| Basic Information | |
|---|---|
| Family ID | F009980 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 310 |
| Average Sequence Length | 40 residues |
| Representative Sequence | LKFVKAIMIVAVLATALSFGACAQRKETVTTSAGTTGYAK |
| Number of Associated Samples | 212 |
| Number of Associated Scaffolds | 309 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 66.45 % |
| % of genes near scaffold ends (potentially truncated) | 43.87 % |
| % of genes from short scaffolds (< 2000 bps) | 88.71 % |
| Associated GOLD sequencing projects | 194 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.774 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (27.097 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.968 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.774 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 44.12% β-sheet: 0.00% Coil/Unstructured: 55.88% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 309 Family Scaffolds |
|---|---|---|
| PF03734 | YkuD | 38.19 |
| PF00221 | Lyase_aromatic | 19.42 |
| PF02774 | Semialdhyde_dhC | 3.88 |
| PF14534 | DUF4440 | 2.91 |
| PF01175 | Urocanase | 1.94 |
| PF01118 | Semialdhyde_dh | 1.94 |
| PF02687 | FtsX | 0.32 |
| PF04519 | Bactofilin | 0.32 |
| PF05698 | Trigger_C | 0.32 |
| PF01425 | Amidase | 0.32 |
| PF15631 | Imm-NTF2-2 | 0.32 |
| PF12704 | MacB_PCD | 0.32 |
| COG ID | Name | Functional Category | % Frequency in 309 Family Scaffolds |
|---|---|---|---|
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 38.19 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 38.19 |
| COG2986 | Histidine ammonia-lyase | Amino acid transport and metabolism [E] | 19.42 |
| COG0002 | N-acetyl-gamma-glutamylphosphate reductase | Amino acid transport and metabolism [E] | 3.88 |
| COG0136 | Aspartate-semialdehyde dehydrogenase | Amino acid transport and metabolism [E] | 3.88 |
| COG2987 | Urocanate hydratase | Amino acid transport and metabolism [E] | 1.94 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.32 |
| COG0544 | FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) | Posttranslational modification, protein turnover, chaperones [O] | 0.32 |
| COG1664 | Cytoskeletal protein CcmA, bactofilin family | Cytoskeleton [Z] | 0.32 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.77 % |
| Unclassified | root | N/A | 3.23 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_16655817 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1836 | Open in IMG/M |
| 2088090014|GPIPI_16886434 | All Organisms → cellular organisms → Bacteria | 1511 | Open in IMG/M |
| 2088090014|GPIPI_17235342 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter | 1171 | Open in IMG/M |
| 2088090014|GPIPI_17430749 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 3397 | Open in IMG/M |
| 2166559005|cont_contig09369 | All Organisms → cellular organisms → Bacteria | 1635 | Open in IMG/M |
| 2170459003|FZN2CUW02J2ZJ1 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 536 | Open in IMG/M |
| 2170459005|F1BAP7Q02HB8PD | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 535 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100790382 | All Organisms → cellular organisms → Bacteria | 1183 | Open in IMG/M |
| 3300000550|F24TB_12110205 | All Organisms → cellular organisms → Bacteria | 1273 | Open in IMG/M |
| 3300000559|F14TC_101256187 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 516 | Open in IMG/M |
| 3300000596|KanNP_Total_noBrdU_T14TCDRAFT_1032295 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 581 | Open in IMG/M |
| 3300000955|JGI1027J12803_100460619 | All Organisms → cellular organisms → Bacteria | 1285 | Open in IMG/M |
| 3300000955|JGI1027J12803_101243898 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1638 | Open in IMG/M |
| 3300000956|JGI10216J12902_108057555 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101483054 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 573 | Open in IMG/M |
| 3300002896|JGI24802J43972_1014069 | Not Available | 613 | Open in IMG/M |
| 3300002899|JGIcombinedJ43975_10009135 | All Organisms → cellular organisms → Bacteria | 1597 | Open in IMG/M |
| 3300002899|JGIcombinedJ43975_10047521 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300002914|JGI25617J43924_10327115 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 530 | Open in IMG/M |
| 3300004114|Ga0062593_100068687 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2328 | Open in IMG/M |
| 3300004268|Ga0066398_10182992 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 544 | Open in IMG/M |
| 3300004479|Ga0062595_100561984 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300005093|Ga0062594_101470459 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300005166|Ga0066674_10016447 | All Organisms → cellular organisms → Bacteria | 3141 | Open in IMG/M |
| 3300005166|Ga0066674_10108824 | All Organisms → cellular organisms → Bacteria | 1290 | Open in IMG/M |
| 3300005166|Ga0066674_10571405 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 501 | Open in IMG/M |
| 3300005167|Ga0066672_10025304 | All Organisms → cellular organisms → Bacteria | 3170 | Open in IMG/M |
| 3300005167|Ga0066672_10187563 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1313 | Open in IMG/M |
| 3300005167|Ga0066672_10251393 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
| 3300005167|Ga0066672_10414839 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300005171|Ga0066677_10169168 | All Organisms → cellular organisms → Bacteria | 1208 | Open in IMG/M |
| 3300005171|Ga0066677_10253858 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
| 3300005171|Ga0066677_10405756 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 779 | Open in IMG/M |
| 3300005171|Ga0066677_10538539 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 669 | Open in IMG/M |
| 3300005172|Ga0066683_10031431 | All Organisms → cellular organisms → Bacteria | 3061 | Open in IMG/M |
| 3300005175|Ga0066673_10181287 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1190 | Open in IMG/M |
| 3300005175|Ga0066673_10429975 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300005175|Ga0066673_10519972 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 699 | Open in IMG/M |
| 3300005175|Ga0066673_10675984 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 596 | Open in IMG/M |
| 3300005176|Ga0066679_10993193 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300005180|Ga0066685_10672421 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 712 | Open in IMG/M |
| 3300005180|Ga0066685_10733080 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 675 | Open in IMG/M |
| 3300005180|Ga0066685_10892850 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 594 | Open in IMG/M |
| 3300005181|Ga0066678_10140330 | All Organisms → cellular organisms → Bacteria | 1503 | Open in IMG/M |
| 3300005181|Ga0066678_10724815 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 661 | Open in IMG/M |
| 3300005181|Ga0066678_10853893 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 598 | Open in IMG/M |
| 3300005186|Ga0066676_10279528 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1098 | Open in IMG/M |
| 3300005186|Ga0066676_10843273 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300005186|Ga0066676_10909526 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300005187|Ga0066675_11125590 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300005187|Ga0066675_11378345 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 517 | Open in IMG/M |
| 3300005288|Ga0065714_10377861 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 609 | Open in IMG/M |
| 3300005289|Ga0065704_10206799 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
| 3300005290|Ga0065712_10126883 | All Organisms → cellular organisms → Bacteria | 1559 | Open in IMG/M |
| 3300005293|Ga0065715_11028666 | Not Available | 538 | Open in IMG/M |
| 3300005294|Ga0065705_11056853 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300005328|Ga0070676_10336323 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
| 3300005332|Ga0066388_100156753 | All Organisms → cellular organisms → Bacteria | 2862 | Open in IMG/M |
| 3300005332|Ga0066388_102045525 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
| 3300005332|Ga0066388_102466716 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
| 3300005332|Ga0066388_102560667 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 928 | Open in IMG/M |
| 3300005332|Ga0066388_104973633 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 675 | Open in IMG/M |
| 3300005332|Ga0066388_105047930 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300005332|Ga0066388_106142304 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 606 | Open in IMG/M |
| 3300005332|Ga0066388_106263957 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300005332|Ga0066388_107865498 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 533 | Open in IMG/M |
| 3300005335|Ga0070666_10877303 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 663 | Open in IMG/M |
| 3300005340|Ga0070689_101759428 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 565 | Open in IMG/M |
| 3300005347|Ga0070668_100049763 | All Organisms → cellular organisms → Bacteria | 3225 | Open in IMG/M |
| 3300005354|Ga0070675_101615203 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300005356|Ga0070674_102100296 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 515 | Open in IMG/M |
| 3300005364|Ga0070673_101773266 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 585 | Open in IMG/M |
| 3300005439|Ga0070711_100515425 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300005440|Ga0070705_100115997 | All Organisms → cellular organisms → Bacteria | 1720 | Open in IMG/M |
| 3300005440|Ga0070705_100344265 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
| 3300005440|Ga0070705_100395536 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300005440|Ga0070705_101486715 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300005447|Ga0066689_10145145 | All Organisms → cellular organisms → Bacteria | 1407 | Open in IMG/M |
| 3300005447|Ga0066689_10410987 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 846 | Open in IMG/M |
| 3300005447|Ga0066689_10731764 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 617 | Open in IMG/M |
| 3300005450|Ga0066682_10096234 | All Organisms → cellular organisms → Bacteria | 1854 | Open in IMG/M |
| 3300005450|Ga0066682_10097709 | All Organisms → cellular organisms → Bacteria | 1841 | Open in IMG/M |
| 3300005450|Ga0066682_10115189 | All Organisms → cellular organisms → Bacteria | 1697 | Open in IMG/M |
| 3300005450|Ga0066682_10821781 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300005451|Ga0066681_10384767 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 862 | Open in IMG/M |
| 3300005454|Ga0066687_10293147 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300005467|Ga0070706_100452584 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1195 | Open in IMG/M |
| 3300005526|Ga0073909_10316584 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 713 | Open in IMG/M |
| 3300005540|Ga0066697_10025810 | All Organisms → cellular organisms → Bacteria | 3227 | Open in IMG/M |
| 3300005540|Ga0066697_10056061 | All Organisms → cellular organisms → Bacteria | 2241 | Open in IMG/M |
| 3300005540|Ga0066697_10732578 | Not Available | 539 | Open in IMG/M |
| 3300005548|Ga0070665_101812113 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 617 | Open in IMG/M |
| 3300005555|Ga0066692_10013735 | All Organisms → cellular organisms → Bacteria | 3927 | Open in IMG/M |
| 3300005555|Ga0066692_10044845 | All Organisms → cellular organisms → Bacteria | 2430 | Open in IMG/M |
| 3300005556|Ga0066707_10310927 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1031 | Open in IMG/M |
| 3300005556|Ga0066707_10545214 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 749 | Open in IMG/M |
| 3300005557|Ga0066704_10341826 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| 3300005558|Ga0066698_10255956 | All Organisms → cellular organisms → Bacteria | 1208 | Open in IMG/M |
| 3300005559|Ga0066700_10067580 | All Organisms → cellular organisms → Bacteria | 2255 | Open in IMG/M |
| 3300005560|Ga0066670_10023777 | All Organisms → cellular organisms → Bacteria | 2893 | Open in IMG/M |
| 3300005560|Ga0066670_10570783 | Not Available | 690 | Open in IMG/M |
| 3300005561|Ga0066699_10180077 | All Organisms → cellular organisms → Bacteria | 1461 | Open in IMG/M |
| 3300005561|Ga0066699_10976979 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300005568|Ga0066703_10816405 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 533 | Open in IMG/M |
| 3300005569|Ga0066705_10554417 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300005569|Ga0066705_10642633 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 646 | Open in IMG/M |
| 3300005574|Ga0066694_10057782 | All Organisms → cellular organisms → Bacteria | 1774 | Open in IMG/M |
| 3300005576|Ga0066708_10720461 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 630 | Open in IMG/M |
| 3300005576|Ga0066708_10828464 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 579 | Open in IMG/M |
| 3300005576|Ga0066708_10847997 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300005587|Ga0066654_10746646 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 552 | Open in IMG/M |
| 3300005598|Ga0066706_10208348 | All Organisms → cellular organisms → Bacteria | 1505 | Open in IMG/M |
| 3300005607|Ga0070740_10022455 | All Organisms → cellular organisms → Bacteria | 3817 | Open in IMG/M |
| 3300005615|Ga0070702_100289094 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
| 3300005713|Ga0066905_100409548 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
| 3300005764|Ga0066903_100513370 | All Organisms → cellular organisms → Bacteria | 2037 | Open in IMG/M |
| 3300005764|Ga0066903_100580581 | All Organisms → cellular organisms → Bacteria | 1934 | Open in IMG/M |
| 3300005764|Ga0066903_100636430 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1860 | Open in IMG/M |
| 3300005764|Ga0066903_100890792 | All Organisms → cellular organisms → Bacteria | 1608 | Open in IMG/M |
| 3300005764|Ga0066903_105358869 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 677 | Open in IMG/M |
| 3300005764|Ga0066903_105915924 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 641 | Open in IMG/M |
| 3300005764|Ga0066903_106710119 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 599 | Open in IMG/M |
| 3300005937|Ga0081455_10069547 | All Organisms → cellular organisms → Bacteria | 2927 | Open in IMG/M |
| 3300005937|Ga0081455_10891359 | Not Available | 554 | Open in IMG/M |
| 3300005985|Ga0081539_10011078 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7205 | Open in IMG/M |
| 3300005985|Ga0081539_10195319 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300006032|Ga0066696_10383041 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 917 | Open in IMG/M |
| 3300006032|Ga0066696_10734706 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 632 | Open in IMG/M |
| 3300006034|Ga0066656_11110116 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300006046|Ga0066652_101633873 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 591 | Open in IMG/M |
| 3300006046|Ga0066652_101839622 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 546 | Open in IMG/M |
| 3300006049|Ga0075417_10713255 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 516 | Open in IMG/M |
| 3300006173|Ga0070716_101123303 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300006176|Ga0070765_100913136 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300006791|Ga0066653_10555228 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 581 | Open in IMG/M |
| 3300006794|Ga0066658_10314230 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300006796|Ga0066665_10808246 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 738 | Open in IMG/M |
| 3300006796|Ga0066665_10996134 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300006797|Ga0066659_10731145 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300006800|Ga0066660_10908899 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 716 | Open in IMG/M |
| 3300006800|Ga0066660_11013033 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300007255|Ga0099791_10055264 | All Organisms → cellular organisms → Bacteria | 1781 | Open in IMG/M |
| 3300007788|Ga0099795_10571440 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 535 | Open in IMG/M |
| 3300009012|Ga0066710_100837284 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1412 | Open in IMG/M |
| 3300009090|Ga0099827_10864097 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300009090|Ga0099827_11906582 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 518 | Open in IMG/M |
| 3300009137|Ga0066709_101692658 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300009143|Ga0099792_10334433 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300009176|Ga0105242_12093084 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 610 | Open in IMG/M |
| 3300009802|Ga0105073_1047827 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 558 | Open in IMG/M |
| 3300010046|Ga0126384_10208140 | All Organisms → cellular organisms → Bacteria | 1554 | Open in IMG/M |
| 3300010048|Ga0126373_10528256 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1226 | Open in IMG/M |
| 3300010048|Ga0126373_12818196 | Not Available | 543 | Open in IMG/M |
| 3300010154|Ga0127503_10927325 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300010321|Ga0134067_10443537 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300010326|Ga0134065_10073870 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1092 | Open in IMG/M |
| 3300010329|Ga0134111_10331969 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 639 | Open in IMG/M |
| 3300010333|Ga0134080_10075990 | All Organisms → cellular organisms → Bacteria | 1353 | Open in IMG/M |
| 3300010337|Ga0134062_10791947 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 506 | Open in IMG/M |
| 3300010361|Ga0126378_11978219 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300010362|Ga0126377_10783272 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
| 3300010366|Ga0126379_11023776 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300010366|Ga0126379_11354186 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300010373|Ga0134128_10494486 | All Organisms → cellular organisms → Bacteria | 1364 | Open in IMG/M |
| 3300010376|Ga0126381_101160862 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1116 | Open in IMG/M |
| 3300010376|Ga0126381_101458146 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 989 | Open in IMG/M |
| 3300010398|Ga0126383_11208001 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300011000|Ga0138513_100048713 | Not Available | 641 | Open in IMG/M |
| 3300012198|Ga0137364_10986459 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300012200|Ga0137382_10116541 | All Organisms → cellular organisms → Bacteria | 1780 | Open in IMG/M |
| 3300012200|Ga0137382_10136828 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter | 1650 | Open in IMG/M |
| 3300012201|Ga0137365_10783547 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 696 | Open in IMG/M |
| 3300012202|Ga0137363_10793850 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300012202|Ga0137363_11562910 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300012204|Ga0137374_10031892 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 5747 | Open in IMG/M |
| 3300012204|Ga0137374_10053439 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 4132 | Open in IMG/M |
| 3300012207|Ga0137381_10178174 | All Organisms → cellular organisms → Bacteria | 1838 | Open in IMG/M |
| 3300012207|Ga0137381_10394739 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter | 1207 | Open in IMG/M |
| 3300012207|Ga0137381_11036825 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300012208|Ga0137376_10205559 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1704 | Open in IMG/M |
| 3300012211|Ga0137377_10274120 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1619 | Open in IMG/M |
| 3300012211|Ga0137377_10371237 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria | 1368 | Open in IMG/M |
| 3300012349|Ga0137387_11237167 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300012350|Ga0137372_10130884 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae | 2068 | Open in IMG/M |
| 3300012350|Ga0137372_11208174 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 510 | Open in IMG/M |
| 3300012354|Ga0137366_10600731 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300012354|Ga0137366_10869887 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 636 | Open in IMG/M |
| 3300012354|Ga0137366_10985701 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300012355|Ga0137369_10480140 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300012356|Ga0137371_10288930 | All Organisms → cellular organisms → Bacteria | 1278 | Open in IMG/M |
| 3300012361|Ga0137360_10919199 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 754 | Open in IMG/M |
| 3300012361|Ga0137360_10925890 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300012362|Ga0137361_10609978 | All Organisms → cellular organisms → Bacteria | 1000 | Open in IMG/M |
| 3300012387|Ga0134030_1023749 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 624 | Open in IMG/M |
| 3300012393|Ga0134052_1050323 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 555 | Open in IMG/M |
| 3300012484|Ga0157333_1022433 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 573 | Open in IMG/M |
| 3300012907|Ga0157283_10308393 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300012918|Ga0137396_10427759 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300012923|Ga0137359_10650369 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300012927|Ga0137416_11206345 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 681 | Open in IMG/M |
| 3300012971|Ga0126369_11326579 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300012971|Ga0126369_13720989 | Not Available | 500 | Open in IMG/M |
| 3300012985|Ga0164308_10502216 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300014150|Ga0134081_10295331 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 580 | Open in IMG/M |
| 3300014157|Ga0134078_10347069 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 652 | Open in IMG/M |
| 3300014325|Ga0163163_10868939 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300014969|Ga0157376_11127949 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300015264|Ga0137403_11269779 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 582 | Open in IMG/M |
| 3300015264|Ga0137403_11562588 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 512 | Open in IMG/M |
| 3300015357|Ga0134072_10069610 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1021 | Open in IMG/M |
| 3300015358|Ga0134089_10335075 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300016270|Ga0182036_11547940 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 557 | Open in IMG/M |
| 3300016270|Ga0182036_11578135 | Not Available | 552 | Open in IMG/M |
| 3300016319|Ga0182033_11344134 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 643 | Open in IMG/M |
| 3300016357|Ga0182032_11484946 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 588 | Open in IMG/M |
| 3300016445|Ga0182038_11064626 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300017792|Ga0163161_11500907 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 592 | Open in IMG/M |
| 3300017997|Ga0184610_1195490 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300018027|Ga0184605_10295035 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 735 | Open in IMG/M |
| 3300018027|Ga0184605_10378700 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300018028|Ga0184608_10051932 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1616 | Open in IMG/M |
| 3300018028|Ga0184608_10119931 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1114 | Open in IMG/M |
| 3300018028|Ga0184608_10175947 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300018028|Ga0184608_10233977 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 808 | Open in IMG/M |
| 3300018028|Ga0184608_10304057 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300018051|Ga0184620_10140472 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 775 | Open in IMG/M |
| 3300018054|Ga0184621_10046423 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1438 | Open in IMG/M |
| 3300018054|Ga0184621_10110248 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300018054|Ga0184621_10239875 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300018056|Ga0184623_10339926 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300018066|Ga0184617_1202204 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300018076|Ga0184609_10026632 | All Organisms → cellular organisms → Bacteria | 2344 | Open in IMG/M |
| 3300018078|Ga0184612_10603945 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 520 | Open in IMG/M |
| 3300018081|Ga0184625_10634829 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 519 | Open in IMG/M |
| 3300018468|Ga0066662_12041873 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300018482|Ga0066669_11494500 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300019269|Ga0184644_1717413 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300019789|Ga0137408_1192720 | All Organisms → cellular organisms → Bacteria | 2094 | Open in IMG/M |
| 3300019868|Ga0193720_1055272 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 554 | Open in IMG/M |
| 3300019878|Ga0193715_1003225 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 3543 | Open in IMG/M |
| 3300019878|Ga0193715_1109545 | Not Available | 544 | Open in IMG/M |
| 3300019879|Ga0193723_1001842 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 8008 | Open in IMG/M |
| 3300019879|Ga0193723_1021112 | All Organisms → cellular organisms → Bacteria | 1997 | Open in IMG/M |
| 3300019882|Ga0193713_1068140 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
| 3300019884|Ga0193741_1113880 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300019886|Ga0193727_1013376 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae | 3088 | Open in IMG/M |
| 3300019886|Ga0193727_1062717 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1168 | Open in IMG/M |
| 3300019886|Ga0193727_1068313 | All Organisms → cellular organisms → Bacteria | 1104 | Open in IMG/M |
| 3300019888|Ga0193751_1005615 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 7013 | Open in IMG/M |
| 3300019889|Ga0193743_1190995 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300020006|Ga0193735_1081694 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300020008|Ga0193757_1030687 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 530 | Open in IMG/M |
| 3300020018|Ga0193721_1037791 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
| 3300020018|Ga0193721_1085160 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300020021|Ga0193726_1264736 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300020062|Ga0193724_1098573 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 594 | Open in IMG/M |
| 3300021411|Ga0193709_1005644 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 3200 | Open in IMG/M |
| 3300021560|Ga0126371_11797192 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300022195|Ga0222625_1478483 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300022195|Ga0222625_1478483 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300022534|Ga0224452_1086607 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300022534|Ga0224452_1191262 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300022694|Ga0222623_10133034 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 969 | Open in IMG/M |
| 3300022892|Ga0247753_1054359 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 521 | Open in IMG/M |
| 3300025904|Ga0207647_10388940 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300025907|Ga0207645_10003779 | All Organisms → cellular organisms → Bacteria | 11366 | Open in IMG/M |
| 3300025918|Ga0207662_11140489 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300025922|Ga0207646_10515552 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
| 3300025944|Ga0207661_11174780 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300025972|Ga0207668_10091820 | All Organisms → cellular organisms → Bacteria | 2233 | Open in IMG/M |
| 3300026285|Ga0209438_1178065 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 561 | Open in IMG/M |
| 3300026307|Ga0209469_1092148 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300026316|Ga0209155_1008062 | All Organisms → cellular organisms → Bacteria | 4646 | Open in IMG/M |
| 3300026316|Ga0209155_1011691 | All Organisms → cellular organisms → Bacteria | 3815 | Open in IMG/M |
| 3300026323|Ga0209472_1239381 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300026324|Ga0209470_1057537 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1851 | Open in IMG/M |
| 3300026325|Ga0209152_10481202 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 507 | Open in IMG/M |
| 3300026326|Ga0209801_1228960 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 723 | Open in IMG/M |
| 3300026329|Ga0209375_1095397 | All Organisms → cellular organisms → Bacteria | 1347 | Open in IMG/M |
| 3300026332|Ga0209803_1232632 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300026343|Ga0209159_1118571 | All Organisms → cellular organisms → Bacteria | 1120 | Open in IMG/M |
| 3300026524|Ga0209690_1308188 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300026538|Ga0209056_10722861 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300026547|Ga0209156_10002818 | All Organisms → cellular organisms → Bacteria | 13460 | Open in IMG/M |
| 3300026547|Ga0209156_10031141 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Silvibacterium → Silvibacterium bohemicum | 3028 | Open in IMG/M |
| 3300026551|Ga0209648_10532497 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 664 | Open in IMG/M |
| 3300026693|Ga0208709_104392 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 587 | Open in IMG/M |
| 3300027663|Ga0208990_1136439 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 657 | Open in IMG/M |
| 3300027903|Ga0209488_10985268 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 585 | Open in IMG/M |
| 3300028379|Ga0268266_11363307 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300028814|Ga0307302_10271513 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 832 | Open in IMG/M |
| 3300028814|Ga0307302_10507971 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 599 | Open in IMG/M |
| 3300028878|Ga0307278_10049036 | All Organisms → cellular organisms → Bacteria | 1914 | Open in IMG/M |
| 3300028881|Ga0307277_10171277 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
| 3300030848|Ga0075388_11655136 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 646 | Open in IMG/M |
| 3300030937|Ga0138302_1848989 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 593 | Open in IMG/M |
| 3300030962|Ga0138297_1273981 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 508 | Open in IMG/M |
| 3300031022|Ga0138301_1485110 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 547 | Open in IMG/M |
| 3300031057|Ga0170834_102941744 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 693 | Open in IMG/M |
| 3300031114|Ga0308187_10197300 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 702 | Open in IMG/M |
| 3300031446|Ga0170820_14623937 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 606 | Open in IMG/M |
| 3300031446|Ga0170820_16502816 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 722 | Open in IMG/M |
| 3300031740|Ga0307468_101290518 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 664 | Open in IMG/M |
| 3300031740|Ga0307468_102504877 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300031744|Ga0306918_10839662 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300032035|Ga0310911_10017129 | All Organisms → cellular organisms → Bacteria | 3418 | Open in IMG/M |
| 3300032180|Ga0307471_100424042 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales | 1464 | Open in IMG/M |
| 3300032180|Ga0307471_101818032 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300032180|Ga0307471_103699836 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 541 | Open in IMG/M |
| 3300032261|Ga0306920_100171497 | All Organisms → cellular organisms → Bacteria | 3234 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 27.10% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.71% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.81% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 5.48% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 4.52% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.19% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.55% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.90% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.26% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.61% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.61% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.29% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.29% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.97% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.97% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.97% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.65% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.65% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.65% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.65% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.32% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.32% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.32% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.32% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.32% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.32% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.32% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.32% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.32% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.32% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.32% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.32% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.32% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.32% |
| Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.32% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
| 2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000596 | Amended soil microbial communities from Kansas Great Prairies, USA - Total DNA no BrdU F1.4TC | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002896 | Soil microbial communities from Manhattan, Kansas, USA - Sample 300um Nextera | Environmental | Open in IMG/M |
| 3300002899 | Soil microbial communities from Manhattan, Kansas, USA - Combined assembly of Kansas soil 100-500um Nextera (ASSEMBLY_DATE=20140607) | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005607 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009802 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_50_60 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011000 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012387 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012393 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012484 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.2.old.190510 | Environmental | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019269 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019868 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s1 | Environmental | Open in IMG/M |
| 3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300019884 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2 | Environmental | Open in IMG/M |
| 3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300019889 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2 | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300020008 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m2 | Environmental | Open in IMG/M |
| 3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
| 3300021411 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3c2 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300022892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S169-409R-5 | Environmental | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026693 | Grasslands soil microbial communities from Kansas, USA, that are Nitrogen fertilized - NN595 (SPAdes) | Environmental | Open in IMG/M |
| 3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300030848 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030937 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300030962 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300031022 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_03105550 | 2088090014 | Soil | AIMIVAVLATALSFGACAQKKETVTTSAGTTGYSK |
| GPIPI_02477490 | 2088090014 | Soil | MKTIMIVALLVTALGLGACAQHKEAVTTTAGTTGYAK |
| GPIPI_02249090 | 2088090014 | Soil | LKFVKAIMIVAVLATALSFGACAQRKETVTTSAGTTGYAK |
| GPIPI_03777820 | 2088090014 | Soil | MKFLKAIMIVAVLVTALGLGSCAKKEETVTHTAGTTGYSK |
| cont_0369.00001150 | 2166559005 | Simulated | LKFFKVIMIVAVLATALSFGACAQHKETVTTGAGTTGYSK |
| E4A_08261290 | 2170459003 | Grass Soil | FKVIMIVAVLATALSFGACAQHKETVTTGAGTTGYSK |
| E41_00925390 | 2170459005 | Grass Soil | LKLIKAIMIVAILATALSFGACAQRKETVTTSAGTTGYHK |
| INPhiseqgaiiFebDRAFT_1007903822 | 3300000364 | Soil | VKFMKMIMIVAXLVTALGLGACAQHKEAVTTTAGTTGYAK* |
| F24TB_121102053 | 3300000550 | Soil | LKFVKIMMLVALLVTALGLGACAQHKETAVTTGAGTTGYAK* |
| F14TC_1012561872 | 3300000559 | Soil | MKTIMIVALLVTALGLGACAQHKEAVTTTAGTTGYAK* |
| KanNP_Total_noBrdU_T14TCDRAFT_10322952 | 3300000596 | Soil | LKLLRLIMIVAVLATALSFGACAQHKETVTTGAGTTGYAK* |
| JGI1027J12803_1004606191 | 3300000955 | Soil | LKLLQAIMIVVILAATLSFGACAQHKEATVTTSAGTTGYAK* |
| JGI1027J12803_1012438982 | 3300000955 | Soil | LKFLKAIMIVAVLATALSFGACAQKKEAVTTTAGTTGYAK* |
| JGI10216J12902_1080575552 | 3300000956 | Soil | LRFVKVMMIVALLVTALGLGACAQHKETVTTGAGTTGYAK* |
| JGIcombinedJ26739_1014830541 | 3300002245 | Forest Soil | LKFFKVIMIVAVLATALSFGACAQKKETVTTGAGTTGYSK* |
| JGI24802J43972_10140691 | 3300002896 | Soil | MKFLKTIMIVAVLVTALGLGACAKKEETMTTTAGTTGYAK* |
| JGIcombinedJ43975_100091351 | 3300002899 | Soil | LKFLKAIMIVAVLVTALGLGSCAKKEETVTTTAGTTGYAK* |
| JGIcombinedJ43975_100475212 | 3300002899 | Soil | LKLLRLIMIVAVLATALSFGACAQHKETVTTGAGTTGYSK* |
| JGI25617J43924_103271152 | 3300002914 | Grasslands Soil | LKFVKAIMIVTVLATALSFGACAQRKETVTTSAGTTGYAK* |
| Ga0062593_1000686873 | 3300004114 | Soil | VKFMKMIMIVALLVTALGLGACAQHKEAVTTTAGTTGYAK* |
| Ga0066398_101829921 | 3300004268 | Tropical Forest Soil | KLIKAIMIVAVLATALSFGACAQRKETVTTSAGTTGYHK* |
| Ga0062595_1005619841 | 3300004479 | Soil | MKFLKAIMFVAVLVTALGLGSCAKKEETVTTTAGTTGYSK* |
| Ga0062594_1014704591 | 3300005093 | Soil | MKFLKAIMIMAVLVTALGLGSCAKKEETVTHTAGTTGYSK* |
| Ga0066674_100164471 | 3300005166 | Soil | VKFVKMIMVVAVLVTSLGLGACAKKQETMTTSAGTTGYSK* |
| Ga0066674_101088241 | 3300005166 | Soil | LKLLRAIMIVAILATALSFGACAQHKETVTTGAGTTGYAK* |
| Ga0066674_105714052 | 3300005166 | Soil | LKFLKAIMIVAILATALSFGACSQRKETVTTSAGTTGYAK* |
| Ga0066672_100253044 | 3300005167 | Soil | LKLLRAIMIVAVLATALSFGACAQHKETVTTGAGTTGYAK* |
| Ga0066672_101875632 | 3300005167 | Soil | LKLIKAIMIVAVLATALSFGACSQKKETVTTSAGTTGYHK* |
| Ga0066672_102513932 | 3300005167 | Soil | VKFLKAIMIVAVLVTTLGLGACAKKQETMTTSAGTTGYSK* |
| Ga0066672_104148391 | 3300005167 | Soil | VKFMKTIMIVALLATALGLGACAQHKEAVTTGAGTTGYAK* |
| Ga0066677_101691682 | 3300005171 | Soil | VKFIKMIMIVTLLVTALGLGACAQHKEAVTTGAATTGYAK* |
| Ga0066677_102538581 | 3300005171 | Soil | LKLLRAIVIMAILATTLSFSACAQHKETVTTGAGTTGYAK* |
| Ga0066677_104057561 | 3300005171 | Soil | LKFIKAIMIVAVLATALSFGACAQRKEAVTTSAGTTGYSK* |
| Ga0066677_105385391 | 3300005171 | Soil | MKFLKAIMIVAVLVTTLGLGACAKKQETMTTSAGTTGYSK* |
| Ga0066683_100314312 | 3300005172 | Soil | LKLLRAIVIVAILATALSFGACAQHKETVTTGAGTTGYAK* |
| Ga0066673_101812873 | 3300005175 | Soil | VKLMKTIMIVALLVTALGLGACAQHKEAVTTGAGTTGYAK* |
| Ga0066673_104299752 | 3300005175 | Soil | VRFLKAIMIVAVLVTTLGLGACAKKQETMTTSAGTTGYSK* |
| Ga0066673_105199722 | 3300005175 | Soil | LKFLKVIMIVAVLATALSFGACAQRKETVTTGAGTTGYSK* |
| Ga0066673_106759841 | 3300005175 | Soil | LKFVKVMMIVALLATALGLGACAQHKEAVTTGAATTGYAK* |
| Ga0066679_109931931 | 3300005176 | Soil | MKFVKMIMIVTLLVTALGLGACAQHKEAVTTGAGTTGYAK* |
| Ga0066685_106724211 | 3300005180 | Soil | LKLLRGILIVAVLATALTFGACAQRKETVTTSAGTTGYSK* |
| Ga0066685_107330801 | 3300005180 | Soil | ERRRDKLKLLRAIVIVAILATALSFGACAQHKETVTTGAGTTGYAK* |
| Ga0066685_108928502 | 3300005180 | Soil | LKFLRAILIVAVLATALSFGACAQRKEAVTTSAGTTGYAK* |
| Ga0066678_101403304 | 3300005181 | Soil | LKFLKAIMIVAVLVTALGLGACAKKQETVTTSAGTTGYSK* |
| Ga0066678_107248152 | 3300005181 | Soil | VRFFKMIMIVAVLVTALELGACAKKQETMTTSAGTTGYSK* |
| Ga0066678_108538931 | 3300005181 | Soil | LKFVKAILVVAVLATALSFGACAQRKETVTTGAGTTGYAK* |
| Ga0066676_102795282 | 3300005186 | Soil | LKFVKAILVVAVLATALSFGACAQRKETVTTSAGTTGYAK* |
| Ga0066676_108432732 | 3300005186 | Soil | MKFLKAIMIVAVLVTTLGLGACAKKQETMTTTAGTTGYAK* |
| Ga0066676_109095262 | 3300005186 | Soil | VKFLKAIIIVAVLVTTLGLGACAKKQETMTTSAGTTGYSK* |
| Ga0066675_111255901 | 3300005187 | Soil | LKFLKAIMIMALLAGALSLGACAHKQETTTTSAGTTTGYSK* |
| Ga0066675_113783451 | 3300005187 | Soil | LKQLLKAIVIVAVLATALSFGACAQRKETVTTGAGTTGYSK* |
| Ga0065714_103778612 | 3300005288 | Miscanthus Rhizosphere | LKLIKAIMIVAILATALSFGACAQRKETVTTSAGTTGYHK* |
| Ga0065704_102067991 | 3300005289 | Switchgrass Rhizosphere | LKQLLKAIMIVAVLATALSFGACSQRKETVTTSAGTTGYHK* |
| Ga0065712_101268833 | 3300005290 | Miscanthus Rhizosphere | VKFVKIMMVVTLLVTALGLGACAQHKETVTTGAGTTGYAK* |
| Ga0065715_110286661 | 3300005293 | Miscanthus Rhizosphere | VKFLKAIMIVALLVTTLELGACAKKQETVTTSAGTTGYSK* |
| Ga0065705_110568532 | 3300005294 | Switchgrass Rhizosphere | MKFLKAMMIVAVLVTALGLGACAKKEETVTTTAGTTGYAK* |
| Ga0070676_103363231 | 3300005328 | Miscanthus Rhizosphere | LKLFRLIMIVAVLATALSFGACAQHKETVTTGAGTTGYSK* |
| Ga0066388_1001567532 | 3300005332 | Tropical Forest Soil | LKFVKVMTIVALLVTALGLGACAQKKETVTTTGAGTTGYAK* |
| Ga0066388_1020455251 | 3300005332 | Tropical Forest Soil | LKFLKVFMIAALLATALGLGACAQQNKEAVTTTAGTTGYAK* |
| Ga0066388_1024667162 | 3300005332 | Tropical Forest Soil | LKLLRMIMIVAVLATALSFGACSQKKETVTTSAGTTGYHK* |
| Ga0066388_1025606672 | 3300005332 | Tropical Forest Soil | LKLLRLIMIVAVLATALSFGACAQHKETVTTGAGTTGYHK* |
| Ga0066388_1049736333 | 3300005332 | Tropical Forest Soil | LKQLLKAIMIVAVLAITLSFGACAQKKETVTTSAGTTGYSK* |
| Ga0066388_1050479302 | 3300005332 | Tropical Forest Soil | LKLLRLIMIVAVLATALTFGACAQHKETVTTGAGTTGYSK* |
| Ga0066388_1061423041 | 3300005332 | Tropical Forest Soil | ERRRDRLKLIKAIMIVAVLATALSFGACAQRKETVTTSAGTTGYHK* |
| Ga0066388_1062639572 | 3300005332 | Tropical Forest Soil | LKFAKMMMVVALLVTALGLGACAQQKKEVVTTGAGTTGYAK* |
| Ga0066388_1078654982 | 3300005332 | Tropical Forest Soil | LKFLRVIMIVAVLATALSFGACSQKKETVTTGAGVTGYAK* |
| Ga0070666_108773032 | 3300005335 | Switchgrass Rhizosphere | LKQFIKAMMIVAVLATALSFGACAQKKETVTTSAGTTGYSK* |
| Ga0070689_1017594281 | 3300005340 | Switchgrass Rhizosphere | LKLIKAIMIVAVLATALTFGACAQRKETVTTSAGTTGYHK* |
| Ga0070668_1000497633 | 3300005347 | Switchgrass Rhizosphere | LKQFLKAIMIVAVLATALSFGACSQRKETVTTSAGTTGYHK* |
| Ga0070675_1016152032 | 3300005354 | Miscanthus Rhizosphere | VKFMKMIMIVALLVTALGLGACAQHKEAVTTSAGTTGYAK* |
| Ga0070674_1021002961 | 3300005356 | Miscanthus Rhizosphere | MKFLKAIMIMAVLVTALGLESCAKKEETVTHTAGTTGYSK* |
| Ga0070673_1017732661 | 3300005364 | Switchgrass Rhizosphere | LKQLLKAILIVAVLATALSFDACAQKKETVTTSAGTTGYSK* |
| Ga0070711_1005154252 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VKFVKLMMVVALLVTALGLGACAQHKETVTTGAGTTGYAK* |
| Ga0070705_1001159973 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | VKFVKMIMVVALLVTALGLGACAQHKETVTTGAGTTGYAK* |
| Ga0070705_1003442652 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | LKFFKVIMIVAVLATALSFGACAQHKETVTTGAGTTGYSK* |
| Ga0070705_1003955361 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | VKFMKMIMIVALLVTALGLGACAQHKEAAVTTTAGTTGYAK* |
| Ga0070705_1014867151 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | LKLLKTIMVVAILATALSFGACAQHKETVTTSAGTTGYAK* |
| Ga0066689_101451453 | 3300005447 | Soil | MKFLKAIMIVAVLVTALGLGACAKKQETVTTSAGTTGYSK* |
| Ga0066689_104109873 | 3300005447 | Soil | VKFLKAIMIVAVLVTALELGACAKKQETMTTSAGTTGYSK* |
| Ga0066689_107317642 | 3300005447 | Soil | LKLLRAIVIVAVLATALSFGACAQHKETVTTGAGTTGYAK* |
| Ga0066682_100962343 | 3300005450 | Soil | VKFMKTIMIVALLVTALGLGACAQHKEAVTTSAGTTGYAK* |
| Ga0066682_100977092 | 3300005450 | Soil | LKILRAIMIVAILATALSFGACAQHKETVTTGAGTTGYAK* |
| Ga0066682_101151893 | 3300005450 | Soil | VRFLKAIMIVAVLVTTLGLGACAKKQETMTTTAGTTGYAK* |
| Ga0066682_108217812 | 3300005450 | Soil | MKFLKAIMIVAVLVTALGLGACAKKEETMTTSAGTTGYSK* |
| Ga0066681_103847672 | 3300005451 | Soil | LKFLKAIMIVAVMATALSFGACAQHKETVTTGAGTTGYAK* |
| Ga0066687_102931471 | 3300005454 | Soil | LKLLRAIVIMAILATTLSFGACAQHKETVTTGAGTTGYAK* |
| Ga0070706_1004525843 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VKFMKTIMIVALLVTALGLGACAQHKEAVTTTAGTTGYSK* |
| Ga0073909_103165842 | 3300005526 | Surface Soil | LKLIKAIMIVAVLATALSFGACAQRKETVTTSAGTTGYHK* |
| Ga0066697_100258104 | 3300005540 | Soil | LKFVKVMMIVALLVTALGLGACAQRKETVTTGAGTTGYAK* |
| Ga0066697_100560613 | 3300005540 | Soil | MIVVILATALSFGACAQHKEATVTTSAGTTGYAK* |
| Ga0066697_107325781 | 3300005540 | Soil | TCLERRRDRVKLMKTIMIVALLVTALGLGACAQHKEAVTTGAGTTGYAK* |
| Ga0070665_1018121131 | 3300005548 | Switchgrass Rhizosphere | KAIMIVAVLATALSFGACAQRKETVTTSAGTTGYSK* |
| Ga0066692_100137351 | 3300005555 | Soil | RLKLIKAIMIVAVLATALSFGACSQKKETVTTSAGTTGYHK* |
| Ga0066692_100448451 | 3300005555 | Soil | ERRRDKLKLLRAIMIVAILATALSFGACAQHKETVTTGAGTTGYAK* |
| Ga0066707_103109273 | 3300005556 | Soil | LKFIKAIMIVAVLATALSFGACAQRKEAVTTSAGTTGY |
| Ga0066707_105452142 | 3300005556 | Soil | LKFVKAIMIVAVLATALSFGACAQRKETVTTGAGTTGYAK* |
| Ga0066704_103418261 | 3300005557 | Soil | LRAIMIVVILATALSFGACAQHKEATVTTSAGTTGYAK* |
| Ga0066698_102559563 | 3300005558 | Soil | MIVAVLATALSFGACAQRKETVTTGAGTTGLEVKSGA |
| Ga0066700_100675803 | 3300005559 | Soil | MIMIVAVLVTALELGACAKKQETMTTSAGTTGYSK* |
| Ga0066670_100237773 | 3300005560 | Soil | MIVVILATALSFGACAQHKEASVTTSAGTTGYAK* |
| Ga0066670_105707831 | 3300005560 | Soil | MKTIMIVALLVTALGLGACAQHKEAVTTGAGTTGYAK* |
| Ga0066699_101800773 | 3300005561 | Soil | LKFIKMIMIVTLLVTALGLGACAQHKEAVTTGAGTTGYAK* |
| Ga0066699_109769791 | 3300005561 | Soil | KMIMIVTLLVTALGLGACAQHKEAVTTGAATTGYAK* |
| Ga0066703_108164051 | 3300005568 | Soil | IMIVAVLATALSFGACAQHKETVTTGAGTTGYAK* |
| Ga0066705_105544172 | 3300005569 | Soil | LKFIKIMMIVALLATALGLGACAQHKEAVTTGAATTGYAK* |
| Ga0066705_106426332 | 3300005569 | Soil | AIMIVAILATALSFGACAQRKETVTTSAGTTGYSK* |
| Ga0066694_100577821 | 3300005574 | Soil | TCWERRRDRVKFVKMIMVVAVLVTSLGLGACAKKQETMTTSAGTTGYSK* |
| Ga0066708_107204611 | 3300005576 | Soil | LKFLKAIMIVAVLATALSFGACAQRKEAVTTSAGTTGYSK* |
| Ga0066708_108284642 | 3300005576 | Soil | LKFLRVIMIVAVLATAFSFGACAQRKETVTTGAGTTGYSK* |
| Ga0066708_108479972 | 3300005576 | Soil | RVKLMKTIMIVALLVTALGLGACAQHKEAVTTGAGTTGYAK* |
| Ga0066654_107466461 | 3300005587 | Soil | LKLIKAIMVVAVLATALSFGACAQRKETVTTSAGTTGYSK* |
| Ga0066706_102083483 | 3300005598 | Soil | LKFVKAIMIVAVLATALSFGACAQRKETVTTSAGTTGYAK* |
| Ga0070740_100224553 | 3300005607 | Surface Soil | LKLLKAILIVAVLATALSFGACAQRKETVTTSAGTTGYAK* |
| Ga0070702_1002890942 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | RLKQLLKAIMIVAVLATALSFGACSQRKETVTTSAGTTGYHK* |
| Ga0066905_1004095481 | 3300005713 | Tropical Forest Soil | LKLLRLIMIVAVTATALSFGACAQHKETVTTGAGTTGYSK* |
| Ga0066903_1005133702 | 3300005764 | Tropical Forest Soil | LKFAKMMMVVALLVTALGLGACAQQHKEAVTTGAATTGYAK* |
| Ga0066903_1005805814 | 3300005764 | Tropical Forest Soil | MIVAVLATALSFGACAQHKQETVTTSAAGTTGYAK* |
| Ga0066903_1006364303 | 3300005764 | Tropical Forest Soil | LKLLRTIMIVAVLVAALGLGACAQQKREVVTTSAGTTGYSK* |
| Ga0066903_1008907923 | 3300005764 | Tropical Forest Soil | LKLLRAIMIVVILAATLSFGACAQHKEATVTTSAGTTGYAK* |
| Ga0066903_1053588693 | 3300005764 | Tropical Forest Soil | LKQFVKAILIVAVLATALSFGACAQRKETVTTSAGTTGYSK* |
| Ga0066903_1059159241 | 3300005764 | Tropical Forest Soil | LKQLLKAIVIVAVLATALSFGACSQKKETVTTSAGTTGYSK* |
| Ga0066903_1067101192 | 3300005764 | Tropical Forest Soil | LKLLRAILIVAVLATALSFGACSQKKETVTTSAGTTGYSK* |
| Ga0081455_100695473 | 3300005937 | Tabebuia Heterophylla Rhizosphere | AILIVAVLATALSFGACAQRKETVTTSAGTTGYSK* |
| Ga0081455_108913591 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MKFLKAIMIVAVLVTALGLGACAKREETVTTTAGTTGYAK* |
| Ga0081539_100110785 | 3300005985 | Tabebuia Heterophylla Rhizosphere | LKFIKAIMIVAVLATALSFGACAQRKETVTTSAGSTGYSK* |
| Ga0081539_101953193 | 3300005985 | Tabebuia Heterophylla Rhizosphere | LKFIKAIMIVAILATALSFGACAQRKETVTTSAGSTGYSK* |
| Ga0066696_103830411 | 3300006032 | Soil | MIVAVLATALSFGACAQRKETVTTGAGTTGYRSEVRRPIV |
| Ga0066696_107347061 | 3300006032 | Soil | VKLMKTIMIVALLVTALGLGACAQHKEAVTTSAGTTGYAK* |
| Ga0066656_111101162 | 3300006034 | Soil | LKFLKVIMIVAVLATALSFGACAQRKETVTTGAGTTGY |
| Ga0066652_1016338732 | 3300006046 | Soil | LKIIKAIMIMAILATALSFGACAQRKETVTTSAGTTGYSK* |
| Ga0066652_1018396222 | 3300006046 | Soil | LKQLLKAITIVAVLATALSFGACAQRKETVTTSAGTTGYSK* |
| Ga0075417_107132551 | 3300006049 | Populus Rhizosphere | LKLLRAIMIVVILATALSFGACAQHKETVTTGAGTTGYSK* |
| Ga0070716_1011233031 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VKFMKTIMIVALLVTALGLGACAQHKEAVTTTAGTTGYAK* |
| Ga0070765_1009131362 | 3300006176 | Soil | LKFVKAILIVAVLATALSFGACAQRKETVTTSAGTTGYAK* |
| Ga0066653_105552282 | 3300006791 | Soil | LKLLRAILIVAVLATALTFGACAQRKETVTTSAGTTGYSK* |
| Ga0066658_103142303 | 3300006794 | Soil | VKFIKMIMIVTLLVTALGLGACAQHKEAVTTGAGTTGYAK* |
| Ga0066665_108082462 | 3300006796 | Soil | LKQLLKAIVIVAVLATALSFGACAQRKETVTTSAGTTGYSK* |
| Ga0066665_109961342 | 3300006796 | Soil | MKFLKAIMIVAVLVTALRLGACAKKQETVTTSAGTTGYSK* |
| Ga0066659_107311452 | 3300006797 | Soil | MKFLKAIMIVAVLVTALGLGACAKKQETMTTSAGTTGYSK* |
| Ga0066660_109088992 | 3300006800 | Soil | LKIIKAIMIMAIMATALSFGACAQRKETVTTSAGTTGYSK* |
| Ga0066660_110130331 | 3300006800 | Soil | LKIFKVIMIVAVLATALSFGACAQHKETVTTGAGTTGYSK* |
| Ga0099791_100552642 | 3300007255 | Vadose Zone Soil | MKMIMIVALLVTALGLGACAQHKEAVTTSAGTTGYAK* |
| Ga0099795_105714402 | 3300007788 | Vadose Zone Soil | MKFFKVIMIVAVLATALSFGACAQHKETVTTGAGTTGYSK* |
| Ga0066710_1008372841 | 3300009012 | Grasslands Soil | LKFLKVIMIVAVLATALSFGACAQRKETVTTGAGTTGYSK |
| Ga0099827_108640971 | 3300009090 | Vadose Zone Soil | LLKAIVIVAVLATALSFGACAQRKEAVTTSAGTTGYSK* |
| Ga0099827_119065822 | 3300009090 | Vadose Zone Soil | GEKMRFFKMIMIVAVLVTALELGACAKKQETMTTSAGTTGYSK* |
| Ga0066709_1016926583 | 3300009137 | Grasslands Soil | MKTIMIVALLVTALGLGACAQHKEAVTTGAGTTGY |
| Ga0099792_103344331 | 3300009143 | Vadose Zone Soil | KAIMIVAVLATALSFGACAQRKETVTTTAGTTGYHK* |
| Ga0105242_120930841 | 3300009176 | Miscanthus Rhizosphere | LLKLLRLIMIVAVLATALSFGACAQRKETVTTGAGTTGYSK* |
| Ga0105073_10478271 | 3300009802 | Groundwater Sand | IMIVAVLVTALGLGSCAKKEETVTTTAGTTGYSK* |
| Ga0126384_102081402 | 3300010046 | Tropical Forest Soil | LRLIMIVAVLATALSFGACAQHKETVTTGAGTTGYSK* |
| Ga0126373_105282563 | 3300010048 | Tropical Forest Soil | IMIVAVLAITLSFGACAQKKETVTTSAGTTGYSK* |
| Ga0126373_128181961 | 3300010048 | Tropical Forest Soil | RLKLLRTIMIVAVLVTALGLGACAQQKREVVTTSAGTTGYSK* |
| Ga0127503_109273252 | 3300010154 | Soil | MKMIMIVALLVTALGLGACAQHKETAVTTTAGTTGYAK* |
| Ga0134067_104435371 | 3300010321 | Grasslands Soil | LKFVKVMMIVALLATALGLGACAQHKEAVTTGAATTG |
| Ga0134065_100738702 | 3300010326 | Grasslands Soil | MKTIMIVALLVTALGLGACAQHKEAVTTSAGTTGYAK* |
| Ga0134111_103319692 | 3300010329 | Grasslands Soil | IMIVAVLATALSFGAFAQHKETVTTGAGTTGYSK* |
| Ga0134080_100759902 | 3300010333 | Grasslands Soil | ETLKFLKAIMIVAILATALSFGACSQRKETVTTSAGTTGYAK* |
| Ga0134062_107919471 | 3300010337 | Grasslands Soil | RAIMIVAILATALSFGACAQHKETVTTGAGTTGYAK* |
| Ga0126378_119782192 | 3300010361 | Tropical Forest Soil | ERRRYKLKFAKMMMVVALLVTALGLGACAQQHKEAVTTGAATTGYAK* |
| Ga0126377_107832721 | 3300010362 | Tropical Forest Soil | LKQLLKAIVIVAVLATALSFGACSQKKEMTTTTAGTTGYSK* |
| Ga0126379_110237763 | 3300010366 | Tropical Forest Soil | MAIMIVAVLATALSFGACSQKKETTTTSAGTTGYSK* |
| Ga0126379_113541862 | 3300010366 | Tropical Forest Soil | RYKLKLFRAIMIVAVLATALSFGACSQKKETVTTGAGVTGYAK* |
| Ga0134128_104944862 | 3300010373 | Terrestrial Soil | MKFLKAIMIMAVLVTALGLGACAKKEETVTHTAGTTGYSK* |
| Ga0126381_1011608622 | 3300010376 | Tropical Forest Soil | MKAILIVAVLATALSFGACAQKKETVTTSAGTTGYSK* |
| Ga0126381_1014581461 | 3300010376 | Tropical Forest Soil | LKQLLKAIVIVAVLATALSFGACSQKKEMTTTTNAGTTGYSK* |
| Ga0126383_112080012 | 3300010398 | Tropical Forest Soil | AIMIVAVLATALSFGACAQKKETVTTSAGTTGYSK* |
| Ga0138513_1000487132 | 3300011000 | Soil | MKFLKAMMIVAVLVTALGLGACAKKEETMTTTAGTTGYSK* |
| Ga0137364_109864592 | 3300012198 | Vadose Zone Soil | MKFLKAMMIVAVLVTALGLGACAKKEETMTTSAGTTGYSK* |
| Ga0137382_101165413 | 3300012200 | Vadose Zone Soil | VNFLKAIMIVAVLVTTLGLGACAKKQETMTTTAGTTGYAK* |
| Ga0137382_101368283 | 3300012200 | Vadose Zone Soil | RDRVKFMKTIMIVALLATALGLGACAQHKEAVTTSAGTTGYAK* |
| Ga0137365_107835471 | 3300012201 | Vadose Zone Soil | FLKAIMIVAVLVTTLGLGACAKKQETMTTTAGTTGYAK* |
| Ga0137363_107938502 | 3300012202 | Vadose Zone Soil | LKFIKAILIVAVLATALSFGACAQRKETVTTSAGT |
| Ga0137363_115629102 | 3300012202 | Vadose Zone Soil | MKTIMIVALLITALGLGACAQHKEPVTTTAGTTGYAK* |
| Ga0137374_100318924 | 3300012204 | Vadose Zone Soil | MKFLKAIMIVAVLITALGLGACAKKEETVTTSAGTTGYSK* |
| Ga0137374_100534395 | 3300012204 | Vadose Zone Soil | MKFLKTMMIVAVLVTALGLGACAKKEETVTTSAGTTGYAK* |
| Ga0137381_101781741 | 3300012207 | Vadose Zone Soil | IMIVAVLASALSLGACAQHKETVTTGAGTTGYAK* |
| Ga0137381_103947392 | 3300012207 | Vadose Zone Soil | MKTIMIVALLATALGLGACAQHKEAVTTGAGTTGYAK* |
| Ga0137381_110368251 | 3300012207 | Vadose Zone Soil | LKFLKAIMIVAILATALSLGACAQRKETVTTSAGT |
| Ga0137376_102055593 | 3300012208 | Vadose Zone Soil | MKFLKAIMFVAILITALGLGSCAKKEETVTTTAGTTGYSK* |
| Ga0137377_102741203 | 3300012211 | Vadose Zone Soil | LKFLKAIMIVAILATALSFGACAQRKETVTTSAGTT |
| Ga0137377_103712373 | 3300012211 | Vadose Zone Soil | LKFIKAILIVAVLATALSFGACAQRKETVTTGAGT |
| Ga0137387_112371671 | 3300012349 | Vadose Zone Soil | GGEIELRFLKMMTIVAVLVSALRFGACAQRKQAPYTTTAGTTGYAK* |
| Ga0137372_101308843 | 3300012350 | Vadose Zone Soil | MKFLKAIMIVAVLVTALGLGACAKKEETVTTSAGTTGYSK* |
| Ga0137372_112081742 | 3300012350 | Vadose Zone Soil | LKFFKVIMIVAVLATALSFGACAQRKETVTTGAGTTGYS |
| Ga0137366_106007312 | 3300012354 | Vadose Zone Soil | LKFVKVMMIVALLVTALGLGACAQRKETVTTGAGTTGYA |
| Ga0137366_108698871 | 3300012354 | Vadose Zone Soil | AIMVVAVLASALSFGACAQRKETVTTSAGTTGYSK* |
| Ga0137366_109857011 | 3300012354 | Vadose Zone Soil | SNLLREEAKRVRFLKAIMIVAVLVTTLALGACAKKQETVTTTAGTTGYAK* |
| Ga0137369_104801401 | 3300012355 | Vadose Zone Soil | KFLRLIMIVAVLATALSFGDCAQHKETVTTGAGTTGYSK* |
| Ga0137371_102889301 | 3300012356 | Vadose Zone Soil | IMIVAVLVTTLGLGACAKKQETMTTTAGTTGYAK* |
| Ga0137360_109191991 | 3300012361 | Vadose Zone Soil | RRRDRVKFMKMIMIVALLVTALGLGACAQHKEAVTTSAGTTGYAK* |
| Ga0137360_109258901 | 3300012361 | Vadose Zone Soil | KLLKAIMIMALLAGALSLGACAHKQETTTTSAGTTTGYSK* |
| Ga0137361_106099784 | 3300012362 | Vadose Zone Soil | ERRRRRVKFLKAIMIVALLVTTLELGACAKKQETVTTSAGTTGYSK* |
| Ga0134030_10237491 | 3300012387 | Grasslands Soil | KLMKTIMIVALLVTALGLGACAQHKEAVTTSAGTTGYAK* |
| Ga0134052_10503231 | 3300012393 | Grasslands Soil | RDRLKFLKVIMIVAVLATALSFGACAQHKETVTTGAGTTGYSK* |
| Ga0157333_10224331 | 3300012484 | Soil | RLKQLLKAILIVAVLATALSFGACAQRKETVTTSAGTTGYHK* |
| Ga0157283_103083932 | 3300012907 | Soil | LKLIKAIMIVAVLATALSFGACAQRKETVTTSAGTTGYHK |
| Ga0137396_104277591 | 3300012918 | Vadose Zone Soil | KFFKVIMIVAVLATALSFGACAQHKETVTTGAGTTGYSK* |
| Ga0137359_106503691 | 3300012923 | Vadose Zone Soil | ERRRDNLKFLRVIMIVAVLATAFSFGACAQRKETVTTGAGTTGYSK* |
| Ga0137416_112063451 | 3300012927 | Vadose Zone Soil | KAIMIVAVLASALSLGACAQHKETVTTGAGTTGYAK* |
| Ga0126369_113265791 | 3300012971 | Tropical Forest Soil | MIMIVAVLATALSFGACAQKKETVTTSAGTTGYHK* |
| Ga0126369_137209891 | 3300012971 | Tropical Forest Soil | LKFLKVFMIAALLATTLGLGACAQQNKEAVTTTAGTTGYAK* |
| Ga0164308_105022161 | 3300012985 | Soil | IMIVAVLATALSFGACAQRKETVTTSAGTTGYHK* |
| Ga0134081_102953311 | 3300014150 | Grasslands Soil | KTIMIVALLVTALGLGACAQHKEAVTTGAGTTGYAK* |
| Ga0134078_103470691 | 3300014157 | Grasslands Soil | KFIKAIMIVAVLATALSFGACAQHKETVTTGAGTTGYAK* |
| Ga0163163_108689392 | 3300014325 | Switchgrass Rhizosphere | KQLLKAIMIVAVLATALSFGACSQRKETVTTSAGTTGYHK* |
| Ga0157376_111279491 | 3300014969 | Miscanthus Rhizosphere | RLKLIKAIMIVAILATALSFGACAQRKETVTTSAGTTGYHK* |
| Ga0137403_112697791 | 3300015264 | Vadose Zone Soil | LLRAIMIVAVLATALSFSACAQHKETVTTGAGTTGYAK* |
| Ga0137403_115625882 | 3300015264 | Vadose Zone Soil | LKFLKVIMIVAVLATALSFGACAQRKETVTTGAGT |
| Ga0134072_100696101 | 3300015357 | Grasslands Soil | LKFVKAILVVAVLATALSFGACAQRKETVTTGAGTTGY |
| Ga0134089_103350752 | 3300015358 | Grasslands Soil | VKFVKMIMVVAVLVTSLGLGACAKKQETMTTSAGTTGY |
| Ga0182036_115479402 | 3300016270 | Soil | LKFLKAIMIVAVLAAALSFGACSQKKETVTTSAGTTGYA |
| Ga0182036_115781352 | 3300016270 | Soil | MKAILIVAVLATALSFGACAQKKETVTTSAGTTGYSK |
| Ga0182033_113441342 | 3300016319 | Soil | LKQLLKAIVIVAVLATALSFGACSQKKETVTTSAGT |
| Ga0182032_114849461 | 3300016357 | Soil | KGGEMKLKLLRAIMIVAILASALSFGACAQHKEAVTTSAGTTGYAK |
| Ga0182038_110646261 | 3300016445 | Soil | LLRAIMIVAILASALSFGACAQHKEAVTTSAGTTGYAK |
| Ga0163161_115009071 | 3300017792 | Switchgrass Rhizosphere | EIDLKFFKVIMIVAVLATALSFGACAQHKETVTTGAGTTGYSK |
| Ga0184610_11954901 | 3300017997 | Groundwater Sediment | MKFLKTMMIVAVLVTALGLGACAKKQETVTTTAGTTGYSK |
| Ga0184605_102950352 | 3300018027 | Groundwater Sediment | MKFLKAMMIVAVLVTALGLGACAKKEETVSTTAGTTGYSK |
| Ga0184605_103787002 | 3300018027 | Groundwater Sediment | LKFLKAIMIVAVLASALSLGACAQHKETVTTGAGT |
| Ga0184608_100519322 | 3300018028 | Groundwater Sediment | MKFLKAIMIVAVLVTSLGLGACAKKEETVTTTAGTTGYAK |
| Ga0184608_101199312 | 3300018028 | Groundwater Sediment | MKFLKAMMIVAVLVTALGLGACAKKQETVTTTAGTTGYSK |
| Ga0184608_101759472 | 3300018028 | Groundwater Sediment | LKQLLKAMMIVAVLAIALSFGACAQRKETVTTSAGT |
| Ga0184608_102339772 | 3300018028 | Groundwater Sediment | MKFLKAIMIVAILVTTLGLGACAKKQETMTTSAGTTGYSK |
| Ga0184608_103040571 | 3300018028 | Groundwater Sediment | YRLKFLKMIMIVAVLASALSFGACAQHKEAVTTTAGTTGYAK |
| Ga0184620_101404722 | 3300018051 | Groundwater Sediment | LKFLKAMMVVAVLVTALGLGACAKKEETVTTTAGTTDYAK |
| Ga0184621_100464231 | 3300018054 | Groundwater Sediment | KAMMIVAVLVTALGLGACAKKEETVTTTAGTTGYAK |
| Ga0184621_101102482 | 3300018054 | Groundwater Sediment | AIMIVAVLASALSLGACAQHKETVTTGAGTTGYAK |
| Ga0184621_102398751 | 3300018054 | Groundwater Sediment | MKFLKAIMIVAVLVTSLGLGACAKKEETMTTTAGTTGYAK |
| Ga0184623_103399262 | 3300018056 | Groundwater Sediment | MKFLKAIMIVAVLVTALGLGACAKKEETVTTTAGTTGYAK |
| Ga0184617_12022042 | 3300018066 | Groundwater Sediment | MKFLKAIMIVAVLVTALGLGACAKKQETVTTTAGTTGYSK |
| Ga0184609_100266322 | 3300018076 | Groundwater Sediment | MKFLKAIMIVAVLVTTLGLGACAKKQETVTTTAGTTGYSK |
| Ga0184612_106039451 | 3300018078 | Groundwater Sediment | LKFLKMIVVMAVLATALSFGACAQRKETVTTSAGTTGYSK |
| Ga0184625_106348292 | 3300018081 | Groundwater Sediment | RYRLKLIKAIMIVAILATALSFGACAQRKETVTTSAGTTGYHK |
| Ga0066662_120418731 | 3300018468 | Grasslands Soil | MKTIMIVALLATALGLGACAQHKEAVTTGAGTTGYAK |
| Ga0066669_114945003 | 3300018482 | Grasslands Soil | ERRRDRVKLMKTIMIVALLVTALGLGACAQHKEAVTTGAGTTGYAK |
| Ga0184644_17174131 | 3300019269 | Groundwater Sediment | RRRRRMKFLKTIMIVAVLVITLGLGACAKKQETVTTTAGTTGYSK |
| Ga0137408_11927201 | 3300019789 | Vadose Zone Soil | RRDRVKFMKMIMIVALLVTALGLGACAQHKEAVTTSAGTTGYAK |
| Ga0193720_10552721 | 3300019868 | Soil | YRLKIVRTIMIMAILATALSFGACAQKKETVTTSAGTTGYSK |
| Ga0193715_10032252 | 3300019878 | Soil | MKFLKAIMIMAVLVTALGLGSCAKKEETVTHTAGTTGYSK |
| Ga0193715_11095451 | 3300019878 | Soil | LKFMKMIMIVTLLVTALGLGACAQKKEVVTTGAGTTGYSK |
| Ga0193723_10018424 | 3300019879 | Soil | MKMIMIVALLATALGLGACAQHKEAVTTTAGTTGYAK |
| Ga0193723_10211122 | 3300019879 | Soil | MKFLKAIMIVAVLVTALGLGACAKKQETVTTTAGTTGYAK |
| Ga0193713_10681401 | 3300019882 | Soil | VKAIMIVAVLAIALSFGACAQRKETVTTSAGTTGYAK |
| Ga0193741_11138802 | 3300019884 | Soil | LKQLLKAIIIVAVLATALSFGACAQRKETVTTSAGTTGY |
| Ga0193727_10133763 | 3300019886 | Soil | MKFLKTIMIVAVLVTALGLGACAKKEETMTTTAGTTGYAK |
| Ga0193727_10627173 | 3300019886 | Soil | LKFYKVIMIVAVLATALSFGACAQHKETVTTGAGTTGYS |
| Ga0193727_10683133 | 3300019886 | Soil | MKFLKAIMIVALLVTTLGLGACAKKQETVTTSAGTTGYSK |
| Ga0193751_10056153 | 3300019888 | Soil | MKFMKMIMIVTLLVTALGLGACAQHKETVTTGAGTTGYSK |
| Ga0193743_11909952 | 3300019889 | Soil | MKFLKAMMIVAVLVTALGLGACAKKQETMTTTAGTTGYSK |
| Ga0193735_10816943 | 3300020006 | Soil | MKFLKAIMIVAVLVTALGLGACAKKEETMTTSAGTTGYSK |
| Ga0193757_10306872 | 3300020008 | Soil | KAIMIVAVLATALSFGACAQRKETVTTSAGTTGYHK |
| Ga0193721_10377914 | 3300020018 | Soil | MKFLKAIMIVAVLVTALGLGACAKKQETMTTTAGTTGYSK |
| Ga0193721_10851601 | 3300020018 | Soil | MKFLKAIMIVAVLVTALGLGACAKKEETMTTSAGTTG |
| Ga0193726_12647361 | 3300020021 | Soil | LKQLLKAIMIVAVLATALSFGACAQRKETVTTSAGTT |
| Ga0193724_10985731 | 3300020062 | Soil | KAMMIVAVLATALSFGACAQRKETVTTSAGTTGYSK |
| Ga0193709_10056445 | 3300021411 | Soil | LKLIKAIMIVAILATALSFGACAQRKETVTTSAGT |
| Ga0126371_117971921 | 3300021560 | Tropical Forest Soil | LKQLLKAIMIVAVLATALSFGACSQKKETTTTSAGTT |
| Ga0222625_14784831 | 3300022195 | Groundwater Sediment | MKFLKAIMIVAVLVTALGLGACAKKEETMTTTAGTTGYAK |
| Ga0222625_14784833 | 3300022195 | Groundwater Sediment | KFLKAIMIVAVLVTALGLGACAKKEETVTTTAGTTGYAK |
| Ga0224452_10866073 | 3300022534 | Groundwater Sediment | KAIMIVAVLVTALGLGACAKKEETVTTTAGTTGYAK |
| Ga0224452_11912621 | 3300022534 | Groundwater Sediment | MKMIMIVALLVTALGLGACAQHKEAVTTSAGTTGYAK |
| Ga0222623_101330342 | 3300022694 | Groundwater Sediment | MKFLKTMMIVAVLVTALGLGACAKKEETVSTTAGTTGYSK |
| Ga0247753_10543591 | 3300022892 | Soil | YRLKLIKAIMIVAVLATALTFGACAQRKETVTTSAGTTGYHK |
| Ga0207647_103889402 | 3300025904 | Corn Rhizosphere | RMKFLKAIMIMAVLVTALGLGACAKKEETVTHTAGTTGYSK |
| Ga0207645_1000377911 | 3300025907 | Miscanthus Rhizosphere | MKFLKAIMIMAVLVTALGLESCAKKEETVTHTAGTTGYSK |
| Ga0207662_111404892 | 3300025918 | Switchgrass Rhizosphere | KFVKIMMVVTLLVTALGLGACAQHKETVTTGAGTTGYAK |
| Ga0207646_105155523 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LKFLKAIMLLAVLASTLSLGACAHKQETMSTGTTA |
| Ga0207661_111747802 | 3300025944 | Corn Rhizosphere | LKAIMIVAVLATALSFGACSQRKETVTTSAGTTGYHK |
| Ga0207668_100918203 | 3300025972 | Switchgrass Rhizosphere | KAIMIVAVLATALSFGACSQRKETVTTSAGTTGYHK |
| Ga0209438_11780651 | 3300026285 | Grasslands Soil | LKAIVIVAVLATALSFGACAQRKESVTTSAGTTGYSK |
| Ga0209469_10921482 | 3300026307 | Soil | FVKLMMVVALLVTALGLGACAQHKETVTTGAGTTGYAK |
| Ga0209155_10080624 | 3300026316 | Soil | VKFVKLMMVVALLVTALGLGACAQHKETVTTGAGTTGYAK |
| Ga0209155_10116912 | 3300026316 | Soil | MKTIMIVALLVTALGLGACAQHKEAVTTGAGTTGYAK |
| Ga0209472_12393812 | 3300026323 | Soil | FIKMIMIVTLLVTALGLGACAQHKEAVTTGAATTGYAK |
| Ga0209470_10575372 | 3300026324 | Soil | LKFVKAILVVAVLATALSFGACAQRKETVTTSAGTTGYAK |
| Ga0209152_104812021 | 3300026325 | Soil | KLLRAIMIVVILATALSFGACAQHKETVTTGAGTTGYAK |
| Ga0209801_12289601 | 3300026326 | Soil | LKFVKAILVVAVLATALSFGACAQRKETVTTGAGTTGYAK |
| Ga0209375_10953973 | 3300026329 | Soil | LKFVKAILVVAVLATALSFGACAQRKETVTTSAGT |
| Ga0209803_12326321 | 3300026332 | Soil | MKFLKAIMIVAVLVTALGLGACAKKQETMTTSAGTTGY |
| Ga0209159_11185712 | 3300026343 | Soil | KIMMVVTLLVTALGLGACAQHKETVTTGAGTTGYAK |
| Ga0209690_13081881 | 3300026524 | Soil | LKLIKAIMIVAVLATALSFGACSQKKETVTTSAGTTGYHK |
| Ga0209056_107228611 | 3300026538 | Soil | MKFLKAIMIVAVLVTALGLGACAKKQETVTTSAGTTGYSK |
| Ga0209156_1000281812 | 3300026547 | Soil | RDRVKLMKTIMIVALLVTALGLGACAQHKEAVTTGAGTTGYAK |
| Ga0209156_100311413 | 3300026547 | Soil | YKLKFVKVMMIVALLATALGLGACAQHKEAVTTGAATTGYAK |
| Ga0209648_105324971 | 3300026551 | Grasslands Soil | EIDLKFFKVIMIVAVLATALSFGACAQKKETVTTGAGTTGYSK |
| Ga0208709_1043921 | 3300026693 | Soil | AIMIVAVLATALSFGACAQRKETVTTSAGTTGYAK |
| Ga0208990_11364392 | 3300027663 | Forest Soil | IKVIMIVAVLATALSFGACAQRKETVTTGAGTTGYSK |
| Ga0209488_109852681 | 3300027903 | Vadose Zone Soil | RRDRVKFMKTIMIVALLATALGLGACAQHKEAVTTSAGTTGYAK |
| Ga0268266_113633072 | 3300028379 | Switchgrass Rhizosphere | LKQLLKAILIVAVLATALSFGACAQKKETVTTSAGTT |
| Ga0307302_102715131 | 3300028814 | Soil | LKLLRLIMIVAVLATALSFGACAQHKETVTTGAGTTGYSK |
| Ga0307302_105079711 | 3300028814 | Soil | FVKAIMIVAVLATALSFGACAQRKETVTTSAGTTGYAK |
| Ga0307278_100490362 | 3300028878 | Soil | MKFLKAMMIVAVLVTALGLGACAKKEETMTTTAGTTGYSK |
| Ga0307277_101712774 | 3300028881 | Soil | RRGRMKFLKAIMIVAVLVTALGLGACAKKQETVTTTAGTTGYAK |
| Ga0075388_116551362 | 3300030848 | Soil | LKFVKAILVLAVLATALSFGACAQKKETVTTSAGTTGYAK |
| Ga0138302_18489891 | 3300030937 | Soil | TIMIVALLVTALGLGACAQHKEPVTTTAGTTGYAK |
| Ga0138297_12739811 | 3300030962 | Soil | CERRRDRLKFLKVIMIVAVLATALSFGACAQHKETVTTGAGTTGYSK |
| Ga0138301_14851102 | 3300031022 | Soil | LKFFKVIMIVAVLATALSFGACAQKKETVTTGAGTTGYSK |
| Ga0170834_1029417441 | 3300031057 | Forest Soil | MKTIMIVALLVTALGLGACAQHKEPVTTTAGTTGYAK |
| Ga0308187_101973001 | 3300031114 | Soil | RRMKFLKAIMIVAILVTALGLGACAKKEESVSTTAGTTGYAK |
| Ga0170820_146239371 | 3300031446 | Forest Soil | RLKQLLKAIVIVAVLATALSFGACSQKKETVTTSAGTTGYSK |
| Ga0170820_165028162 | 3300031446 | Forest Soil | MKTIMIVALLITALGLGACAQHKEPVTTTAGTTGYAK |
| Ga0307468_1012905181 | 3300031740 | Hardwood Forest Soil | KAIMIVAVLATALSFGACAQRKETVTTSAGTTGYSK |
| Ga0307468_1025048772 | 3300031740 | Hardwood Forest Soil | LKQLLKAIMIVAVLATALSFGACSQKKETVTTSAGT |
| Ga0306918_108396621 | 3300031744 | Soil | KAIMIVAVLATALSFGACSQKKETTTTSAGTTGYSK |
| Ga0310911_100171291 | 3300032035 | Soil | LKQLLKAIVIVAVLATALSFGACSQKKEAVTTSAGTTGYSK |
| Ga0307471_1004240423 | 3300032180 | Hardwood Forest Soil | VKFMKTIMIVALLVTALGLGACAQHKEAVTTTAGTT |
| Ga0307471_1018180322 | 3300032180 | Hardwood Forest Soil | LKFVKAILIVAVLATALSFGACAQRKETVTTSAGTT |
| Ga0307471_1036998361 | 3300032180 | Hardwood Forest Soil | CSERRRDRVKFMKTIMIVALLVTALGLGACAQHKEAVTTTAGTTGYAK |
| Ga0306920_1001714971 | 3300032261 | Soil | AILVVAVLATALSFGACAQRKETVTTSAGTTGYAK |
| ⦗Top⦘ |