548	Open in IMG/M
3300010093\|Ga0127490_1065545	Not Available	567	Open in IMG/M
3300010100\|Ga0127440_1071309	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	529	Open in IMG/M
3300010108\|Ga0127474_1073010	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	564	Open in IMG/M
3300010115\|Ga0127495_1037623	All Organisms → cellular organisms → Bacteria	519	Open in IMG/M
3300010120\|Ga0127451_1043792	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	885	Open in IMG/M
3300010122\|Ga0127488_1021200	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	696	Open in IMG/M
3300010124\|Ga0127498_1145565	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	552	Open in IMG/M
3300010124\|Ga0127498_1147404	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	658	Open in IMG/M
3300010126\|Ga0127482_1032879	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	613	Open in IMG/M
3300010126\|Ga0127482_1116015	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	771	Open in IMG/M
3300010127\|Ga0127489_1043240	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	545	Open in IMG/M
3300010128\|Ga0127486_1103536	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	680	Open in IMG/M
3300010133\|Ga0127459_1193803	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	949	Open in IMG/M
3300010134\|Ga0127484_1130120	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	504	Open in IMG/M
3300010140\|Ga0127456_1176924	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	701	Open in IMG/M
3300010141\|Ga0127499_1053073	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	700	Open in IMG/M
3300010303\|Ga0134082_10330342	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	643	Open in IMG/M
3300010360\|Ga0126372_10702111	All Organisms → cellular organisms → Bacteria	988	Open in IMG/M
3300010366\|Ga0126379_13178840	Not Available	550	Open in IMG/M
3300010373\|Ga0134128_10806547	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1040	Open in IMG/M
3300010373\|Ga0134128_10915497	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	970	Open in IMG/M
3300010373\|Ga0134128_12172103	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	611	Open in IMG/M
3300010396\|Ga0134126_12149144	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	609	Open in IMG/M
3300011003\|Ga0138514_100048642	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	851	Open in IMG/M
3300011271\|Ga0137393_10234171	All Organisms → cellular organisms → Bacteria	1556	Open in IMG/M
3300011333\|Ga0127502_10077654	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	517	Open in IMG/M
3300012189\|Ga0137388_11864608	All Organisms → cellular organisms → Bacteria	532	Open in IMG/M
3300012198\|Ga0137364_10046612	All Organisms → cellular organisms → Bacteria	2868	Open in IMG/M
3300012206\|Ga0137380_10455432	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1131	Open in IMG/M
3300012207\|Ga0137381_10210053	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1688	Open in IMG/M
3300012207\|Ga0137381_11671948	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	527	Open in IMG/M
3300012210\|Ga0137378_10394099	All Organisms → cellular organisms → Bacteria	1285	Open in IMG/M
3300012210\|Ga0137378_10549611	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1063	Open in IMG/M
3300012210\|Ga0137378_11760153	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	524	Open in IMG/M
3300012211\|Ga0137377_11481068	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	605	Open in IMG/M
3300012212\|Ga0150985_106263384	All Organisms → cellular organisms → Bacteria	1384	Open in IMG/M
3300012212\|Ga0150985_109333580	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	726	Open in IMG/M
3300012224\|Ga0134028_1066834	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	551	Open in IMG/M
3300012285\|Ga0137370_10520838	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	729	Open in IMG/M
3300012353\|Ga0137367_10534901	All Organisms → cellular organisms → Bacteria	824	Open in IMG/M
3300012354\|Ga0137366_10567667	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	816	Open in IMG/M
3300012355\|Ga0137369_10417621	All Organisms → cellular organisms → Bacteria	964	Open in IMG/M
3300012357\|Ga0137384_10316433	All Organisms → cellular organisms → Bacteria	1296	Open in IMG/M
3300012357\|Ga0137384_10606695	All Organisms → cellular organisms → Bacteria	893	Open in IMG/M
3300012374\|Ga0134039_1203951	Not Available	524	Open in IMG/M
3300012376\|Ga0134032_1103295	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	572	Open in IMG/M
3300012378\|Ga0134025_1048927	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	522	Open in IMG/M
3300012380\|Ga0134047_1051733	All Organisms → cellular organisms → Bacteria	1950	Open in IMG/M
3300012380\|Ga0134047_1154685	All Organisms → cellular organisms → Bacteria	573	Open in IMG/M
3300012380\|Ga0134047_1224726	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	584	Open in IMG/M
3300012381\|Ga0134026_1108189	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	602	Open in IMG/M
3300012382\|Ga0134038_1138271	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	750	Open in IMG/M
3300012385\|Ga0134023_1260283	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	528	Open in IMG/M
3300012386\|Ga0134046_1116050	Not Available	544	Open in IMG/M
3300012390\|Ga0134054_1220212	All Organisms → cellular organisms → Bacteria	569	Open in IMG/M
3300012393\|Ga0134052_1009813	Not Available	559	Open in IMG/M
3300012393\|Ga0134052_1017054	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	513	Open in IMG/M
3300012395\|Ga0134044_1178222	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	716	Open in IMG/M
3300012399\|Ga0134061_1365992	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	711	Open in IMG/M
3300012404\|Ga0134024_1411514	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	530	Open in IMG/M
3300012405\|Ga0134041_1189254	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	507	Open in IMG/M
3300012410\|Ga0134060_1309245	All Organisms → cellular organisms → Bacteria	583	Open in IMG/M
3300012410\|Ga0134060_1450095	Not Available	581	Open in IMG/M
3300012410\|Ga0134060_1452219	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	502	Open in IMG/M
3300012469\|Ga0150984_116027461	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	762	Open in IMG/M
3300012527\|Ga0136633_1185256	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	786	Open in IMG/M
3300012532\|Ga0137373_10096737	All Organisms → cellular organisms → Bacteria	2591	Open in IMG/M
3300012532\|Ga0137373_10155814	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1922	Open in IMG/M
3300012532\|Ga0137373_10502752	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	926	Open in IMG/M
3300012678\|Ga0136615_10207933	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	893	Open in IMG/M
3300012884\|Ga0157300_1077800	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	575	Open in IMG/M
3300012899\|Ga0157299_10312036	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	525	Open in IMG/M
3300012927\|Ga0137416_10114313	All Organisms → cellular organisms → Bacteria	2055	Open in IMG/M
3300012927\|Ga0137416_11820208	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	556	Open in IMG/M
3300012930\|Ga0137407_10619626	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1016	Open in IMG/M
3300012955\|Ga0164298_11514558	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	524	Open in IMG/M
3300012975\|Ga0134110_10065401	All Organisms → cellular organisms → Bacteria	1443	Open in IMG/M
3300012985\|Ga0164308_10676457	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	887	Open in IMG/M
3300012986\|Ga0164304_11756353	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	519	Open in IMG/M
3300012989\|Ga0164305_11136652	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	673	Open in IMG/M
3300013297\|Ga0157378_11797565	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	661	Open in IMG/M
3300014056\|Ga0120125_1068688	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	797	Open in IMG/M
3300014157\|Ga0134078_10041770	All Organisms → cellular organisms → Bacteria	1553	Open in IMG/M
3300014157\|Ga0134078_10493511	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	568	Open in IMG/M
3300014254\|Ga0075312_1146337	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	521	Open in IMG/M
3300014263\|Ga0075324_1113502	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	594	Open in IMG/M
3300014308\|Ga0075354_1084119	Not Available	642	Open in IMG/M
3300015086\|Ga0167655_1053423	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	590	Open in IMG/M
3300015201\|Ga0173478_10213424	All Organisms → cellular organisms → Bacteria	819	Open in IMG/M
3300015356\|Ga0134073_10169336	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	704	Open in IMG/M
3300015359\|Ga0134085_10068900	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1437	Open in IMG/M
3300015359\|Ga0134085_10301428	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	705	Open in IMG/M
3300015374\|Ga0132255_103294937	All Organisms → cellular organisms → Bacteria	688	Open in IMG/M
3300017656\|Ga0134112_10429644	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	550	Open in IMG/M
3300017656\|Ga0134112_10441190	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	543	Open in IMG/M
3300017657\|Ga0134074_1055813	All Organisms → cellular organisms → Bacteria	1337	Open in IMG/M
3300017787\|Ga0183260_10355288	All Organisms → cellular organisms → Bacteria	983	Open in IMG/M
3300018031\|Ga0184634_10317209	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	715	Open in IMG/M
3300018431\|Ga0066655_10319838	All Organisms → cellular organisms → Bacteria	1013	Open in IMG/M
3300018432\|Ga0190275_11053963	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	886	Open in IMG/M
3300018432\|Ga0190275_13135773	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	535	Open in IMG/M
3300018482\|Ga0066669_10127755	All Organisms → cellular organisms → Bacteria	1825	Open in IMG/M
3300019233\|Ga0184645_1236692	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	735	Open in IMG/M
3300019269\|Ga0184644_1405679	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	762	Open in IMG/M
3300019361\|Ga0173482_10411029	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	632	Open in IMG/M
3300019789\|Ga0137408_1016201	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	787	Open in IMG/M
3300019882\|Ga0193713_1056984	All Organisms → cellular organisms → Bacteria	1118	Open in IMG/M
3300020059\|Ga0193745_1068059	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	777	Open in IMG/M
3300020067\|Ga0180109_1199311	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	542	Open in IMG/M
3300020068\|Ga0184649_1162349	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	2296	Open in IMG/M
3300020215\|Ga0196963_10591711	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	507	Open in IMG/M
3300021046\|Ga0215015_10985715	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	791	Open in IMG/M
3300021307\|Ga0179585_1142025	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	678	Open in IMG/M
3300021344\|Ga0193719_10179651	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	908	Open in IMG/M
3300021412\|Ga0193736_1041372	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	635	Open in IMG/M
3300022195\|Ga0222625_1589744	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	584	Open in IMG/M
3300022724\|Ga0242665_10035326	All Organisms → cellular organisms → Bacteria	1255	Open in IMG/M
3300022724\|Ga0242665_10395013	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	504	Open in IMG/M
3300025155\|Ga0209320_10397054	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium	555	Open in IMG/M
3300025327\|Ga0209751_10460599	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1045	Open in IMG/M
3300025537\|Ga0210061_1102730	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	505	Open in IMG/M
3300025885\|Ga0207653_10075874	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1156	Open in IMG/M
3300025899\|Ga0207642_11138669	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	505	Open in IMG/M
3300025905\|Ga0207685_10788330	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	523	Open in IMG/M
3300025906\|Ga0207699_11385159	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	520	Open in IMG/M
3300025920\|Ga0207649_11330870	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	568	Open in IMG/M
3300025921\|Ga0207652_10277720	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1511	Open in IMG/M
3300025922\|Ga0207646_10349254	All Organisms → cellular organisms → Bacteria	1336	Open in IMG/M
3300025934\|Ga0207686_11691949	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	523	Open in IMG/M
3300025936\|Ga0207670_10914357	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	735	Open in IMG/M
3300025942\|Ga0207689_10161579	All Organisms → cellular organisms → Bacteria	1846	Open in IMG/M
3300025945\|Ga0207679_11457317	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	628	Open in IMG/M
3300026004\|Ga0208416_1017364	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	571	Open in IMG/M
3300026009\|Ga0208530_1003752	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1040	Open in IMG/M
3300026041\|Ga0207639_11353676	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	668	Open in IMG/M
3300026046\|Ga0208780_1028077	Not Available	526	Open in IMG/M
3300026053\|Ga0208422_1010962	All Organisms → cellular organisms → Bacteria	1039	Open in IMG/M
3300026066\|Ga0208290_1004373	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1261	Open in IMG/M
3300026088\|Ga0207641_10697085	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1000	Open in IMG/M
3300026095\|Ga0207676_11649953	All Organisms → cellular organisms → Bacteria	639	Open in IMG/M
3300026298\|Ga0209236_1247215	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	591	Open in IMG/M
3300026300\|Ga0209027_1257865	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	559	Open in IMG/M
3300026301\|Ga0209238_1250356	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	527	Open in IMG/M
3300026313\|Ga0209761_1120501	Not Available	1275	Open in IMG/M
3300026317\|Ga0209154_1167729	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	894	Open in IMG/M
3300026325\|Ga0209152_10380399	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	548	Open in IMG/M
3300026332\|Ga0209803_1115405	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1080	Open in IMG/M
3300026342\|Ga0209057_1007691	All Organisms → cellular organisms → Bacteria	7072	Open in IMG/M
3300026524\|Ga0209690_1017601	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	3666	Open in IMG/M
3300027388\|Ga0208995_1080753	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	569	Open in IMG/M
3300027543\|Ga0209999_1078206	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	637	Open in IMG/M
3300027577\|Ga0209874_1122593	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	604	Open in IMG/M
3300027643\|Ga0209076_1106776	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	793	Open in IMG/M
3300027840\|Ga0209683_10065365	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1612	Open in IMG/M
3300027874\|Ga0209465_10362795	All Organisms → cellular organisms → Bacteria	726	Open in IMG/M
3300027875\|Ga0209283_10901259	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	535	Open in IMG/M
3300027882\|Ga0209590_10138814	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1496	Open in IMG/M
3300027882\|Ga0209590_11030374	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	512	Open in IMG/M
3300027895\|Ga0209624_11051237	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	526	Open in IMG/M
3300028380\|Ga0268265_10185002	All Organisms → cellular organisms → Bacteria	1794	Open in IMG/M
3300028381\|Ga0268264_11148734	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	786	Open in IMG/M
3300028711\|Ga0307293_10102235	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	909	Open in IMG/M
3300028713\|Ga0307303_10020286	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1268	Open in IMG/M
3300028714\|Ga0307309_10105102	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	678	Open in IMG/M
3300028715\|Ga0307313_10206702	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	609	Open in IMG/M
3300028719\|Ga0307301_10186720	All Organisms → cellular organisms → Bacteria	672	Open in IMG/M
3300028722\|Ga0307319_10211407	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	636	Open in IMG/M
3300028778\|Ga0307288_10408251	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	554	Open in IMG/M
3300028784\|Ga0307282_10587205	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	540	Open in IMG/M
3300028803\|Ga0307281_10167160	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	778	Open in IMG/M
3300028811\|Ga0307292_10332114	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	640	Open in IMG/M
3300028812\|Ga0247825_10108092	Not Available	1886	Open in IMG/M
3300028889\|Ga0247827_10661791	All Organisms → cellular organisms → Bacteria	676	Open in IMG/M
3300030619\|Ga0268386_10706028	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	657	Open in IMG/M
3300030904\|Ga0308198_1005763	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1352	Open in IMG/M
3300030987\|Ga0308155_1003953	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1008	Open in IMG/M
3300030989\|Ga0308196_1032552	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	662	Open in IMG/M
3300030993\|Ga0308190_1046442	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	824	Open in IMG/M
3300030993\|Ga0308190_1077489	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	692	Open in IMG/M
3300031093\|Ga0308197_10048124	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1089	Open in IMG/M
3300031093\|Ga0308197_10218673	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	658	Open in IMG/M
3300031152\|Ga0307501_10203666	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	567	Open in IMG/M
3300031421\|Ga0308194_10034352	All Organisms → cellular organisms → Bacteria	1214	Open in IMG/M
3300031421\|Ga0308194_10091409	All Organisms → cellular organisms → Bacteria	859	Open in IMG/M
3300031720\|Ga0307469_10348662	All Organisms → cellular organisms → Bacteria	1242	Open in IMG/M
3300031720\|Ga0307469_11033093	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	769	Open in IMG/M
3300031731\|Ga0307405_11377131	Not Available	616	Open in IMG/M
3300031820\|Ga0307473_10394898	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	904	Open in IMG/M
3300031820\|Ga0307473_10748679	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	691	Open in IMG/M
3300031820\|Ga0307473_11376547	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	531	Open in IMG/M
3300031852\|Ga0307410_10595781	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	921	Open in IMG/M
3300031854\|Ga0310904_10398618	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	900	Open in IMG/M
3300031911\|Ga0307412_12326949	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	500	Open in IMG/M
3300031943\|Ga0310885_10193856	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	1000	Open in IMG/M
3300031944\|Ga0310884_10524564	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	698	Open in IMG/M
3300031965\|Ga0326597_10698797	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1067	Open in IMG/M
3300031995\|Ga0307409_101681176	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	663	Open in IMG/M
3300032002\|Ga0307416_100935469	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	968	Open in IMG/M
3300032004\|Ga0307414_11451153	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	638	Open in IMG/M
3300032013\|Ga0310906_11157066	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	561	Open in IMG/M
3300032075\|Ga0310890_11491529	Not Available	557	Open in IMG/M
3300032143\|Ga0315292_10733607	All Organisms → cellular organisms → Bacteria	830	Open in IMG/M
3300032180\|Ga0307471_100041968	All Organisms → cellular organisms → Bacteria	3676	Open in IMG/M
3300032180\|Ga0307471_100461080	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1412	Open in IMG/M
3300032180\|Ga0307471_101391012	All Organisms → cellular organisms → Bacteria	862	Open in IMG/M
3300032180\|Ga0307471_102076917	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	714	Open in IMG/M
3300032205\|Ga0307472_100305602	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1281	Open in IMG/M
3300032397\|Ga0315287_10563352	All Organisms → cellular organisms → Bacteria → Proteobacteria	1351	Open in IMG/M
3300032893\|Ga0335069_11599599	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	698	Open in IMG/M
3300033412\|Ga0310810_11331393	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	560	Open in IMG/M
3300033501\|Ga0326732_1026671	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	979	Open in IMG/M
3300033502\|Ga0326731_1065127	All Organisms → cellular organisms → Bacteria	847	Open in IMG/M
3300034123\|Ga0370479_0006047	All Organisms → cellular organisms → Bacteria	2599	Open in IMG/M
3300034157\|Ga0370506_097040	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	655	Open in IMG/M
3300034178\|Ga0364934_0397140	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	522	Open in IMG/M
3300034662\|Ga0314783_030808	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	925	Open in IMG/M
3300034676\|Ga0314801_114017	All Organisms → cellular organisms → Bacteria	619	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	84.52%
Host-Associated	Host-Associated	15.48%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	79.03%
Plants	Host-Associated → Plants	14.84%
Aquatic	Environmental → Aquatic	5.48%
Human	Host-Associated → Human	0.65%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	77.74%
Rhizosphere	Host-Associated → Plants → Rhizosphere	8.06%
Rhizoplane	Host-Associated → Plants → Rhizoplane	6.13%
Freshwater	Environmental → Aquatic → Freshwater	4.19%
Marine	Environmental → Aquatic → Marine	0.97%
Peat	Environmental → Terrestrial → Peat	0.65%
Digestive System	Host-Associated → Human → Digestive System	0.65%
Sediment	Environmental → Aquatic → Sediment	0.32%
Floodplain	Environmental → Terrestrial → Floodplain	0.32%
Agricultural Field	Environmental → Terrestrial → Agricultural Field	0.32%
Roots	Host-Associated → Plants → Roots	0.32%
Phylloplane	Host-Associated → Plants → Phylloplane	0.32%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	63.23%
Loam	Environmental → Terrestrial → Soil → Loam	8.06%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	5.81%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	5.16%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	4.84%
Soil	Host-Associated → Plants → Rhizosphere → Soil	2.26%
Sediment	Environmental → Aquatic → Freshwater → Sediment	1.61%
Sand	Environmental → Terrestrial → Soil → Sand	1.61%
Ice	Environmental → Aquatic → Freshwater → Ice	0.97%
Wetlands	Environmental → Aquatic → Marine → Wetlands	0.97%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.97%
Lake	Environmental → Aquatic → Freshwater → Lake	0.65%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.65%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	0.65%
Large Intestine	Host-Associated → Human → Digestive System → Large Intestine	0.65%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.32%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.32%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.32%
Unclassified	Environmental → Terrestrial → Agricultural Field → Unclassified	0.32%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.32%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified	0.32%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	44.19%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	10.65%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	6.13%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	5.81%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	5.16%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	4.84%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	3.87%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	2.90%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	2.26%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	1.61%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	1.29%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	1.29%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	1.29%
Unclassified	Environmental → Aquatic → Freshwater → Ice → Unclassified	0.97%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	0.97%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.97%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	0.65%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	0.65%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	0.65%
Fecal	Host-Associated → Human → Digestive System → Large Intestine → Fecal	0.65%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	0.32%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.32%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	0.32%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.32%
Unclassified	Environmental → Terrestrial → Soil → Loam → Unclassified	0.32%
Desert	Environmental → Terrestrial → Soil → Sand → Desert	0.32%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.32%
Unclassified	Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified	0.32%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.32%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified	0.32%

Habitat	Taxonomy	Distribution
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	16.13%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	12.26%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	10.97%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	6.45%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	5.16%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	4.19%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	3.23%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	2.90%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	2.58%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.26%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	1.94%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	1.94%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	1.94%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	1.61%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.29%
Rice Paddy Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil	1.29%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	1.29%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.29%
Polar Desert Sand	Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand	0.97%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	0.97%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.97%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.97%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	0.65%
Wetland Sediment	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment	0.65%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	0.65%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.65%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.65%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.65%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	0.65%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.65%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	0.65%
Host-Associated	Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated	0.65%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	0.65%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.65%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.65%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.65%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.65%
Soil	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil	0.32%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.32%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.32%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	0.32%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	0.32%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.32%
Sugarcane Root And Bulk Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil	0.32%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	0.32%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.32%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.32%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.32%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.32%
Soil	Environmental → Terrestrial → Soil → Loam → Unclassified → Soil	0.32%
Soil	Environmental → Terrestrial → Soil → Sand → Desert → Soil	0.32%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.32%
Soil	Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil	0.32%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.32%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.32%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.32%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.32%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.32%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.32%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	0.32%
Agave	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave	0.32%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2067725002	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
2067725004	Soil microbial communities from Great Prairies - Kansas Corn soil	Environmental	Open in IMG/M
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300001661	Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)	Environmental	Open in IMG/M
3300002244	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1	Host-Associated	Open in IMG/M
3300002560	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm	Environmental	Open in IMG/M
3300002914	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm	Environmental	Open in IMG/M
3300002915	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm	Environmental	Open in IMG/M
3300002916	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm	Environmental	Open in IMG/M
3300003267	Sugarcane bulk soil Sample L1	Environmental	Open in IMG/M
3300004013	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2	Environmental	Open in IMG/M
3300004062	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2	Environmental	Open in IMG/M
3300004081	Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)	Environmental	Open in IMG/M
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300004800	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300004803	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300004808	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh	Environmental	Open in IMG/M
3300005172	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132	Environmental	Open in IMG/M
3300005179	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133	Environmental	Open in IMG/M
3300005181	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127	Environmental	Open in IMG/M
3300005186	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125	Environmental	Open in IMG/M
3300005187	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124	Environmental	Open in IMG/M
3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Host-Associated	Open in IMG/M
3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Host-Associated	Open in IMG/M
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated	Open in IMG/M
3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Environmental	Open in IMG/M
3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Host-Associated	Open in IMG/M
3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Host-Associated	Open in IMG/M
3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Environmental	Open in IMG/M
3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Environmental	Open in IMG/M
3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Environmental	Open in IMG/M
3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Environmental	Open in IMG/M
3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Environmental	Open in IMG/M
3300005526	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1	Environmental	Open in IMG/M
3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Environmental	Open in IMG/M
3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Environmental	Open in IMG/M
3300005552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150	Environmental	Open in IMG/M
3300005562	Agave microbial communities from Guanajuato, Mexico - As.Ma.e	Host-Associated	Open in IMG/M
3300005569	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154	Environmental	Open in IMG/M
3300005574	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143	Environmental	Open in IMG/M
3300005598	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155	Environmental	Open in IMG/M
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated	Open in IMG/M
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300005883	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_302	Environmental	Open in IMG/M
3300005885	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_401	Environmental	Open in IMG/M
3300006034	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105	Environmental	Open in IMG/M
3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Environmental	Open in IMG/M
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated	Open in IMG/M
3300006791	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102	Environmental	Open in IMG/M
3300006804	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200	Environmental	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006880	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Host-Associated	Open in IMG/M
3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Host-Associated	Open in IMG/M
3300006903	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300007255	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1	Environmental	Open in IMG/M
3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Environmental	Open in IMG/M
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental	Open in IMG/M
3300009088	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG	Environmental	Open in IMG/M
3300009089	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009802	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_50_60	Environmental	Open in IMG/M
3300009813	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20	Environmental	Open in IMG/M
3300009821	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30	Environmental	Open in IMG/M
3300010038	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106	Environmental	Open in IMG/M
3300010039	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56	Environmental	Open in IMG/M
3300010040	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55	Environmental	Open in IMG/M
3300010044	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60	Environmental	Open in IMG/M
3300010081	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_0_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010090	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_24_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010091	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_16_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010093	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_16_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010100	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_0_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010108	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_8_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010115	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_16_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010120	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_24_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010122	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010124	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_4_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010126	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_0_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010127	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_8_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010128	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_24_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010133	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_8_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010134	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_8_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010140	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_24_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010141	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_8_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010303	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental	Open in IMG/M
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental	Open in IMG/M
3300011003	Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015	Environmental	Open in IMG/M
3300011271	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG	Environmental	Open in IMG/M
3300011333	Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental	Open in IMG/M
3300012198	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG	Environmental	Open in IMG/M
3300012206	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG	Environmental	Open in IMG/M
3300012207	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG	Environmental	Open in IMG/M
3300012210	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG	Environmental	Open in IMG/M
3300012211	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012224	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012285	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG	Environmental	Open in IMG/M
3300012353	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG	Environmental	Open in IMG/M
3300012354	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG	Environmental	Open in IMG/M
3300012355	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG	Environmental	Open in IMG/M
3300012357	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG	Environmental	Open in IMG/M
3300012374	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012376	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_0_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012378	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_16_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012380	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012381	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_24_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012382	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_4_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012385	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012386	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012390	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012393	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012395	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012399	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012404	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_8_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012405	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012410	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012527	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ83 (22.06)	Environmental	Open in IMG/M
3300012532	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG	Environmental	Open in IMG/M
3300012678	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ288 (22.06)	Environmental	Open in IMG/M
3300012884	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2	Environmental	Open in IMG/M
3300012899	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2	Environmental	Open in IMG/M
3300012927	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012930	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012955	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG	Environmental	Open in IMG/M
3300012975	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015	Environmental	Open in IMG/M
3300012985	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG	Environmental	Open in IMG/M
3300012986	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG	Environmental	Open in IMG/M
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300014056	Permafrost microbial communities from Nunavut, Canada - A20_5cm_0M	Environmental	Open in IMG/M
3300014157	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG	Environmental	Open in IMG/M
3300014254	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D2	Environmental	Open in IMG/M
3300014263	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1	Environmental	Open in IMG/M
3300014308	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D1	Environmental	Open in IMG/M
3300015086	Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-5c, rocky medial moraine)	Environmental	Open in IMG/M
3300015201	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)	Environmental	Open in IMG/M
3300015356	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG	Environmental	Open in IMG/M
3300015359	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015	Environmental	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300017656	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015	Environmental	Open in IMG/M
3300017657	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015	Environmental	Open in IMG/M
3300017787	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2)	Environmental	Open in IMG/M
3300017939	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG	Environmental	Open in IMG/M
3300018031	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1	Environmental	Open in IMG/M
3300018431	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104	Environmental	Open in IMG/M
3300018432	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300019233	Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019269	Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019361	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)	Environmental	Open in IMG/M
3300019789	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300019882	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2	Environmental	Open in IMG/M
3300020059	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2	Environmental	Open in IMG/M
3300020067	Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT47_16_1Ra (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300020068	Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300020215	Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_5	Environmental	Open in IMG/M
3300021046	Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth	Environmental	Open in IMG/M
3300021307	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_06_16RNAfungal (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300021344	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2	Environmental	Open in IMG/M
3300021412	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2m1	Environmental	Open in IMG/M
3300022195	Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300022724	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300025155	Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 4	Environmental	Open in IMG/M
3300025327	Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes)	Environmental	Open in IMG/M
3300025537	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 (SPAdes)	Environmental	Open in IMG/M
3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)	Environmental	Open in IMG/M
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026004	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_302 (SPAdes)	Environmental	Open in IMG/M
3300026009	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_401 (SPAdes)	Environmental	Open in IMG/M
3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026046	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1 (SPAdes)	Environmental	Open in IMG/M
3300026053	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1 (SPAdes)	Environmental	Open in IMG/M
3300026066	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1 (SPAdes)	Environmental	Open in IMG/M
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026298	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes)	Environmental	Open in IMG/M
3300026300	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes)	Environmental	Open in IMG/M
3300026301	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes)	Environmental	Open in IMG/M
3300026313	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes)	Environmental	Open in IMG/M
3300026317	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes)	Environmental	Open in IMG/M
3300026325	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)	Environmental	Open in IMG/M
3300026332	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes)	Environmental	Open in IMG/M
3300026342	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes)	Environmental	Open in IMG/M
3300026524	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes)	Environmental	Open in IMG/M
3300027388	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 (SPAdes)	Environmental	Open in IMG/M
3300027543	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes)	Host-Associated	Open in IMG/M
3300027577	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes)	Environmental	Open in IMG/M
3300027643	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes)	Environmental	Open in IMG/M
3300027840	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes)	Environmental	Open in IMG/M
3300027874	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)	Environmental	Open in IMG/M
3300027875	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027882	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027895	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)	Environmental	Open in IMG/M
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028711	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150	Environmental	Open in IMG/M
3300028713	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184	Environmental	Open in IMG/M
3300028714	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196	Environmental	Open in IMG/M
3300028715	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203	Environmental	Open in IMG/M
3300028719	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182	Environmental	Open in IMG/M
3300028722	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368	Environmental	Open in IMG/M
3300028778	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142	Environmental	Open in IMG/M
3300028784	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121	Environmental	Open in IMG/M
3300028803	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120	Environmental	Open in IMG/M
3300028811	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149	Environmental	Open in IMG/M
3300028812	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48	Environmental	Open in IMG/M
3300028889	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2	Environmental	Open in IMG/M
3300030619	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq)	Environmental	Open in IMG/M
3300030904	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_202 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030987	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_144 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030989	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_197 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030993	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031093	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031152	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S	Environmental	Open in IMG/M
3300031421	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Host-Associated	Open in IMG/M
3300031820	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515	Environmental	Open in IMG/M
3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Host-Associated	Open in IMG/M
3300031854	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1	Environmental	Open in IMG/M
3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Host-Associated	Open in IMG/M
3300031943	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2	Environmental	Open in IMG/M
3300031944	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1	Environmental	Open in IMG/M
3300031965	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185	Environmental	Open in IMG/M
3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Host-Associated	Open in IMG/M
3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Host-Associated	Open in IMG/M
3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Host-Associated	Open in IMG/M
3300032013	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3	Environmental	Open in IMG/M
3300032075	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3	Environmental	Open in IMG/M
3300032143	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M
3300032397	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0	Environmental	Open in IMG/M
3300032782	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1	Environmental	Open in IMG/M
3300032893	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1	Environmental	Open in IMG/M
3300033412	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC	Environmental	Open in IMG/M
3300033501	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF12FN SIP fraction	Environmental	Open in IMG/M
3300033502	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF9FY SIP fraction	Environmental	Open in IMG/M
3300034123	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_15	Environmental	Open in IMG/M
3300034157	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_18	Environmental	Open in IMG/M
3300034178	Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17	Environmental	Open in IMG/M
3300034662	Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R4 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300034676	Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R2 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.38
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.38
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F009994

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign