 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F009806 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 312 |
| Average Sequence Length | 43 residues |
| Representative Sequence | PSQSPKDENAIACQSFLNAGIASTLLDSDCAGAAGYGKDMA |
| Number of Associated Samples | 225 |
| Number of Associated Scaffolds | 312 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.68 % |
| % of genes from short scaffolds (< 2000 bps) | 95.51 % |
| Associated GOLD sequencing projects | 204 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.35 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (85.256 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (21.795 % of family members) |
| Environment Ontology (ENVO) | Unclassified (65.705 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (63.141 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.03% β-sheet: 0.00% Coil/Unstructured: 57.97% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 312 Family Scaffolds |
|---|---|---|
| PF13368 | Toprim_C_rpt | 43.27 |
| PF01266 | DAO | 41.03 |
| PF00535 | Glycos_transf_2 | 0.96 |
| PF00908 | dTDP_sugar_isom | 0.32 |
| PF16254 | DUF4910 | 0.32 |
| PF13950 | Obsolete Pfam Family | 0.32 |
| PF03030 | H_PPase | 0.32 |
| PF04989 | CmcI | 0.32 |
| COG ID | Name | Functional Category | % Frequency in 312 Family Scaffolds |
|---|---|---|---|
| COG1898 | dTDP-4-dehydrorhamnose 3,5-epimerase or related enzyme | Cell wall/membrane/envelope biogenesis [M] | 0.32 |
| COG3510 | Cephalosporin hydroxylase | Defense mechanisms [V] | 0.32 |
| COG3808 | Na+ or H+-translocating membrane pyrophosphatase | Energy production and conversion [C] | 0.32 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 85.26 % |
| All Organisms | root | All Organisms | 14.74 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 21.79% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 11.54% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 10.58% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 9.29% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 8.33% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 6.41% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 6.41% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.85% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.21% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.88% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 2.56% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 2.24% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.92% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.92% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.60% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.32% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 0.32% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.32% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.32% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.32% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.64% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.64% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.64% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.64% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.64% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.64% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000929 | Marine plume microbial communities from the Columbia River - 15 PSU | Environmental | Open in IMG/M |
| 3300001275 | Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnion | Environmental | Open in IMG/M |
| 3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
| 3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
| 3300002269 | Freshwater microbial communities from Lake Mendota, WI - 01JUN2011 deep hole epilimnion ns | Environmental | Open in IMG/M |
| 3300002272 | Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns | Environmental | Open in IMG/M |
| 3300002278 | Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002401 | Freshwater microbial communities from Lake Mendota, WI - 26JUN2009 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002447 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003388 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
| 3300003429 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003490 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003493 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300004806 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug08 | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300006108 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH20Aug07 | Environmental | Open in IMG/M |
| 3300006120 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH25Aug08 | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007165 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 | Environmental | Open in IMG/M |
| 3300007171 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface layer) 8 sequencing projects | Environmental | Open in IMG/M |
| 3300007212 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Bottom layer) 7 sequencing projects | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007546 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-02 | Environmental | Open in IMG/M |
| 3300007548 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3 | Environmental | Open in IMG/M |
| 3300007550 | Estuarine microbial communities from the Columbia River estuary - metaG 1549A-3 | Environmental | Open in IMG/M |
| 3300007551 | Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3 | Environmental | Open in IMG/M |
| 3300007590 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-02 | Environmental | Open in IMG/M |
| 3300007593 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3 | Environmental | Open in IMG/M |
| 3300007597 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02 | Environmental | Open in IMG/M |
| 3300007603 | Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 | Environmental | Open in IMG/M |
| 3300007606 | Estuarine microbial communities from the Columbia River estuary - metaG 1569-02 | Environmental | Open in IMG/M |
| 3300007618 | Estuarine microbial communities from the Columbia River estuary - metaG 1554A-02 | Environmental | Open in IMG/M |
| 3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
| 3300007627 | Estuarine microbial communities from the Columbia River estuary - metaG 1546A-02 | Environmental | Open in IMG/M |
| 3300007630 | Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02 | Environmental | Open in IMG/M |
| 3300007651 | Estuarine microbial communities from the Columbia River estuary - metaG 1555C-3 | Environmental | Open in IMG/M |
| 3300007670 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3 | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008119 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
| 3300008964 | Estuarine microbial communities from the Columbia River estuary - metaG 1551A-02 | Environmental | Open in IMG/M |
| 3300009051 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009080 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009187 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
| 3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011184 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
| 3300013014 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaG | Environmental | Open in IMG/M |
| 3300013093 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES057 metaG | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014819 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1011A | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300018815 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_68 | Environmental | Open in IMG/M |
| 3300018868 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_50 | Environmental | Open in IMG/M |
| 3300020083 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020190 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surface | Environmental | Open in IMG/M |
| 3300020204 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015008 Mahale S9 surface | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020214 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015054 Kigoma Offshore 80m | Environmental | Open in IMG/M |
| 3300020220 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100m | Environmental | Open in IMG/M |
| 3300020484 | Freshwater microbial communities from Lake Mendota, WI - 8OCT2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020509 | Freshwater microbial communities from Lake Mendota, WI - 14SEP2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020510 | Freshwater microbial communities from Lake Mendota, WI - 06JUL2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020511 | Freshwater microbial communities from Lake Mendota, WI - 15JUL2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020512 | Freshwater microbial communities from Lake Mendota, WI - 19NOV2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020522 | Freshwater microbial communities from Lake Mendota, WI - 26JUN2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020526 | Freshwater microbial communities from Lake Mendota, WI - 21JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020535 | Freshwater microbial communities from Lake Mendota, WI - 25JUL2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020544 | Freshwater microbial communities from Lake Mendota, WI - 04SEP2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020549 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020575 | Freshwater microbial communities from Lake Mendota, WI - 20MAY2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020578 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015038 Kigoma Deep Cast 35m | Environmental | Open in IMG/M |
| 3300020693 | Freshwater microbial communities from Trout Bog Lake, WI - 01OCT2007 hypolimnion | Environmental | Open in IMG/M |
| 3300020732 | Freshwater microbial communities from Trout Bog Lake, WI - 29MAY2009 epilimnion | Environmental | Open in IMG/M |
| 3300021092 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015021 Mahale Deep Cast 10m | Environmental | Open in IMG/M |
| 3300021340 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L442-9m | Environmental | Open in IMG/M |
| 3300021602 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L222-5m | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024298 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8d | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300024504 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepA_8d | Environmental | Open in IMG/M |
| 3300024514 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8d | Environmental | Open in IMG/M |
| 3300024850 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025390 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH04Jul08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025778 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Jul07 (SPAdes) | Environmental | Open in IMG/M |
| 3300026459 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepA_8d | Environmental | Open in IMG/M |
| 3300027084 | Estuarine microbial communities from the Columbia River estuary - metaG 1554A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027126 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8d | Environmental | Open in IMG/M |
| 3300027136 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_8h | Environmental | Open in IMG/M |
| 3300027141 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8h | Environmental | Open in IMG/M |
| 3300027145 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepA_8h | Environmental | Open in IMG/M |
| 3300027147 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepC_8h | Environmental | Open in IMG/M |
| 3300027150 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepB_8h | Environmental | Open in IMG/M |
| 3300027151 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_0h | Environmental | Open in IMG/M |
| 3300027152 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepB_8d | Environmental | Open in IMG/M |
| 3300027153 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8h | Environmental | Open in IMG/M |
| 3300027154 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepA_8h | Environmental | Open in IMG/M |
| 3300027238 | Estuarine microbial communities from the Columbia River estuary - metaG 1555C-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027285 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepC_8d | Environmental | Open in IMG/M |
| 3300027302 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepA_8d | Environmental | Open in IMG/M |
| 3300027329 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepB_8h | Environmental | Open in IMG/M |
| 3300027336 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepC_8d | Environmental | Open in IMG/M |
| 3300027337 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8d | Environmental | Open in IMG/M |
| 3300027368 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepB_8d | Environmental | Open in IMG/M |
| 3300027375 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepC_8d | Environmental | Open in IMG/M |
| 3300027489 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8d | Environmental | Open in IMG/M |
| 3300027491 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8d | Environmental | Open in IMG/M |
| 3300027499 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027518 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027531 | Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027627 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027689 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
| 3300027728 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m | Environmental | Open in IMG/M |
| 3300027730 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027744 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028027 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 3H_FC | Environmental | Open in IMG/M |
| 3300028044 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_15m | Environmental | Open in IMG/M |
| 3300028114 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_13.5m | Environmental | Open in IMG/M |
| 3300028557 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_4m | Environmental | Open in IMG/M |
| 3300028571 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch201714.5m_1 | Environmental | Open in IMG/M |
| 3300031786 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
| 3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
| 3300034051 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13May2013-rr0097 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034094 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Sep2000-rr0077 | Environmental | Open in IMG/M |
| 3300034096 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098 | Environmental | Open in IMG/M |
| 3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
| 3300034107 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133 | Environmental | Open in IMG/M |
| 3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
| 3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
| 3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| 3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
| 3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
| 3300034166 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079 | Environmental | Open in IMG/M |
| 3300034167 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Apr2015-rr0082 | Environmental | Open in IMG/M |
| 3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
| 3300034279 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163 | Environmental | Open in IMG/M |
| 3300034280 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| NpDRAFT_100134733 | 3300000929 | Freshwater And Marine | AVDANSPNQSPNDEKAIARQSLRNAGIARTLLDSDCAGADGYGRDMM* |
| B570J13894_10055702 | 3300001275 | Freshwater | PANCCASAVEANNPSQSPKEENAIARQSFRNAGIAKTLLDCDCAGADGYGNDML* |
| B570J14230_101103611 | 3300001282 | Freshwater | RAVEASNPSQSPNDENAIAFQSFLNAGIASTLLDSDCAGADGYGKDMMEVYL* |
| JGI24766J26685_100963962 | 3300002161 | Freshwater And Sediment | PPANCCANAVEANSPNQSPNDEKAIARHSLRNAGIARTLLDSDCAGADGYGRDMM* |
| B570J29577_1023952 | 3300002269 | Freshwater | CARAVDANKPNQSPNEEKAIACQSFLNAGIAKTLRDCAXAGADGYGNDML* |
| B570J29579_1057992 | 3300002272 | Freshwater | SCCARAVDANKPNQSPNEEKAIACQSFLNAGIAKTLRDCACAGADGYGNDML* |
| B570J29579_1075642 | 3300002272 | Freshwater | SPPANCCASAVEANNPSQSPKEENAIARQSFRNAGIAKTLLDCDCAGADGYGNDML* |
| B570J29590_1063572 | 3300002278 | Freshwater | SPPANCCASAVEANSPSQSPKEENAIARQSFRNAGIAKTLLDCDCAGADGYGNDML* |
| B570J29611_10041801 | 3300002401 | Freshwater | PNQSPKDENAIACQSFLNAGIASTFLDADWAGAAGYGNDML* |
| B570J29611_10129681 | 3300002401 | Freshwater | PPANCCASAVEANSPSQSPKEENAIARQSFRNAGIAKTLLDCDCAGADGYGNDML* |
| JGI24768J34885_102174752 | 3300002447 | Freshwater And Sediment | SSPNQSPKDENAIACQSFLNAGIASTLLDSDCAGAAGNGSDML* |
| B570J40625_1003462781 | 3300002835 | Freshwater | KPNQSPNEEKAIACQSFLNAGIAKTLRDCACAGADGYGSDIG* |
| B570J40625_1016983501 | 3300002835 | Freshwater | QSPKDENAIACQSFLNAGIASTFLDTDWAGAAGYGNDMV* |
| JGI25910J50241_100563802 | 3300003388 | Freshwater Lake | PANCWANAVEARSPSQSPXDEKAIACQSFLXAGIASTLRDSDCAGAAGYGNDMA* |
| JGI25911J50253_100581272 | 3300003411 | Freshwater Lake | PSQSPNEENAMACQSFLNAGIANTLLDSDFAGAAGYGNDMA* |
| JGI25914J50564_100642051 | 3300003429 | Freshwater Lake | ANAVEAKSPSQSPNEENAIACQSFLNAGIANTLLDSDFAGAAGYGNDIK* |
| JGI25926J51410_10615632 | 3300003490 | Freshwater Lake | EARSPSQSPNEENAMACQSFLNAGIANTLLDSDFAGAAGYGNDMG* |
| JGI25923J51411_10947011 | 3300003493 | Freshwater Lake | AVQARRPNQSPKDENAIACQSFLKAGIASTFLDTDWAGAAGYGSDMV* |
| Ga0007854_103836071 | 3300004806 | Freshwater | PSQSPKDEKAIDCQSRRKAGMAKTLRDSDCAGALGYGRA* |
| Ga0007854_104578291 | 3300004806 | Freshwater | PSQSPNEEKAMLFQSFRKAGIARTLRDSDCAGAEGYGSAWDMG* |
| Ga0070374_101543141 | 3300005517 | Freshwater Lake | QARRPNQSPKDENAIACQSFLNAGIASTFLDTDWAGAAGYGSDMV* |
| Ga0070374_103377971 | 3300005517 | Freshwater Lake | ANAVEARSPSQSPNEENAIACQSFLNAGIANTLLDSDFAGAAGYGKDMG* |
| Ga0070374_104839261 | 3300005517 | Freshwater Lake | VEAKSPSQSPNEENAIACQSFLNAGIANTLLDSDFAGAAGYGNDMA* |
| Ga0070374_106535572 | 3300005517 | Freshwater Lake | QARRPNQSPKDENAIACQSFLKAGIASTFLDTDWAGAAGYGNDMV* |
| Ga0068872_102781102 | 3300005528 | Freshwater Lake | PSQSPNEENAIACQSFLNAGIASTLLDSDWAGADGYGNDMA* |
| Ga0068872_104501072 | 3300005528 | Freshwater Lake | PKEENAIARQSFRNAGIAKTLLDCDCAGADGYGNDMG* |
| Ga0068872_105359412 | 3300005528 | Freshwater Lake | PSQSPNDENAIAFQSFLNAGIASTLLDSDCAGVDGYGKDMMEVYL* |
| Ga0068872_106665941 | 3300005528 | Freshwater Lake | AVDANKPNQSPNEEKAIACQSFLNAGIAKTLRDCACAGADGYGNDML* |
| Ga0049083_101888792 | 3300005580 | Freshwater Lentic | ENAIACQSFLNAGIASTFLDTDWAGAAGYGSDML* |
| Ga0049080_101208001 | 3300005582 | Freshwater Lentic | QSPKDENAIACQSFLNAGIASTFLDTDWAGAAGYGSDML* |
| Ga0049085_101732921 | 3300005583 | Freshwater Lentic | PNQSPKDENAIACQSFLNAGIASTFLDTDWAGAAGYGSDML* |
| Ga0049085_101888561 | 3300005583 | Freshwater Lentic | QSPKDENAIACQSFLNAGIASTFLDTDWAGAAGYGSDMV* |
| Ga0049082_100511411 | 3300005584 | Freshwater Lentic | PSQSPKDENAIACQSFLNAGIASTFLDTDWAGAAGYGSDMV* |
| Ga0049082_101208591 | 3300005584 | Freshwater Lentic | PSQSPNEENAMACQSFLNAGIANTLLDSDFAGAAGYGNDMG* |
| Ga0049084_102107751 | 3300005585 | Freshwater Lentic | VQARRPNQSPKDENAIACQSFLKAGIASTLLDTDWAGAAGYGSDMT* |
| Ga0078894_105163472 | 3300005662 | Freshwater Lake | PSQSPKDENAIACHSFLNAGIASTLLDSDCAGAAGYGKDMA* |
| Ga0078894_105813521 | 3300005662 | Freshwater Lake | PSQSPKDEKAIACQSFLNAGIASTLRDSDCAGAAGYGNDMA* |
| Ga0078894_111521162 | 3300005662 | Freshwater Lake | PSQSPKDENAIACHSFLNAGIASTLLDSDCAGAAGYGKDMMEVYL* |
| Ga0007862_10451352 | 3300006108 | Freshwater | RPSQSPNEEKAMLFQSFRKAGIARTLRDSDCAGAEGYGSA* |
| Ga0007867_10107811 | 3300006120 | Freshwater | PNQSPKEEKAIEFQSLRKAGIARTLRDSDCAGADG* |
| Ga0079301_10552891 | 3300006639 | Deep Subsurface | PKDENAIACQSFLNAGIARTLLDSDCAGAAGYGNDMDEEYLLSQ* |
| Ga0079301_10571791 | 3300006639 | Deep Subsurface | AKAVEASNPSQSPKDENAIACQSFLNAGIARTLLDSDCAGAAGYGKDMA* |
| Ga0079301_11805941 | 3300006639 | Deep Subsurface | VEASSPSQSPKDENAIACHSFLNAGIASTLLDSDCAGAAGYGKDMA* |
| Ga0075464_105522532 | 3300006805 | Aqueous | ANCWASAVDARRPNQSPKDENAIACQSFLNAGIASTLLDSDCAGAAGNGKDMA* |
| Ga0075473_102436742 | 3300006875 | Aqueous | PSQSPKDENAIACQSFLNAGIARTLLDSDCAGAAGYGKDMA* |
| Ga0079302_10410662 | 3300007165 | Deep Subsurface | DENAIACHSFLNAGIASTLLDSDCAGAAGYGKDMA* |
| Ga0102977_10826893 | 3300007171 | Freshwater Lake | SPKDENAIACQSFRKAGSASTLLDWDCAGADGYGRDIG* |
| Ga0103958_10850173 | 3300007212 | Freshwater Lake | SAVEANNPSQSPKEENAIARQSFRNAGIAKTLLDCDCAGADGYGNDMG* |
| Ga0075458_100490031 | 3300007363 | Aqueous | DENAIACQSFLNAGIARTLLDSDCAGAAGYGNDMA* |
| Ga0075458_102156281 | 3300007363 | Aqueous | VEASNPSQSPKDENAIACQSFLNAGIASTLLDSDCAGAAGYGNDMA* |
| Ga0102874_12043931 | 3300007546 | Estuarine | RRPNQSPKDENAIACQSFLNAGIASTFLDTDWAGAAGYGSDML* |
| Ga0102877_10376442 | 3300007548 | Estuarine | NPSQSPKDEKAIACQSFLNAGIARTLLDSDCAGAAGYGNDMAEEYLLSQ* |
| Ga0102877_11719922 | 3300007548 | Estuarine | PSQSPKDENAIACQSFLNAGIASTLRDSDCAGAAGYGNDMM* |
| Ga0102880_10506971 | 3300007550 | Estuarine | SPKDENAIACQSFLKAGIANTLLDSDCAGAAGNGSDML* |
| Ga0102881_10876291 | 3300007551 | Estuarine | KDENAIACQSFLNAGIASTFLDTDWAGAAGYGNDMI* |
| Ga0102917_11052352 | 3300007590 | Estuarine | WASAVEASNPSQSPKDENAIACQSFLNAGIASTLLDSDCAGAAGYGNDMAEEYLLSQ* |
| Ga0102918_10530322 | 3300007593 | Estuarine | SNPSQSPKDEKAIACQSFLNAGIASTLRDSDCAGAAGYGNDMM* |
| Ga0102918_12886362 | 3300007593 | Estuarine | PANCWANAVEASSPSQSPKDENAIACHSFLNAGIASTLLDSDCAGAAGYGKDMA* |
| Ga0102919_10611261 | 3300007597 | Estuarine | RPSQSPKDENAIACQSFLNAGIASTFLDTDWAGAAGYGSDMV* |
| Ga0102921_12965552 | 3300007603 | Estuarine | RPNQSPKDENAIACQSFLNAGIASTFLDTDWAGAAGYGSDMV* |
| Ga0102921_13315641 | 3300007603 | Estuarine | KDENAIACQSFLNAGIASTFLDTDWAGAAGYGNDML* |
| Ga0102923_10366721 | 3300007606 | Estuarine | ARRPNQSPKDENAIACQSFLNAGIASTFLDTDWAGAAGYGSDML* |
| Ga0102896_11645462 | 3300007618 | Estuarine | SPKDENAIACQSFLNAGIASTFLDTDWAGAAGYGNDMV* |
| Ga0102896_11876711 | 3300007618 | Estuarine | ARRPNQSPKDENAIACQSFLNAGIASTFLDTDWAGAAGYGNDML* |
| Ga0102896_12633351 | 3300007618 | Estuarine | VEASNPSQSPTAENAIACQSFLNAGIASTLLDSDCAGAAGYGNDMM* |
| Ga0102863_10911561 | 3300007622 | Estuarine | NCWANAVEASSPSQSPKDENAIACHSFLNAGIASTLLDSDCAGAAGYGKDMA* |
| Ga0102869_12182451 | 3300007627 | Estuarine | ENAMACQSFLNAGIANTLLDSDFAGAAGYGNDMG* |
| Ga0102903_10784842 | 3300007630 | Estuarine | CWASAVDASSPNQSPKDENAIACQSFLKAGIANTLLDSDCAGAAGNGSDML* |
| Ga0102903_11965621 | 3300007630 | Estuarine | EARSPSQSPNEENAIACQSFLNAGIANTLLDSDFAGAAGYGNDIK* |
| Ga0102900_10762421 | 3300007651 | Estuarine | QSPNDEKAIARQSLRNAGIARTLLDSDCAGADGYGRDMM* |
| Ga0102862_11027001 | 3300007670 | Estuarine | AKSPSQSPKDEKAIACQSFLNAGIASTLRDSDCAGAAGYGNDMA* |
| Ga0105746_10581262 | 3300007973 | Estuary Water | QSPKDENAIACQSFLNAGIASTLLDSDCAGAAGNGKDMA* |
| Ga0105746_11765281 | 3300007973 | Estuary Water | DENAIACQSFLNAGIASTFLDTDWAGAAGYGNDMV* |
| Ga0105747_10180811 | 3300007974 | Estuary Water | QSPNEENAMACQSFLNAGIANTLLDSDFAGAAGYGNDMG* |
| Ga0105747_11001811 | 3300007974 | Estuary Water | VDANKPNQSPNEEKAIACQSFLNAGIAKTLRDCACAGADGYGNDML* |
| Ga0105747_11283771 | 3300007974 | Estuary Water | RRPNQSPKDENAIACQSFLNAGIASTFLDTDWAGATGYGSDMV* |
| Ga0105748_100745662 | 3300007992 | Estuary Water | SQSPNDEKAIACQSFLNAGIASTLRDSDCAGAAGYGNDMA* |
| Ga0105748_104743661 | 3300007992 | Estuary Water | NAVEASSPSQSPKDENAIACHSFLNAGIASTLLDSDCAGAAGYGKDMMEVYL* |
| Ga0108970_102521752 | 3300008055 | Estuary | PNQSPKDENAIACQSFLNAGIASTLLDTDWAGAAGYGSDMV* |
| Ga0108970_106019432 | 3300008055 | Estuary | PKDENAIACQSFLNAGIASTLLDSDCAGAAGNGKDMA* |
| Ga0114341_101946572 | 3300008108 | Freshwater, Plankton | PNQSPKDENAIACQSFLNAGIASTFLDTDWAGAAGYGNDMV* |
| Ga0114341_102236542 | 3300008108 | Freshwater, Plankton | NCWAKAVEASNPSQSPKDENAIACQSFLNAGIARTLRDSDCAGAAGYGNDMA* |
| Ga0114344_10051381 | 3300008111 | Freshwater, Plankton | QSPNEENAIACQSFLNAGIASTLLDSDWAGADGYGNDMA* |
| Ga0114344_11507582 | 3300008111 | Freshwater, Plankton | QSPNEENAIACQSFLNAGIASTLLDSDWAGADGYGNDMI* |
| Ga0114344_11582981 | 3300008111 | Freshwater, Plankton | AIACQSFLNAGIARTLLDSDCAGAAGYGKDMMEVYL* |
| Ga0114344_11823572 | 3300008111 | Freshwater, Plankton | PSQSPKEENAIARQSFRNAGIAKTLLDCDCAGADGYGNDML* |
| Ga0114347_10533721 | 3300008114 | Freshwater, Plankton | PNEENAIACQSFLNAGIARTLLDSDCAGAEGYGKDMM* |
| Ga0114347_10655173 | 3300008114 | Freshwater, Plankton | QSPKEENAIARQSFRNAGIAKTLLDCDCAGADGYGNDMG* |
| Ga0114347_11752232 | 3300008114 | Freshwater, Plankton | NAVEARSPSQSPNEENAIACQSFLNAGIASTLLDSDWAGADGYGNDMM* |
| Ga0114351_10232651 | 3300008117 | Freshwater, Plankton | ANCWAKAVEASNPSQSPKDENAIACQSFLNAGIARTLRDSDCAGAAGYGNDMA* |
| Ga0114351_10389143 | 3300008117 | Freshwater, Plankton | NAVEAKSPSQSPNEENAIACQSFLNAGIASTRLDSDCAGADGYGKDMM* |
| Ga0114351_10826672 | 3300008117 | Freshwater, Plankton | ANCWAKAVEASNPSQSPKDENAIACQSFLNAGIARTLLDSDCAGAAGYGKDMMEVYL* |
| Ga0114354_11386622 | 3300008119 | Freshwater, Plankton | SQSPKDENAIACHSFLNAGIASTLLDSDCAGAAGYGKDMMEVYL* |
| Ga0114336_10742643 | 3300008261 | Freshwater, Plankton | WANAVEASSPSQSPKDENAIACHSFLNAGIASTLLDSDCAGAAGYGKDMA* |
| Ga0114336_11344642 | 3300008261 | Freshwater, Plankton | AVEASSPSQSPKDENAIACQSFLNAGIANTLLDSDCAGAAGYGKDMA* |
| Ga0114336_12135291 | 3300008261 | Freshwater, Plankton | RRPNQSPKDENAIACQSFLKAGIASTLLDTDWAGAAGYGSDML* |
| Ga0114336_12222131 | 3300008261 | Freshwater, Plankton | EEKAIACQSFLNAGIAKTLRDCACAGADGYGSDML* |
| Ga0114336_13253791 | 3300008261 | Freshwater, Plankton | CWASAVEARSPSQSPKDEKAIACQSFLNAGIASTLRDSDCAGAAGYGNDMA* |
| Ga0114337_10588163 | 3300008262 | Freshwater, Plankton | AVEANNPSQSPKEENAIARQSFRNAGIAKTLLDCDCAGADGYGNDMG* |
| Ga0114337_13167132 | 3300008262 | Freshwater, Plankton | QSPKDENAIACQSFLNAGIASTFLDTDWAGAAGYGNDML* |
| Ga0102889_11325042 | 3300008964 | Estuarine | WANAVEARSPSQSPRDEKAIACQSFLNAGIASTLRDSDCAGAAGYGNDMA* |
| Ga0102864_10259391 | 3300009051 | Estuarine | ARRPNQSPKDENAIACQSFLNAGIASTFLDTDWAGAAGYGNDMV* |
| Ga0114973_100974911 | 3300009068 | Freshwater Lake | SPSQSPKDEKAIACQSFLNAGIASTLRDSDCAGAAGYGNDMA* |
| Ga0114973_104378261 | 3300009068 | Freshwater Lake | SPSQSPKDEKAIACQSFLNAGIASTLRDSDCAGAAGYGNDMM* |
| Ga0102815_107782021 | 3300009080 | Estuarine | QSPKDENAIACQSFLNAGIASTFLDADWAGAAGYGSDML* |
| Ga0114980_102814402 | 3300009152 | Freshwater Lake | VLARRPNQSPKDENAIACQSFLNAGIASTFLDTDWAGAAGYGNDMV* |
| Ga0114980_103627461 | 3300009152 | Freshwater Lake | SPSQSPKDENAIAFQSFLKAGIANTLLDSDCAGAAGNGSDMM* |
| Ga0114981_102306861 | 3300009160 | Freshwater Lake | VDARSPNQSPKDENAIACQSFLNAGIAKTLLDSDCAGAAGNGSDML* |
| Ga0114981_102590182 | 3300009160 | Freshwater Lake | PKDENAIACQSFLNAGIASTLRDSDCAGAAGYGKDMA* |
| Ga0114966_103065521 | 3300009161 | Freshwater Lake | VDARSPNQSPKDENAIACQSFLNAGIASTLLDSDCAGAAGNGKDMA* |
| Ga0114966_103977432 | 3300009161 | Freshwater Lake | RRPNQSPKDENAIACQSFLNAGIASTFLDADWAGAAGYGSDML* |
| Ga0114970_102878722 | 3300009163 | Freshwater Lake | DARSPNQSPKDENAIACQSFLNAGIASTLLDSDCAGAAGNGSDML* |
| Ga0114975_102367811 | 3300009164 | Freshwater Lake | AVQARRPNQSPKDENAIACQSFLNAGIASTLLDTD* |
| Ga0114979_101143691 | 3300009180 | Freshwater Lake | SPKDEKAIACQSFLNAGIASTLRDSDCAGAAGYGNDMM* |
| Ga0114969_101295612 | 3300009181 | Freshwater Lake | SPKDENAIACQSFLNAGIAKTLLDSDCAGAAGNGSDML* |
| Ga0114969_102583662 | 3300009181 | Freshwater Lake | VDARSPNQSPKDENAIACQSFLNAGIASTLLDSDCAGGAGNGKDMA* |
| Ga0114959_104734792 | 3300009182 | Freshwater Lake | PKDENAIACQSFLNAGIASTLLDSDCAGAAGNGSDML* |
| Ga0114974_105749092 | 3300009183 | Freshwater Lake | VEARSPSQSPKDEKAIACQSFLNAGIASTLRDSDCAGAAGYGNDMA* |
| Ga0114976_101612351 | 3300009184 | Freshwater Lake | RPNQSPKDENAIACQSFLNAGIASTFLDTDWAGAAGYGNDMV* |
| Ga0114976_104956131 | 3300009184 | Freshwater Lake | QSPKDENAIACQSFLNAGIAKTLLDSDCAGAAGNGSDML* |
| Ga0114976_105189092 | 3300009184 | Freshwater Lake | AVQARRPNQSPKDENAIACQSFLNAGIASTLLDTDWAGAAGYGSDMV* |
| Ga0114972_104844251 | 3300009187 | Freshwater Lake | NQSPKDENAIACQSFLNAGIAKTLLDSDCAGAAGNGSDML* |
| Ga0114972_107355712 | 3300009187 | Freshwater Lake | KDENAIACQSFLNAGIASTLLDSDCAGAAGNGKDMA* |
| Ga0114958_101598282 | 3300009684 | Freshwater Lake | ASAVEASSPNQSPKDENAIACQSFLNAGIAKTLLDSDCAGAAGNGSDML* |
| Ga0114960_102825561 | 3300010158 | Freshwater Lake | QSPKDENAIACQSFLNAGIASTLLDSDCAGAAGKGSDMA* |
| Ga0114967_105417832 | 3300010160 | Freshwater Lake | ARRPNQSPKDENAIACQSFLNAGIASTFLDADWAGAAGYGNDML* |
| Ga0129336_101250911 | 3300010370 | Freshwater To Marine Saline Gradient | KDENAIACQSFRNAGIAKTLLDCDCAGADGYGNDIG* |
| Ga0133913_116880691 | 3300010885 | Freshwater Lake | CWASAVDARSPNQSPKDENAIACQSFLNAGIAKTLLDSDCDGVIG* |
| Ga0133913_117710243 | 3300010885 | Freshwater Lake | PNDENAMACQSFRNAGMASTLRDIDCAGGDGYKIDIKSYSI* |
| Ga0136709_10614692 | 3300011184 | Freshwater | PNQSPKDENAIACQSFLKAGIASTLLDTDWAGAAGYGSDML* |
| Ga0151620_10460001 | 3300011268 | Freshwater | SPSQSPKDENAIDCQSFLNAGIASTLLDSDFAGAAGNGIDMM* |
| Ga0151620_11229852 | 3300011268 | Freshwater | KDENAIACQSFLNAGIARTLLDSDCAGAAGYGKDMMEVYL* |
| Ga0153801_10819652 | 3300012017 | Freshwater | AKAVEASNPSQSPKDENAIACQSFLNAGIASTLRDSDCAGAAGYGNDMM* |
| Ga0164293_104116641 | 3300013004 | Freshwater | DEKAIACQSFLNAGIASTLRDSDCAGAAGYGNDMA* |
| Ga0164292_101740101 | 3300013005 | Freshwater | SPSQSPKEENAIARQSFRNAGIAKTLLDCDCAGADGYGNDMG* |
| Ga0164292_101936251 | 3300013005 | Freshwater | NPSQSPNDENAIAFQSFLNAGIASTLLDSDCAGADGYGKDMG* |
| Ga0164292_101966431 | 3300013005 | Freshwater | SPNQSPKEENAIARQSFRNAGIAKTLLDCDCAGADGYGNDMG* |
| Ga0164294_106436892 | 3300013006 | Freshwater | PKDEKAIACQSFLNAGIASTLRDSDCAGAAGYGNDMA* |
| Ga0164294_109957631 | 3300013006 | Freshwater | RPNQSPKDENAIACQSFLNAGIASTFLDTDWAGAAGYGNDML* |
| Ga0164295_113594912 | 3300013014 | Freshwater | SQSPKDEKAIACQSFLNAGIASTLRDSDCAGAAGYGNDMA* |
| Ga0164296_13104191 | 3300013093 | Freshwater | KPSQSPNEEKAMEYQRRLKAGMAKTLRESVCAGALGYGRACDIGAV* |
| Ga0164296_13903631 | 3300013093 | Freshwater | KPSQSPNEEKAMEYQRRLKAGMAKTLRESVCAGALGYGRA* |
| Ga0177922_107421772 | 3300013372 | Freshwater | PNEENAMACQSFLNAGIANTLLDSDFAGAAGYGNDMA* |
| Ga0119954_10399761 | 3300014819 | Freshwater | ENAIACQSFLNAGIARTLLDSDCAGAAGYGKDMA* |
| Ga0169931_101734041 | 3300017788 | Freshwater | SPKEENAIACHSFRNPGIASTLLDSDCAGAAGYGKDIG |
| Ga0169931_107319012 | 3300017788 | Freshwater | PKDENAIACHSFRNAGIASTLLDSDLAGVDGYGKDMA |
| Ga0187845_12206301 | 3300018815 | Freshwater | RPNQSPKDENAIACQSFLNAGIASTFLDTDWAGAAGYGSDMV |
| Ga0187844_104531372 | 3300018868 | Freshwater | VEARSPSQSPKDENAIACQSFLNAGIASTLRDSDCAGAAGYGNDMA |
| Ga0194111_105825012 | 3300020083 | Freshwater Lake | KDENAIACHSFRNAGIASTLLDSDLAGVDGYGSDMN |
| Ga0194115_100792842 | 3300020183 | Freshwater Lake | VEARSPSQSPKDENAIACHSFRNAGIASTLLDSDLAGVDGYGSDMN |
| Ga0194118_105908771 | 3300020190 | Freshwater Lake | KDENAIACHSFRNAGIASTLLDSDLAGVDGYGKDMN |
| Ga0194116_101776452 | 3300020204 | Freshwater Lake | ANAVEARSPSQSPKDENAIACHSFRNAGIASTLLDSDLAGVDGYGKDMA |
| Ga0211731_109788912 | 3300020205 | Freshwater | DENAIACQSFLNAGIASTLLDSDCAGAAGYGKDTG |
| Ga0194132_105859232 | 3300020214 | Freshwater Lake | ARSPSQSPKDENAIACHSFRNAGIASTLLDSDLAGVDGYGKDMA |
| Ga0194119_100920771 | 3300020220 | Freshwater Lake | PKDENAIACHSFRNAGIASTLLDSDLAGVDGYGSDMN |
| Ga0208049_1112631 | 3300020484 | Freshwater | NAVDANSPNQSPNDEKAIARQSLRNAGIDRTLLDSDCAGADG |
| Ga0208594_10221502 | 3300020509 | Freshwater | PSQSPKEENAIARQSFRNAGIAKTLLDCDCAGADGYGNDML |
| Ga0208086_10067631 | 3300020510 | Freshwater | DANKPNQSPNEEKAIACQSFLNAGIAKTLRDCACAGADGYGNDML |
| Ga0208593_10273342 | 3300020511 | Freshwater | KDEKAIACQSFLNAGIASTLRDSDCAGAAGYGNDMA |
| Ga0207936_10366371 | 3300020512 | Freshwater | ANAVDANSPNQSPNDEKAIARQSLRNAGIDRTLLDSDCAGADG |
| Ga0208327_10279811 | 3300020522 | Freshwater | VDANSPNQSPNDEKAIARQSLRNAGIDRTLLDSDCAGADG |
| Ga0208085_10458602 | 3300020526 | Freshwater | SAVEANSPSQSPKEENAIARQSFRNAGIAKTLLDCDCAGADGYGNDML |
| Ga0208228_10150232 | 3300020535 | Freshwater | NSPNQSPKEENAIARQSFRNAGIAKTLLDCDCAGADGYGNDML |
| Ga0207937_10139133 | 3300020544 | Freshwater | NEENAIACQSFLNAGIASTLLDSDCAGADGYGNDMA |
| Ga0207942_10321712 | 3300020549 | Freshwater | ARRPNQSPKDENAIACQSFLNAGIASTFLDADWAGAAGYGSDML |
| Ga0208053_10207822 | 3300020575 | Freshwater | QSPKDENAIACQSFLNAGIASTFLDTDWAGAAGYGNDMV |
| Ga0194129_102686371 | 3300020578 | Freshwater Lake | VEARSPSQSPKDENAIACHSFRNAGIASTLLDSDLAGVDGYGKDMA |
| Ga0214226_10256061 | 3300020693 | Freshwater | PNEEKAMLFHNLRKAGTARTLRDSDCAGADGYGSA |
| Ga0214201_10358442 | 3300020732 | Freshwater | SQSPNEEKAMLFQSFRKAGIARTLRDSDCAGAEGYGSAWDMG |
| Ga0194122_105125191 | 3300021092 | Freshwater Lake | PSQSPKDENAIACHSFRNAGIASTLLDSDLAGVDGYGKDMA |
| Ga0194122_106219141 | 3300021092 | Freshwater Lake | ARSPSQSPKDENAIACHSFRNAGIASTLLDSDLAGADGYGKDMA |
| Ga0194041_101951442 | 3300021340 | Anoxic Zone Freshwater | EEKAIDFQSLRNAGIAKTLRVSDCAGAPGYGNDCDMS |
| Ga0194060_103753122 | 3300021602 | Anoxic Zone Freshwater | SAVDARSPNQSPKDENAIACQSFLNAGIASTLLDSDCAGAAGNGKDMA |
| Ga0222713_108614452 | 3300021962 | Estuarine Water | QSPKDENAIACQSFLNAGIASTLLDTDWAGAAGYGSDMV |
| Ga0222712_102611102 | 3300021963 | Estuarine Water | AKAVEASNPSQSPKDENAIACQSFLNAGIARTLLDSDWAGAAGYGNDMA |
| Ga0214917_101137323 | 3300022752 | Freshwater | SSPNQSPNEEKAIACQSFLNAGIANTPRDCDCAGADGYGNDIG |
| Ga0214917_103347332 | 3300022752 | Freshwater | NSPNQSPNDEKAIARHSLRNAGIARTLLDSDCAGADGYGRDMM |
| Ga0214921_101598743 | 3300023174 | Freshwater | VEASKPNQSPNDEKAIACQSFLKAGIDNTPRDADWAGAAGYGSDMD |
| Ga0214923_101398261 | 3300023179 | Freshwater | VEASRPNQSPKDENAIACQSFLNAGIASTLLDSDCAGAAGNGKDMA |
| Ga0214919_100817941 | 3300023184 | Freshwater | NQSPKDENAIACQSFLNAGIASTLLDSDCAGAAGKGSDMA |
| Ga0214919_105709621 | 3300023184 | Freshwater | VEASKPNQSPNDEKAIACQSFLKAGIDNTPLDADWAGAAGYGSDMD |
| Ga0214919_107773772 | 3300023184 | Freshwater | PNQSPNEEKAIACQSFLNAGIANTPRDCDCAGADGYGNDIG |
| Ga0255178_10959802 | 3300024298 | Freshwater | AVEASSPNLSPNEEKAIACQSFLNAGIANTPRDCDCAGADGYGNDIG |
| Ga0244777_104681621 | 3300024343 | Estuarine | DEKAIACHSFLNAGIASTLRDSDCAGAAGYGNDMM |
| Ga0244776_102911082 | 3300024348 | Estuarine | PKDENAIACQSFLNAGIASTLRDSDCAGAAGYGNDMA |
| Ga0255179_10330042 | 3300024504 | Freshwater | NQSPNEEKAIACQSFLNAGIANTPRDCDCAGADGYGNDIG |
| Ga0255177_10375561 | 3300024514 | Freshwater | VEASNPSQSPKDENAIACQSFLNAGIARTLLDSDCAGAAGYGNDMA |
| Ga0255282_10939232 | 3300024850 | Freshwater | ASSPNQSPNEEKAIACQSFLNAGIANTPRDCDCAGADGYGKDML |
| Ga0208743_10079021 | 3300025390 | Freshwater | EAKRPSQSPNEEKAMLFQSFRKAGIARTLRDSDCAGAEGYGSA |
| Ga0208147_10357761 | 3300025635 | Aqueous | DENAIACQSFLKAGIASTLLDTDWAGAAGYGSDML |
| Ga0208388_10230132 | 3300025778 | Freshwater | RRPSQSPNEEKAMLFQSFRKAGIARTLRDSDCAGAEGYGSA |
| Ga0255170_10070371 | 3300026459 | Freshwater | PNEEKAIACQSFLNAGIANTPRDCDCAGADGYGNDML |
| Ga0255170_10331311 | 3300026459 | Freshwater | QSPNEEKAIACQSFLNAGIANTPRDCDCAGADGYGNDIG |
| Ga0208443_10712902 | 3300027084 | Estuarine | CASAVEARSPSQSPKDENAIAFQSFLKAGIANTLLDSDCAGAAGNGSDML |
| Ga0255098_10333831 | 3300027126 | Freshwater | ANCCANAVDANSPNQSPNDEKAIARQSLRNAGIARTLLDSDCAGADGYGRDMM |
| Ga0255107_10398091 | 3300027136 | Freshwater | SPPASCWAKAVQARRPNQSPKDENAIACQSFLNAGIASTFLDTDWAGAAGYGSDML |
| Ga0255076_10741591 | 3300027141 | Freshwater | PKDENAIACQSFLKAGIANTLLDSDCAGAAGNGSDML |
| Ga0255114_10159801 | 3300027145 | Freshwater | PPASCWAKAVQARRPNQSPKDENAIACQSFLNAGIASTFLDTDWAGAAGYGSDML |
| Ga0255113_10154223 | 3300027147 | Freshwater | RRPNQSPKDENAIACQSFLNAGIASTFLDTDWAGAAGYGSDMV |
| Ga0255112_10206451 | 3300027150 | Freshwater | AKAVQARRPNQSPKDENAIACQSFLNAGIASTFLDTDWAGAAGYGSDML |
| Ga0255112_10525361 | 3300027150 | Freshwater | VEARSPSQSPNEENAMACQSFLNAGIANTLLDSDFAGAAGYGNDMG |
| Ga0255063_10479772 | 3300027151 | Freshwater | PNQSPKDENAIACQSFLNAGIASTFLDTDWAGAAGYGSDML |
| Ga0255100_10398421 | 3300027152 | Freshwater | ARAVQARRPNQSPKDENAIACQSFLNAGIASTFLDTDWAGAAGYGSDML |
| Ga0255083_10393062 | 3300027153 | Freshwater | PSQSPNDEKAIACQSFLNAGIASTLRDSDCAGAAGYGNDMA |
| Ga0255111_10908381 | 3300027154 | Freshwater | RPNQSPKDENAIACQSFLKAGIASTFLDTDWAGAAGYGRDML |
| Ga0208808_10262832 | 3300027238 | Estuarine | QSPNDEKAIARQSLRNAGIARTLLDSDCAGADGYGRDMM |
| Ga0255131_10296532 | 3300027285 | Freshwater | PKDEKAIACQSFLNAGIASTLRDSDCAGAAGYGNDMA |
| Ga0255096_10512442 | 3300027302 | Freshwater | NAVEAKSPSQSPNDEKAIACQSFLNAGIASTLRDSDCAGAAGYGNDMA |
| Ga0255109_11302371 | 3300027329 | Freshwater | PNEENAIACQSFLNAGIANTLLDSDFAGAAGYGNDIK |
| Ga0255128_10243963 | 3300027336 | Freshwater | PNEENAMACQSFLNAGIANTLLDSDFAGAAGYGNDMG |
| Ga0255087_10546672 | 3300027337 | Freshwater | RRPSQSPKDENAIACQSFLNAGIASTFLDTDWAGAAGYGSDML |
| Ga0255133_10646802 | 3300027368 | Freshwater | QSPKDENAIACQSFLNAGIASTFLDTDWAGAAGYGSDMV |
| Ga0255137_10197952 | 3300027375 | Freshwater | SPNEENAIACQSFLNAGIARTLLDSDCAGAEGYGKDMM |
| Ga0255095_10614531 | 3300027489 | Freshwater | PKDEKAIACQSFLNAGIASTLRDSDCAGAAGYGNDMM |
| Ga0255097_10547472 | 3300027491 | Freshwater | ARAVQARRPSQSPKDENAIACQSFLNAGIASTFLDTDWAGAAGYGSDML |
| Ga0208788_10221251 | 3300027499 | Deep Subsurface | KDENAIACQSFLNAGIARTLLDSDCAGAAGYGNDMDEEYLLSQ |
| Ga0208787_10371643 | 3300027518 | Deep Subsurface | PSQSPNEENAIACQSFLNAGIASTLLDSDCAGADGYGNDMA |
| Ga0208682_10231712 | 3300027531 | Estuarine | SQSPKDEKAIACQSFLNAGIASTLRDSDCAGAAGYGNDMM |
| Ga0209651_10554962 | 3300027581 | Freshwater Lake | QARRPSQSPKDENAIACQSFLNAGIASTFLDTDWAGAAGYGSDML |
| Ga0208974_10361751 | 3300027608 | Freshwater Lentic | DENAIACQSFLNAGIASTFLDADWAGAAGYGNDML |
| Ga0208942_12000212 | 3300027627 | Freshwater Lentic | RAVQARRPSQSPKDENAIACQSFLNAGIASTFLDTDWAGAAGYGSDMV |
| Ga0209356_11419302 | 3300027644 | Freshwater Lake | DENAIACQSFLKAGIASTFLDTDWAGAAGYGSDMV |
| Ga0209551_12602582 | 3300027689 | Freshwater Lake | PNQSPKDENAIACQSFLKAGIANTLLDSDCAGAAGNGSDML |
| Ga0209443_10767122 | 3300027707 | Freshwater Lake | RAVQARRPNQSPKDENAIACQSFLNAGIASTFLDTDWAGAAGYGNDMV |
| (restricted) Ga0247836_10912473 | 3300027728 | Freshwater | PPANCWANAVEARRPSQSPKDENAMACQSFLNAGIASTLLDSDCAGAAGYGKDMA |
| (restricted) Ga0247833_11413572 | 3300027730 | Freshwater | NAVEARSPSQSPKEENAIACQSFLNAGIASTLLDSDCAGAAGYGKDMA |
| Ga0209442_11604262 | 3300027732 | Freshwater Lake | RRPNQSPKDENAIACQSFLNAGIASTFLDTDWAGAAGYGSDML |
| Ga0209190_12490211 | 3300027736 | Freshwater Lake | DENAIACQSFLNAGIASTLLDSDCAGAAGKGSDMA |
| Ga0209355_11632951 | 3300027744 | Freshwater Lake | KDENAIACQSFLNAGIASTFLDTDWAGAAGYGNDMV |
| Ga0209355_11848931 | 3300027744 | Freshwater Lake | QARRPNQSPKDENAIACQSFLNAGIASTFLDTDWAGAAGYGSDML |
| Ga0209355_13470352 | 3300027744 | Freshwater Lake | PSQSPNEENAMACQSFLNAGIANTLLDSDFAGAAGYGNDMG |
| Ga0209596_11056591 | 3300027754 | Freshwater Lake | ARSPNQSPKDENAIACQSFLNAGIASTLLDSDCAGGAGNGKDMA |
| Ga0209444_100820652 | 3300027756 | Freshwater Lake | RSPNQSPKDENAIACQSFLNAGIASTLLDSDCAGAAGNGKDMA |
| Ga0209296_11403262 | 3300027759 | Freshwater Lake | KDENAIACQSFLNAGIAKTLLDSDCAGAAGNGSDML |
| Ga0209296_12176962 | 3300027759 | Freshwater Lake | CWASAVEARSPSQSPKDEKAIACQSFLNAGIASTLRDSDCVGAAGYGNDMM |
| Ga0209296_13936422 | 3300027759 | Freshwater Lake | DENAIACQSFLNAGIASTLLDSDCAGAAGNGKDMA |
| Ga0209770_101984052 | 3300027769 | Freshwater Lake | SPKDENAIACQSFLNAGIASTFLDADWAGAAGYGNDML |
| Ga0209768_104339741 | 3300027772 | Freshwater Lake | PNEENAMACQSFLNAGIANTLLDSDCAGAAGYGNDIK |
| Ga0209246_100727781 | 3300027785 | Freshwater Lake | AVDARSPNQSPKDENAIACQSFLNAGIASTLLDSDCAGAAGNGKDMA |
| Ga0209972_103047491 | 3300027793 | Freshwater Lake | PSQSPNEENAIACQSFLNAGIASTLLDSDWAGADGYGNDMA |
| Ga0209353_103225552 | 3300027798 | Freshwater Lake | KDENAIACQSFLKAGIASTFLDTDWAGAAGYGSDMV |
| Ga0209358_104289741 | 3300027804 | Freshwater Lake | RRPNQSPKDENAIACQSFLNAGIASTFLDTDWAGAAGYGNDMV |
| Ga0209354_102194001 | 3300027808 | Freshwater Lake | NQSPKDENAIACQSFLNAGIASTLLDSDCAGAAGNGKDMA |
| Ga0209990_100843261 | 3300027816 | Freshwater Lake | NCCASAVEANNPSQSPKEENAIARQSFRNAGIAKTLLDCDCAGADGYGNDMG |
| Ga0209400_10560513 | 3300027963 | Freshwater Lake | RPSQSPKDENAIACQSFLNAGIASTFLDTDWAGAAGYGSDMV |
| Ga0209400_12481091 | 3300027963 | Freshwater Lake | PANCWASAVEASRPNQSPKDENAIACQSFLNAGIASTLLDSDCAGAAGKGSDMA |
| Ga0209191_10804612 | 3300027969 | Freshwater Lake | RPNQSPKDENAIACQSFLNAGIASTFLDTDWAGAAGYGNDMV |
| Ga0209191_11029281 | 3300027969 | Freshwater Lake | SPSQSPKDEKAIACQSFLNAGIASTLRDSDCAGAAGYGNDMA |
| Ga0209401_11710901 | 3300027971 | Freshwater Lake | SPKDENAIACQSFLNAGIASTLLDSDCAGAAGKGSDMA |
| Ga0209299_10669783 | 3300027974 | Freshwater Lake | SRPNQSPKDENAIACQSFLNAGIASTLLDSDCAGAAGNGKDMA |
| Ga0247723_10341932 | 3300028025 | Deep Subsurface Sediment | PNQSPNEEKAIACQSFLNAGIAKTLRDCACAGADGYGNDML |
| Ga0247722_100595273 | 3300028027 | Deep Subsurface Sediment | QSPKDENAIACQSFLNAGIARTLLDSDCAGAAGYGKDMA |
| (restricted) Ga0247838_11307771 | 3300028044 | Freshwater | PSQSPKDENAIACQSFLNAGIASTLLDSDCAGAAGYGKDMA |
| (restricted) Ga0247835_11168222 | 3300028114 | Freshwater | KDENAMACQSFLNAGIASTLLDSDCAGAAGYGKDMA |
| (restricted) Ga0247832_12885172 | 3300028557 | Freshwater | DENAIACQSFLNAGIASTLLDTDWAGAAGYGSDMV |
| (restricted) Ga0247844_12211641 | 3300028571 | Freshwater | SPKDENAIACQSFLNAGIASTLLDSDCAGAAGYGKDMA |
| Ga0315908_107781712 | 3300031786 | Freshwater | RSPSQSPNEENAMACQSFLNAGIANTLLDSDFAGAAGYGNDMA |
| Ga0315900_101232771 | 3300031787 | Freshwater | SPKDENAIACQSFLNAGIARTLRDSDCAGAAGYGNDMA |
| Ga0315909_101850141 | 3300031857 | Freshwater | SQSPNEENAIACQSFLNAGIASTLLDSDWAGADGYGNDMA |
| Ga0315904_104471742 | 3300031951 | Freshwater | RSPSQSPNEENAIACQSFLNAGIASTLLDSDWAGADGYGNDMM |
| Ga0315904_107936191 | 3300031951 | Freshwater | RSPSQSPNEENAIACQSFLNAGIASTLLDSDWAGADGYGNDMA |
| Ga0315904_111952391 | 3300031951 | Freshwater | AVEARSPSQSPNEENAIACQSFLNAGIASTLLDSDCAGADG |
| Ga0315906_103269582 | 3300032050 | Freshwater | VDASKPNQSPKEEKAIACQSFLNAGIAKTLRDCDCAGADRYGNDMG |
| Ga0315906_103841511 | 3300032050 | Freshwater | SPSQSPNEENAIACQSFLNAGIASTLLDSDWAGADGYGNDMA |
| Ga0315902_102900793 | 3300032093 | Freshwater | EASNPSQSPKDENAIAFQSFLNAGIASTLLDSDCAGADGYGKDMG |
| Ga0315903_100594231 | 3300032116 | Freshwater | NCWARAVQARRPNQSPKDENAIACQSFLKAGIASTLLDTDWAGGAGYGSDML |
| Ga0315903_103314372 | 3300032116 | Freshwater | RRPNQSPKDENAIACQSFLNAGIASTFLDADWAGAAGYGNDML |
| Ga0315903_107586091 | 3300032116 | Freshwater | NNPSQSPKEENAIARQSFRNAGIAKTLLDCDCAGADGYGNDMG |
| Ga0334980_0195739_3_152 | 3300033816 | Freshwater | NPSQSPKDENAIACQSFLNAGIARTLLDSDCAGAAGYGNDMAEEYLLSQ |
| Ga0334994_0142699_1_138 | 3300033993 | Freshwater | QARRPNQSPKDENAIACQSFLNAGIASTFLDADWAGAAGYGSDMV |
| Ga0334994_0249123_794_928 | 3300033993 | Freshwater | ASNPSQSPNDENAIAFQSFLNAGIASTLLDSDCAGADGYGKDMG |
| Ga0334996_0086798_1696_1848 | 3300033994 | Freshwater | WASAVEASNPSQSPNEENAIACQSFLNAGIASTLLDSDCAGADGYGKDMG |
| Ga0334996_0126571_1304_1453 | 3300033994 | Freshwater | ANAVEARSPSQSPNEENAIACQSFLNAGIASTLLDSDCAGADGYGNDMA |
| Ga0334996_0292020_3_167 | 3300033994 | Freshwater | WASAVEASNPSQSPNEENAIACQSFLNAGIASTLLDSDCAGADGYGKDMMEVYL |
| Ga0335003_0257083_3_170 | 3300033995 | Freshwater | PPANCWANAVEAKSPSQSPNDEKAIACQSFLNAGIASTLRDSDCAGAAGYGNDMA |
| Ga0334979_0162172_2_136 | 3300033996 | Freshwater | ARRPNQSPKDENAIACQSFLNAGIASTFLDADWAGAAGYGNDML |
| Ga0334985_0729699_410_532 | 3300034018 | Freshwater | SQSPNDENAIAFQSFLNAGIASTLLDSDCAGADGYGKDMG |
| Ga0334998_0140146_1_114 | 3300034019 | Freshwater | PNEENAIACQSFLNAGIASTLLDSDWAGADGYGNDMA |
| Ga0335024_0519463_2_163 | 3300034051 | Freshwater | ANAVEARSPSQSPKDEKAIACQSFLNAGIASTLLDSDCAGAAGYGKDMMEVYL |
| Ga0334987_0840138_361_504 | 3300034061 | Freshwater | SNPSQSPNDENAIAFQSFLNAGIASTLLDSDCAGADGYGKDMMEVYL |
| Ga0334995_0177762_2_136 | 3300034062 | Freshwater | ARRPNQSPKDENAIACQSFLNAGIASTFLDADWAGAAGYGSDMV |
| Ga0334995_0253386_1005_1181 | 3300034062 | Freshwater | CWAKAVEASNPSQSPKDENAIACQSFLNAGIARTLLDSDCAGAAGYGNDMDEEYLLSQ |
| Ga0334995_0278259_949_1107 | 3300034062 | Freshwater | NCWARAVEASNPSQSPNDENAIAFQSFLNAGIASTLLDSDCAGADGYGKDMG |
| Ga0335019_0066452_2302_2445 | 3300034066 | Freshwater | AVDANSPNQSPNDEKAIARQSLRNAGIDRTLLDSDCAGADGYGRDMM |
| Ga0335010_0156695_1_141 | 3300034092 | Freshwater | VQARRPNQSPKDENAIACQSFLNAGIASTFLDADWAGAAGYGSDMV |
| Ga0335012_0167942_1073_1183 | 3300034093 | Freshwater | KDENAIAFQSFRNAGIAKTLRDSDCAGADGYDSGMK |
| Ga0335012_0329150_2_115 | 3300034093 | Freshwater | PNDEKAIACQSFLNAGIASTLRDSDCAGAAGYGNDMA |
| Ga0335014_0266133_654_785 | 3300034094 | Freshwater | QSPNDENAIAFQSFLNAGIASTLLDSDCAGADGYGKDMMEVYL |
| Ga0335025_0389366_565_723 | 3300034096 | Freshwater | EASNPSQSPKDENAIACQSFLNAGIARTLLDSDCAGAAGYGNDMDEEYLLSQ |
| Ga0335030_0341224_3_110 | 3300034103 | Freshwater | DENAIACQSFLNAGIASTFLDADWAGAAGYGSDMV |
| Ga0335037_0299287_742_876 | 3300034107 | Freshwater | ANNPSQSPKEENAIARQSFRNAGIAKTLLDCDCAGADGYGNDML |
| Ga0335063_0616280_369_506 | 3300034111 | Freshwater | PSQSPNEENAIAFQSFLNAGIASTLLDSDCAGADGYGKDMMEVYL |
| Ga0335068_0453709_490_600 | 3300034116 | Freshwater | KDENAIACQSFLNAGIASTFLDADWAGAAGYGSDMV |
| Ga0335068_0486107_414_572 | 3300034116 | Freshwater | NCCANAVEARSPSQSPNEENAIACQSFLNAGIASTLLDSDCAGADGYGNDMA |
| Ga0335033_0182949_2_115 | 3300034117 | Freshwater | PKDENAIACQSFLNAGIASTFLDTDWAGAAGYGNDMV |
| Ga0335033_0564125_2_145 | 3300034117 | Freshwater | AVDAKSPSQSPKEENAIAFQSLRNAGIAKTLRDSDCAGADGYDSGMN |
| Ga0335053_0293626_886_1023 | 3300034118 | Freshwater | EASNPSQSPKDENAIACQSFLNAGIARTLLDSDCAGAAGYGNDMA |
| Ga0335054_0355299_719_847 | 3300034119 | Freshwater | NPSQSPKEENAIARQSFRNAGIAKTLLDCDCAGADGYGNDMG |
| Ga0335056_0108392_1546_1698 | 3300034120 | Freshwater | WARAVEASNPSQSPNDENAIAFQSFLNAGIASTLLDSDCAGADGYGKDMG |
| Ga0335056_0397101_3_113 | 3300034120 | Freshwater | KDENAIACQSFLNAGIASTLLDSDCAGAAGYGNDMA |
| Ga0335016_0188924_3_113 | 3300034166 | Freshwater | NEENAIACQSFLNAGIASTLLDSDWAGADGYGNDMA |
| Ga0335017_0471958_1_132 | 3300034167 | Freshwater | KSPSQSPNDEKAIACQSFLNAGIASTLRDSDCAGAAGYGNDMA |
| Ga0335065_0185259_1250_1366 | 3300034200 | Freshwater | SPKEENAIARQSFRNAGIAKTLLDCDCAGADGYGNDMG |
| Ga0335052_0131604_2_151 | 3300034279 | Freshwater | ARAVLARRPNQSPKDENAIACQSFLNAGIASTFLDTDWAGAAGYGNDMV |
| Ga0335052_0246089_888_1010 | 3300034279 | Freshwater | SQSPKEENAIARQSFRNAGIAKTLLDCDCAGADGYGNDIG |
| Ga0335052_0399649_622_732 | 3300034279 | Freshwater | NDENAIAFQSFLNAGIASTLLDSDCAGADGYGKDMG |
| Ga0335052_0412330_2_112 | 3300034279 | Freshwater | KDENAIACQSFLNAGIASTLRDSDCAGAAGYGNDMA |
| Ga0335052_0680590_341_505 | 3300034279 | Freshwater | PANCWANAVEARSPSQSPKDENAIACQSFLNAGIASTLRDSDCAGAAGYSRDTS |
| Ga0334997_0168188_1342_1452 | 3300034280 | Freshwater | KEENAIARQSFRNAGIAKTLLDCDCAGADGYGNDMG |
| Ga0335007_0151386_3_155 | 3300034283 | Freshwater | VEASNPSQSPNEENAIACQSFLNAGIASTLLDSDCAGADGYGKDMMEVYL |
| Ga0335007_0458092_652_777 | 3300034283 | Freshwater | PSQSPNEENAIACQSFLNAGIASTLLDSDCAGADGYGKDMG |
| Ga0335048_0350563_610_747 | 3300034356 | Freshwater | CCANAVDANSPNQSPNDEKAIARQSLRNAGIARTLLDSDCAGADG |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |