NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F009752

Metagenome / Metatranscriptome Family F009752

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F009752
Family Type Metagenome / Metatranscriptome
Number of Sequences 313
Average Sequence Length 96 residues
Representative Sequence MKVKAGLAKVGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Number of Associated Samples 225
Number of Associated Scaffolds 313

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 13.55 %
% of genes near scaffold ends (potentially truncated) 61.34 %
% of genes from short scaffolds (< 2000 bps) 99.04 %
Associated GOLD sequencing projects 208
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (98.083 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(33.227 % of family members)
Environment Ontology (ENVO) Unclassified
(69.010 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(78.275 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 48.36%    β-sheet: 0.00%    Coil/Unstructured: 51.64%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 313 Family Scaffolds
PF16363GDP_Man_Dehyd 0.32
PF03144GTP_EFTU_D2 0.32
PF00022Actin 0.32

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 313 Family Scaffolds
COG5277Actin-related proteinCytoskeleton [Z] 0.32


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.08 %
UnclassifiedrootN/A1.92 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001355|JGI20158J14315_10133569All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani785Open in IMG/M
3300001822|ACM39_119155All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani663Open in IMG/M
3300005516|Ga0066831_10060009All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1029Open in IMG/M
3300006357|Ga0075502_1637861All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani509Open in IMG/M
3300006357|Ga0075502_1649922All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani653Open in IMG/M
3300006390|Ga0075509_1495249All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani562Open in IMG/M
3300006397|Ga0075488_1071453All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani648Open in IMG/M
3300006401|Ga0075506_1750881All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani586Open in IMG/M
3300007513|Ga0105019_1217718All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani921Open in IMG/M
3300007552|Ga0102818_1093411All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani596Open in IMG/M
3300007658|Ga0102898_1151114All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani546Open in IMG/M
3300007725|Ga0102951_1131574All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani706Open in IMG/M
3300007760|Ga0105018_1140183All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani769Open in IMG/M
3300007760|Ga0105018_1146603All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani722Open in IMG/M
3300008958|Ga0104259_1021307All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani648Open in IMG/M
3300008993|Ga0104258_1085649All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani589Open in IMG/M
3300008993|Ga0104258_1110793All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani513Open in IMG/M
3300009024|Ga0102811_1335364All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani568Open in IMG/M
3300009054|Ga0102826_1068061All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani857Open in IMG/M
3300009071|Ga0115566_10454585All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani731Open in IMG/M
3300009077|Ga0115552_1170127All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani906Open in IMG/M
3300009086|Ga0102812_10398975All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani748Open in IMG/M
3300009151|Ga0114962_10435986All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani703Open in IMG/M
3300009172|Ga0114995_10263744All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani950Open in IMG/M
3300009193|Ga0115551_1200343All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani897Open in IMG/M
3300009193|Ga0115551_1348415All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani642Open in IMG/M
3300009432|Ga0115005_10664216All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani836Open in IMG/M
3300009432|Ga0115005_11369072All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani578Open in IMG/M
3300009436|Ga0115008_10351711All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1045Open in IMG/M
3300009436|Ga0115008_10375722All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1008Open in IMG/M
3300009441|Ga0115007_11111003All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani547Open in IMG/M
3300009442|Ga0115563_1213209All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani736Open in IMG/M
3300009445|Ga0115553_1258311All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani680Open in IMG/M
3300009447|Ga0115560_1173241All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani847Open in IMG/M
3300009466|Ga0126448_1054551All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani917Open in IMG/M
3300009466|Ga0126448_1100548All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani655Open in IMG/M
3300009470|Ga0126447_1076791All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani817Open in IMG/M
3300009472|Ga0115554_1286437All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani653Open in IMG/M
3300009476|Ga0115555_1348315All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani592Open in IMG/M
3300009495|Ga0115571_1331973All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani602Open in IMG/M
3300009508|Ga0115567_10789917All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani566Open in IMG/M
3300009543|Ga0115099_10372383All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani582Open in IMG/M
3300009543|Ga0115099_10496938All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani793Open in IMG/M
3300009592|Ga0115101_1065952All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani740Open in IMG/M
3300009599|Ga0115103_1209968All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani823Open in IMG/M
3300009599|Ga0115103_1544814All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani742Open in IMG/M
3300009606|Ga0115102_10187770All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani538Open in IMG/M
3300009606|Ga0115102_10400424All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani527Open in IMG/M
3300009606|Ga0115102_10415751All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani533Open in IMG/M
3300009677|Ga0115104_10073976All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani598Open in IMG/M
3300009677|Ga0115104_10235249All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani602Open in IMG/M
3300009677|Ga0115104_10481884All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani505Open in IMG/M
3300009677|Ga0115104_11197601All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani658Open in IMG/M
3300009679|Ga0115105_10645271All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani560Open in IMG/M
3300009679|Ga0115105_10674740All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani716Open in IMG/M
3300009679|Ga0115105_10816560All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani502Open in IMG/M
3300009679|Ga0115105_10963336All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani558Open in IMG/M
3300009732|Ga0123373_112081All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani799Open in IMG/M
3300009735|Ga0123377_1071675All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani517Open in IMG/M
3300009785|Ga0115001_10972690All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani509Open in IMG/M
3300010316|Ga0136655_1158646All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani675Open in IMG/M
3300010354|Ga0129333_10747830All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani837Open in IMG/M
3300010981|Ga0138316_10079494All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani625Open in IMG/M
3300010987|Ga0138324_10040380Not Available1680Open in IMG/M
3300010987|Ga0138324_10454457All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani631Open in IMG/M
3300012413|Ga0138258_1769805All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani727Open in IMG/M
3300012414|Ga0138264_1680745All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani595Open in IMG/M
3300012418|Ga0138261_1224255All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani543Open in IMG/M
3300012523|Ga0129350_1245593All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani520Open in IMG/M
3300012523|Ga0129350_1384416All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani788Open in IMG/M
3300012953|Ga0163179_11095581All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani699Open in IMG/M
3300012953|Ga0163179_11789491All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani561Open in IMG/M
3300013004|Ga0164293_10737796All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani628Open in IMG/M
3300016732|Ga0182057_1257357All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani587Open in IMG/M
3300016733|Ga0182042_1235068All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani505Open in IMG/M
3300016736|Ga0182049_1049835All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani539Open in IMG/M
3300016766|Ga0182091_1440132All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani649Open in IMG/M
3300017751|Ga0187219_1211644All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani532Open in IMG/M
3300017771|Ga0181425_1065199All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1178Open in IMG/M
3300017957|Ga0181571_10472442All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani769Open in IMG/M
3300018041|Ga0181601_10692242All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani514Open in IMG/M
3300018428|Ga0181568_10927098All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani667Open in IMG/M
3300018515|Ga0192960_103138All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani779Open in IMG/M
3300018567|Ga0188858_110760All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani514Open in IMG/M
3300018599|Ga0188834_1028770All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani560Open in IMG/M
3300018614|Ga0188846_1043153All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani505Open in IMG/M
3300018617|Ga0193133_1019930All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani574Open in IMG/M
3300018622|Ga0188862_1023132All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani584Open in IMG/M
3300018628|Ga0193355_1015096All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani712Open in IMG/M
3300018649|Ga0192969_1028755All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani879Open in IMG/M
3300018684|Ga0192983_1018084All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani922Open in IMG/M
3300018692|Ga0192944_1020615All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani925Open in IMG/M
3300018692|Ga0192944_1022065All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani900Open in IMG/M
3300018725|Ga0193517_1057363All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani671Open in IMG/M
3300018725|Ga0193517_1076975All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani530Open in IMG/M
3300018730|Ga0192967_1077942All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani540Open in IMG/M
3300018732|Ga0193381_1056441All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani537Open in IMG/M
3300018745|Ga0193000_1053275All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani605Open in IMG/M
3300018745|Ga0193000_1072509All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani505Open in IMG/M
3300018765|Ga0193031_1084150All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani537Open in IMG/M
3300018782|Ga0192832_1065704All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani505Open in IMG/M
3300018787|Ga0193124_1041123All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani680Open in IMG/M
3300018791|Ga0192950_1049336All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani622Open in IMG/M
3300018791|Ga0192950_1054042All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani597Open in IMG/M
3300018806|Ga0192898_1089117All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani516Open in IMG/M
3300018827|Ga0193366_1048164All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani615Open in IMG/M
3300018831|Ga0192949_1090945All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani584Open in IMG/M
3300018832|Ga0194240_1019052All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani633Open in IMG/M
3300018832|Ga0194240_1032122All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani531Open in IMG/M
3300018836|Ga0192870_1091748All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani508Open in IMG/M
3300018838|Ga0193302_1051797All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani696Open in IMG/M
3300018846|Ga0193253_1080497All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani783Open in IMG/M
3300018846|Ga0193253_1094104All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani706Open in IMG/M
3300018846|Ga0193253_1132676All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani549Open in IMG/M
3300018871|Ga0192978_1043165All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani848Open in IMG/M
3300018905|Ga0193028_1078286All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani654Open in IMG/M
3300018913|Ga0192868_10025461All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani819Open in IMG/M
3300018913|Ga0192868_10059835All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani600Open in IMG/M
3300018913|Ga0192868_10065435All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani580Open in IMG/M
3300018932|Ga0192820_10157101All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani535Open in IMG/M
3300018961|Ga0193531_10261679All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani618Open in IMG/M
3300018967|Ga0193178_10070118All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani546Open in IMG/M
3300018968|Ga0192894_10127971All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani800Open in IMG/M
3300018968|Ga0192894_10220334All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani631Open in IMG/M
3300018968|Ga0192894_10326722All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani514Open in IMG/M
3300018974|Ga0192873_10295494All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani690Open in IMG/M
3300018980|Ga0192961_10242321All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani531Open in IMG/M
3300018989|Ga0193030_10096485All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani901Open in IMG/M
3300018989|Ga0193030_10104866All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani874Open in IMG/M
3300018989|Ga0193030_10153660All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani746Open in IMG/M
3300018989|Ga0193030_10166775All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani718Open in IMG/M
3300018989|Ga0193030_10172871All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani706Open in IMG/M
3300018989|Ga0193030_10188370All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani678Open in IMG/M
3300018989|Ga0193030_10191261All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani672Open in IMG/M
3300018989|Ga0193030_10221538All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani622Open in IMG/M
3300018989|Ga0193030_10229488All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani610Open in IMG/M
3300018989|Ga0193030_10268692All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani557Open in IMG/M
3300018997|Ga0193257_10192288All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani598Open in IMG/M
3300019001|Ga0193034_10148629All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani568Open in IMG/M
3300019021|Ga0192982_10294245All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani583Open in IMG/M
3300019031|Ga0193516_10172376All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani725Open in IMG/M
3300019031|Ga0193516_10175601All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani717Open in IMG/M
3300019031|Ga0193516_10194899All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani673Open in IMG/M
3300019031|Ga0193516_10256641All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani568Open in IMG/M
3300019032|Ga0192869_10262545All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani749Open in IMG/M
3300019032|Ga0192869_10289909All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani713Open in IMG/M
3300019032|Ga0192869_10398773All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani598Open in IMG/M
3300019032|Ga0192869_10420930All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani579Open in IMG/M
3300019033|Ga0193037_10264670All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani599Open in IMG/M
3300019036|Ga0192945_10108710All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani877Open in IMG/M
3300019036|Ga0192945_10281081All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani522Open in IMG/M
3300019037|Ga0192886_10251186All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani579Open in IMG/M
3300019037|Ga0192886_10286114All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani545Open in IMG/M
3300019045|Ga0193336_10281323All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani721Open in IMG/M
3300019045|Ga0193336_10323607All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani688Open in IMG/M
3300019045|Ga0193336_10558218All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani558Open in IMG/M
3300019050|Ga0192966_10199306All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani716Open in IMG/M
3300019051|Ga0192826_10259188All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani639Open in IMG/M
3300019051|Ga0192826_10301052All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani586Open in IMG/M
3300019051|Ga0192826_10332295All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani552Open in IMG/M
3300019051|Ga0192826_10383416All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani507Open in IMG/M
3300019095|Ga0188866_1014293All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani814Open in IMG/M
3300019097|Ga0193153_1030067All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani558Open in IMG/M
3300019100|Ga0193045_1047354All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani701Open in IMG/M
3300019103|Ga0192946_1040798All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani697Open in IMG/M
3300019103|Ga0192946_1055803All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani581Open in IMG/M
3300019108|Ga0192972_1079791All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani584Open in IMG/M
3300019117|Ga0193054_1036358All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani740Open in IMG/M
3300019118|Ga0193157_1029088All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani575Open in IMG/M
3300019123|Ga0192980_1074986All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani625Open in IMG/M
3300019149|Ga0188870_10067919All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani870Open in IMG/M
3300019150|Ga0194244_10046327All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani701Open in IMG/M
3300019150|Ga0194244_10063730All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani635Open in IMG/M
3300019191|Ga0180035_1104522All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani573Open in IMG/M
3300019253|Ga0182064_1150886All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani578Open in IMG/M
3300019261|Ga0182097_1090450All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani534Open in IMG/M
3300020013|Ga0182086_1307866All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani512Open in IMG/M
3300020165|Ga0206125_10254547All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani667Open in IMG/M
3300020175|Ga0206124_10333907All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani573Open in IMG/M
3300020182|Ga0206129_10219239All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani825Open in IMG/M
3300020372|Ga0211683_10285224All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani514Open in IMG/M
3300020382|Ga0211686_10287738All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani674Open in IMG/M
3300021169|Ga0206687_1535874All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani585Open in IMG/M
3300021334|Ga0206696_1479715All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani784Open in IMG/M
3300021345|Ga0206688_10965817All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani574Open in IMG/M
3300021345|Ga0206688_11052622All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani525Open in IMG/M
3300021350|Ga0206692_1187807All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani536Open in IMG/M
3300021355|Ga0206690_10258791All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani539Open in IMG/M
3300021355|Ga0206690_10450933All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani540Open in IMG/M
3300021359|Ga0206689_10691316All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani584Open in IMG/M
3300021359|Ga0206689_11216106All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani622Open in IMG/M
3300021890|Ga0063090_1069961All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani513Open in IMG/M
3300021899|Ga0063144_1009681All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani564Open in IMG/M
3300021902|Ga0063086_1014453All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani669Open in IMG/M
3300021902|Ga0063086_1103471All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani559Open in IMG/M
3300021913|Ga0063104_1061127All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani521Open in IMG/M
3300021927|Ga0063103_1106277All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani501Open in IMG/M
3300021927|Ga0063103_1115043All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani538Open in IMG/M
3300021928|Ga0063134_1090240All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani595Open in IMG/M
3300021935|Ga0063138_1118112All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani511Open in IMG/M
3300021937|Ga0063754_1093116All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani526Open in IMG/M
3300021941|Ga0063102_1000265All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani682Open in IMG/M
3300021941|Ga0063102_1018133All Organisms → cellular organisms → Eukaryota1837Open in IMG/M
3300021962|Ga0222713_10631355All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani620Open in IMG/M
3300023679|Ga0232113_1023609All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani661Open in IMG/M
3300023683|Ga0228681_1020379All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani762Open in IMG/M
3300023696|Ga0228687_1022265All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani729Open in IMG/M
3300023696|Ga0228687_1040108All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani554Open in IMG/M
3300024420|Ga0228632_1122045All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani608Open in IMG/M
3300025570|Ga0208660_1125979All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani540Open in IMG/M
3300025620|Ga0209405_1142028All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani630Open in IMG/M
3300025685|Ga0209095_1158488All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani653Open in IMG/M
3300025690|Ga0209505_1131931All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani679Open in IMG/M
3300025699|Ga0209715_1112317All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani983Open in IMG/M
3300026443|Ga0247559_1088379All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani653Open in IMG/M
3300026448|Ga0247594_1077384All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani580Open in IMG/M
3300026448|Ga0247594_1103391All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani504Open in IMG/M
3300026458|Ga0247578_1094951All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani584Open in IMG/M
3300026461|Ga0247600_1080063All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani643Open in IMG/M
3300026465|Ga0247588_1093721All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani600Open in IMG/M
3300026465|Ga0247588_1129900All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani507Open in IMG/M
3300026468|Ga0247603_1110443All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani567Open in IMG/M
3300026495|Ga0247571_1071465All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani795Open in IMG/M
3300026495|Ga0247571_1178885All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani504Open in IMG/M
3300026500|Ga0247592_1099096All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani703Open in IMG/M
3300026500|Ga0247592_1145214All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani566Open in IMG/M
3300026503|Ga0247605_1177722All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani508Open in IMG/M
3300026503|Ga0247605_1178033All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani508Open in IMG/M
3300027159|Ga0208020_1022576All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1232Open in IMG/M
3300027188|Ga0208921_1041830All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani678Open in IMG/M
3300027188|Ga0208921_1067935All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani514Open in IMG/M
3300027191|Ga0208021_1050511All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani621Open in IMG/M
3300027687|Ga0209710_1238647All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani595Open in IMG/M
3300027749|Ga0209084_1232722All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani725Open in IMG/M
3300027751|Ga0208304_10252757All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani625Open in IMG/M
3300027752|Ga0209192_10143007All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani950Open in IMG/M
3300027757|Ga0208671_10265517All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani609Open in IMG/M
3300027810|Ga0209302_10506052All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani535Open in IMG/M
3300027833|Ga0209092_10415175All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani702Open in IMG/M
3300027833|Ga0209092_10477345All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani641Open in IMG/M
3300028134|Ga0256411_1155661All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani747Open in IMG/M
3300028134|Ga0256411_1219115All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani596Open in IMG/M
3300028137|Ga0256412_1214385All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani711Open in IMG/M
3300028137|Ga0256412_1228563All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani687Open in IMG/M
3300028137|Ga0256412_1232100All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani681Open in IMG/M
3300028137|Ga0256412_1391216All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani510Open in IMG/M
3300028233|Ga0256417_1202457All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani530Open in IMG/M
3300028282|Ga0256413_1320466All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani544Open in IMG/M
3300028290|Ga0247572_1154159All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani574Open in IMG/M
3300028575|Ga0304731_10879791All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani625Open in IMG/M
3300030670|Ga0307401_10279341All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani758Open in IMG/M
3300030699|Ga0307398_10720379All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani553Open in IMG/M
3300030722|Ga0308137_1055880All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani703Open in IMG/M
3300030780|Ga0073988_12285171All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani646Open in IMG/M
3300030780|Ga0073988_12301280All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani521Open in IMG/M
3300030788|Ga0073964_11406049All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani516Open in IMG/M
3300030856|Ga0073990_10003589All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani527Open in IMG/M
3300030856|Ga0073990_11885253All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani519Open in IMG/M
3300030856|Ga0073990_12027484All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani610Open in IMG/M
3300030856|Ga0073990_12045912All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani578Open in IMG/M
3300030857|Ga0073981_11639210All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani559Open in IMG/M
3300031032|Ga0073980_11357232All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani554Open in IMG/M
3300031038|Ga0073986_11885061All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani520Open in IMG/M
3300031062|Ga0073989_13332362All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani670Open in IMG/M
3300031062|Ga0073989_13362608All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani506Open in IMG/M
3300031062|Ga0073989_13441795All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani566Open in IMG/M
3300031062|Ga0073989_13550277All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani590Open in IMG/M
3300031540|Ga0308143_115593All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani761Open in IMG/M
3300031569|Ga0307489_10382710All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani932Open in IMG/M
3300031580|Ga0308132_1089591All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani632Open in IMG/M
3300031710|Ga0307386_10751821All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani524Open in IMG/M
3300031734|Ga0307397_10623511All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani506Open in IMG/M
3300031735|Ga0307394_10206250All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani772Open in IMG/M
3300031737|Ga0307387_10898524All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani562Open in IMG/M
3300031737|Ga0307387_10990327All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani536Open in IMG/M
3300031743|Ga0307382_10379724All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani640Open in IMG/M
3300031743|Ga0307382_10434533All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani598Open in IMG/M
3300031743|Ga0307382_10523234All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani544Open in IMG/M
3300031750|Ga0307389_10478729All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani796Open in IMG/M
3300031750|Ga0307389_10913963All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani579Open in IMG/M
3300031758|Ga0315907_10764202All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani726Open in IMG/M
3300032150|Ga0314779_1035672All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani503Open in IMG/M
3300032463|Ga0314684_10689982All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani588Open in IMG/M
3300032481|Ga0314668_10416107All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani693Open in IMG/M
3300032481|Ga0314668_10544533All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani591Open in IMG/M
3300032481|Ga0314668_10652564All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani527Open in IMG/M
3300032517|Ga0314688_10255794All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani920Open in IMG/M
3300032518|Ga0314689_10460965All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani666Open in IMG/M
3300032521|Ga0314680_10802064All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani593Open in IMG/M
3300032617|Ga0314683_10779783All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani577Open in IMG/M
3300032650|Ga0314673_10288790All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani826Open in IMG/M
3300032650|Ga0314673_10442769All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani669Open in IMG/M
3300032651|Ga0314685_10795006All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani502Open in IMG/M
3300032666|Ga0314678_10306763All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani714Open in IMG/M
3300032707|Ga0314687_10740883All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani545Open in IMG/M
3300032708|Ga0314669_10301925All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani860Open in IMG/M
3300032711|Ga0314681_10367227All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani804Open in IMG/M
3300032724|Ga0314695_1392898All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani526Open in IMG/M
3300032727|Ga0314693_10336003All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani816Open in IMG/M
3300032728|Ga0314696_10590512All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani566Open in IMG/M
3300032729|Ga0314697_10367995All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani640Open in IMG/M
3300032730|Ga0314699_10346583All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani669Open in IMG/M
3300032730|Ga0314699_10553469All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani516Open in IMG/M
3300032733|Ga0314714_10323045All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani869Open in IMG/M
3300032750|Ga0314708_10473583All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani606Open in IMG/M
3300032754|Ga0314692_10363030All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani784Open in IMG/M
3300033572|Ga0307390_11028516All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani523Open in IMG/M
3300033984|Ga0334989_0383068All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani727Open in IMG/M
3300034022|Ga0335005_0338845Not Available881Open in IMG/M
3300034068|Ga0334990_0290465Not Available889Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine33.23%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine19.49%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater9.27%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater7.67%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine4.79%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine3.83%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater3.51%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh3.19%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous2.56%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake1.92%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.28%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.96%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.96%
Meromictic PondEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond0.96%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.96%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine0.96%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.32%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.32%
Marine PlanktonEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton0.32%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.32%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.32%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.32%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake0.32%
WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water0.32%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.64%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.64%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.64%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001355Pelagic Microbial community sample from North Sea - COGITO 998_met_08EnvironmentalOpen in IMG/M
3300001822Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM39, ROCA_DNA108_2.0um_23aEnvironmentalOpen in IMG/M
3300005516Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49BEnvironmentalOpen in IMG/M
3300006357Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006390Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006397Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006401Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007513Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300007552Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.571EnvironmentalOpen in IMG/M
3300007658Estuarine microbial communities from the Columbia River estuary - metaG 1555A-3EnvironmentalOpen in IMG/M
3300007725Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MGEnvironmentalOpen in IMG/M
3300007760Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate aEnvironmentalOpen in IMG/M
3300008958Marine microbial communities from eastern North Pacific Ocean - P1 particle-associatedEnvironmentalOpen in IMG/M
3300008993Marine microbial communities from eastern North Pacific Ocean - P1 free-livingEnvironmentalOpen in IMG/M
3300009024Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705EnvironmentalOpen in IMG/M
3300009054Estuarine microbial communities from the Columbia River estuary - metaG S.737EnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009077Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328EnvironmentalOpen in IMG/M
3300009086Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713EnvironmentalOpen in IMG/M
3300009151Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaGEnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009193Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009442Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519EnvironmentalOpen in IMG/M
3300009445Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331EnvironmentalOpen in IMG/M
3300009447Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509EnvironmentalOpen in IMG/M
3300009466Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 2m depth; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300009470Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, surface; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300009472Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404EnvironmentalOpen in IMG/M
3300009476Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407EnvironmentalOpen in IMG/M
3300009495Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531EnvironmentalOpen in IMG/M
3300009508Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412EnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009732Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_232_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009735Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_240_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300010316Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNAEnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010981Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4)EnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300012036Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 2 #698EnvironmentalOpen in IMG/M
3300012413Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA6.ICE_1m.20151110 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012414Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA16.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012418Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA12.A_72.20151113 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012523Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300016732Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101403AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016733Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011501AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016736Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011508BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016766Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041409AS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017751Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2)EnvironmentalOpen in IMG/M
3300017771Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13EnvironmentalOpen in IMG/M
3300017957Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018041Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018428Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018515Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782216-ERR1712231)EnvironmentalOpen in IMG/M
3300018567Metatranscriptome of marine microbial communities from Baltic Sea - GS683_3p0_dTEnvironmentalOpen in IMG/M
3300018599Metatranscriptome of marine microbial communities from Baltic Sea - GS675_3p0_dTEnvironmentalOpen in IMG/M
3300018614Metatranscriptome of marine microbial communities from Baltic Sea - GS678_3p0_dTEnvironmentalOpen in IMG/M
3300018617Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000604 (ERX1782236-ERR1711896)EnvironmentalOpen in IMG/M
3300018622Metatranscriptome of marine microbial communities from Baltic Sea - GS684_3p0_dTEnvironmentalOpen in IMG/M
3300018628Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001820 (ERX1782125-ERR1711885)EnvironmentalOpen in IMG/M
3300018649Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782476-ERR1712161)EnvironmentalOpen in IMG/M
3300018684Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782225-ERR1712160)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018725Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782256-ERR1712230)EnvironmentalOpen in IMG/M
3300018730Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782285-ERR1712028)EnvironmentalOpen in IMG/M
3300018732Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001992 (ERX1789574-ERR1719298)EnvironmentalOpen in IMG/M
3300018745Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001746 (ERX1782385-ERR1712134)EnvironmentalOpen in IMG/M
3300018765Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782330-ERR1712010)EnvironmentalOpen in IMG/M
3300018766Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000317 (ERX1789428-ERR1719465)EnvironmentalOpen in IMG/M
3300018782Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000570 (ERX1782313-ERR1712019)EnvironmentalOpen in IMG/M
3300018787Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001288 (ERX1789595-ERR1719164)EnvironmentalOpen in IMG/M
3300018791Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782108-ERR1712085)EnvironmentalOpen in IMG/M
3300018806Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000722 (ERX1789621-ERR1719484)EnvironmentalOpen in IMG/M
3300018827Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_122 - TARA_N000001938 (ERX1782415-ERR1712182)EnvironmentalOpen in IMG/M
3300018831Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001386 (ERX1789378-ERR1719149)EnvironmentalOpen in IMG/M
3300018832Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000852 (ERX1782372-ERR1712031)EnvironmentalOpen in IMG/M
3300018836Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000807 (ERX1789715-ERR1719504)EnvironmentalOpen in IMG/M
3300018838Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001646 (ERX1789439-ERR1719515)EnvironmentalOpen in IMG/M
3300018846Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)EnvironmentalOpen in IMG/M
3300018871Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001026 (ERX1789475-ERR1719345)EnvironmentalOpen in IMG/M
3300018905Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002775 (ERX1789358-ERR1719472)EnvironmentalOpen in IMG/M
3300018913Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782451-ERR1712205)EnvironmentalOpen in IMG/M
3300018932Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000051 (ERX1782293-ERR1711916)EnvironmentalOpen in IMG/M
3300018961Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002783 (ERX1789414-ERR1719458)EnvironmentalOpen in IMG/M
3300018967Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000316 (ERX1789557-ERR1719488)EnvironmentalOpen in IMG/M
3300018968Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000713 (ERX1782205-ERR1712096)EnvironmentalOpen in IMG/M
3300018974Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782160-ERR1711971)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300018997Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001303 (ERX1789387-ERR1719468)EnvironmentalOpen in IMG/M
3300019001Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001043 (ERX1782383-ERR1712007)EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019033Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000067 (ERX1782334-ERR1712080)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019037Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000703 (ERX1782146-ERR1712183)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300019051Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227)EnvironmentalOpen in IMG/M
3300019095Metatranscriptome of marine microbial communities from Baltic Sea - GS694_3p0_dTEnvironmentalOpen in IMG/M
3300019097Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000393 (ERX1782443-ERR1712022)EnvironmentalOpen in IMG/M
3300019100Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809468-ERR1739839)EnvironmentalOpen in IMG/M
3300019103Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782358-ERR1712021)EnvironmentalOpen in IMG/M
3300019108Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001017 (ERX1809742-ERR1740135)EnvironmentalOpen in IMG/M
3300019117Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002348 (ERX1782351-ERR1711912)EnvironmentalOpen in IMG/M
3300019118Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000396 (ERX1782223-ERR1711898)EnvironmentalOpen in IMG/M
3300019123Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782390-ERR1712195)EnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300019150Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782105-ERR1711908)EnvironmentalOpen in IMG/M
3300019191Estuarine microbial communities from the Columbia River estuary - R.880 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019253Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101410AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019261Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041413BS (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020013Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041406CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020165Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1EnvironmentalOpen in IMG/M
3300020175Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2EnvironmentalOpen in IMG/M
3300020182Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2EnvironmentalOpen in IMG/M
3300020372Marine microbial communities from Tara Oceans - TARA_B100000787 (ERX556133-ERR599090)EnvironmentalOpen in IMG/M
3300020382Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX556058-ERR599059)EnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021334Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021345Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021355Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 150m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021359Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021890Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-3M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021899Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S27 C1 B23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021902Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021913Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-130M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021927Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-122M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021928Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S9 C1 B7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021935Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S17 C1 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021937Marine eukaryotic phytoplankton communities from the South Atlantic Ocean - 30m ANT-15 Euk ARK-20-2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021941Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-120M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300023679Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 32R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023683Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 22R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023696Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 52R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024420Seawater microbial communities from Monterey Bay, California, United States - 40DEnvironmentalOpen in IMG/M
3300025570Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025620Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 (SPAdes)EnvironmentalOpen in IMG/M
3300025685Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 (SPAdes)EnvironmentalOpen in IMG/M
3300025690Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331 (SPAdes)EnvironmentalOpen in IMG/M
3300025699Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 (SPAdes)EnvironmentalOpen in IMG/M
3300026443Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 4R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026448Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026458Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 36R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026461Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 75R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026462Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 17R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026465Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 48R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026468Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 79R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026500Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026503Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027159Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573 (SPAdes)EnvironmentalOpen in IMG/M
3300027188Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709 (SPAdes)EnvironmentalOpen in IMG/M
3300027191Estuarine microbial communities from the Columbia River estuary - metaG S.737 (SPAdes)EnvironmentalOpen in IMG/M
3300027687Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes)EnvironmentalOpen in IMG/M
3300027749Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027751Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 (SPAdes)EnvironmentalOpen in IMG/M
3300027752Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes)EnvironmentalOpen in IMG/M
3300027757Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 (SPAdes)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028134Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_12 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028233Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - MB_1026D (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028290Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028575Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030670Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030722Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_943_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030780Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S19_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030788Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_R_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030856Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S23_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030857Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S5_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031032Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S2_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031038Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S14_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031062Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S21_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031540Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_544_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031580Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1111_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031735Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031737Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031743Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031750Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300032150Metatranscriptome of sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB 2018 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300032463Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032481Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032518Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032521Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032617Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032650Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032651Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032666Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032707Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032708Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032711Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032724Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032727Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032728Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032729Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032730Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032733Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032750Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032754Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033984Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030EnvironmentalOpen in IMG/M
3300034022Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058EnvironmentalOpen in IMG/M
3300034068Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI20158J14315_1013356923300001355Pelagic MarineMEIKGKLAEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW*
ACM39_11915513300001822Marine PlanktonTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGLALERFIKVAKQVRSNLNDKYDIGFIDPGVEGDWQ*
Ga0066831_1006000913300005516MarineMENWNNAQKIVGGLSKQGKSPAWAVSTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNSLALKRFIEVAKKVRANLNDKYDIGFIDPGVEGDWQ*
Ga0075502_163786113300006357AqueousFEMTNWNNAMEIAAGLAKQGKTPRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALKRFIEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0075502_164992223300006357AqueousMHNWDNAMEIKSKLQEKGANPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNANLSNHLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0075509_149524923300006390AqueousEEELAFQLGSFSRNFEMTNWNNAMEIAAGLAKQGKTPRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALKRFIEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0075488_107145313300006397AqueousEDELHYQLGEFSRNFDMKNWDNAMKIRGELADKGQTPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0075506_175088123300006401AqueousMEIKSKLQEKGANPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNANLSNHLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0105019_121771813300007513MarineVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNANLSNKLALKRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0102818_109341113300007552EstuarineMKNWQNAMTILGELKKNGKTPKYAVTTKELYDHSFSFPKVRNYDYAIEQMTDLENVEDNLNKNLTNDYALTRFIEVAKKVRANLNKKYDIGFMDPGVEGDWQ*
Ga0102898_115111413300007658EstuarineNAIKIRDELAKQGKPVKIAVTTKELYDHSFSFPKVRNHDYAVEQMNELEHYEDNLNQNIDNSLALARFVEVAKKVRANLNAKYDIGFIDPGVDGDW*
Ga0102951_113157423300007725WaterVTTKELYDKSFSFPKVRNYDYAVDQMNQLEAAEDNLNKNLSNAGALSFFLKTAKQVRANLNDKYDVGFMDPGVESDKE*
Ga0105018_114018323300007760MarineMKNWGNAMYVKGELGKSGKNPKFAVTTKELYDKSFSFPKVRNYDYAVAQMNELEHYEDNLNANLSNNLALTRFIDVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0105018_114660313300007760MarineELHYQLGEFSRNFGMENWDNAMKISAGLSKEGKTPKYAVTTKELYDHSFSFPKVRNYDYAVENMNELEHYEDNLNNNLSNGYALQKFIAVAKKVR*
Ga0104259_102130713300008958Ocean WaterMENWNNAMKIKGALGSKVKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHFEDNLNNNLSNALALERFITVAKKVRANLNDKYDIGFVDPGVESDWQ*
Ga0104258_108564913300008993Ocean WaterRNFNMDNWDNAMKVKGGLAKLGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKTRANLNDKYDIGFIDPGVEGDW*
Ga0104258_111079313300008993Ocean WaterMFSRSFEMASWNNAMEIASGLAKTGKTPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALKRFIEVAKKVRANLNDKYDIGFVDPGVEGDWQ*
Ga0102811_133536413300009024EstuarineEFSRNFDIKNWENAMTIRSGLAGSGQTPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNANLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0102826_106806123300009054EstuarineMKNWDNAMEIKGKLAGSGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0115566_1045458523300009071Pelagic MarineSFQLGQFSRNFEMTAWNNAMEIAAGLAKSGKTPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0115552_117012713300009077Pelagic MarineMESWNNAMHIKKELSKKKGINAKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ*
Ga0102812_1039897513300009086EstuarinePLEISEEELSFQLGQFSRNFEMSAWNNAMEIAAGLAKSGKTPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0114962_1043598613300009151Freshwater LakeVTTKELYDKSFSFPKVRNYDFTVEQMTELEHFEDNLNSNLSNELALTRFIEVAKKVRANLNDKWGSAFIDPGSY*
Ga0114995_1026374433300009172MarineMENWNNAMKIKGALGAKVKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHFEDNLNNNLSNALALERFITVAKKVRANLNDKYDIGFVDPGVESDWQ*
Ga0115551_120034323300009193Pelagic MarineMDNWDNAMKVKKGLSKVGKSPKFAVTTKELYDKSFSFPKVRNYDYATEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0115551_134841523300009193Pelagic MarineGKTPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0115005_1066421623300009432MarineMEIKGGLAGSGANPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNANLSNNLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0115005_1136907223300009432MarineMKNWDNAMEIKGKLGESGSAPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0115008_1035171133300009436MarineMENWNNAMYINKKLKKKGIFPKYAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLGNGLALERFVKVAKQVRSNLNDKYDIGFIDPGVEGDWQ*
Ga0115008_1037572213300009436MarineMENWDNAIKIKKALEEKGSKPSYAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNTNNMNSLALKRFVEVAKKVRANLNDKYDIGFIDPGVEGDWQ*
Ga0115007_1111100313300009441MarineGKLAETGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0115563_121320913300009442Pelagic MarineLGEFSRNFNQDNWDNSQKVLAGLKKEGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0115553_125831113300009445Pelagic MarineKFAVTTKELYDKSFSFPKVRNYDYATEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0115560_117324123300009447Pelagic MarineMKNWDNAMEIKGKLAEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0126448_105455113300009466Meromictic PondVTTKELYDKSFSFPKVRNYDYAVDQMNQLEAAEDNLNKNLSNSKALSHFLEVAKKVRSNLNDKYD
Ga0126448_110054813300009466Meromictic PondMKFWDNAMKIKEELGKKGINPRFAVTTKELYDHSFSFPKVRNYDYAVEQMNELEHYEDNLNNNISNSLALHRFIEVAKKVRKNLNDKYDIGFIDPGVEGDW*
Ga0126447_107679123300009470Meromictic PondVTTKELYDKSFSFPKVRNYDYAVDQMNQLEAAEDNLNKNLSNSKALSHFLEVAKKVRSNLNDKYDVGFMDPGVEGDWQ*
Ga0115554_128643713300009472Pelagic MarineKKKGINAKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ*
Ga0115555_134831523300009476Pelagic MarineFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0115571_133197313300009495Pelagic MarineMENWNNAMKIKGALGAKVKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHFEDNLNNNLSNALALERFITVAKKVRANLNDKYDIGFVDP
Ga0115567_1078991713300009508Pelagic MarineMESWNNAMHIKKELSKKKGINAKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGF
Ga0115099_1037238313300009543MarineYQLGEFSRNFDIKNWENAMTIRSGLAGSGQTPKFAVTTKELYDKSFSFPKVTNYDYAVQQMNELEHYEDNLNANLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0115099_1049693823300009543MarineMESWNNAMHIKKKLGKKGINPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ*
Ga0115101_106595213300009592MarineMTIKTELAKTGVFPKIAVTTKELYDKSFSFPKVRNYEYAVQQMNELEHYEDNLNTNISNSHHLSKFIEVAKKVRENLNAKYDIGFIDPGVEGDWQ*
Ga0115103_120996813300009599MarineNLHYQLGEFSRNFQMVNWDNAMHISGELRKGGASPKVAVTTKELYDKSFSFPKVRNYDYAVQNMNELEGAEDNLNTNLSNGLALKRFIAVAKKVRANLNDKYDIGFVDPGVDGDWQ*
Ga0115103_154481423300009599MarineMFSRSFEMASWNNAMEIASGLAKTGKTPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALKRFIEVAKKVRANLNDKYDIGFIDPGVEGDWQ*
Ga0115102_1018777013300009606MarineNWVNAMHIKDQLSSQGVSPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNDLEAVEDNLNQNLGNDLALHRFIDTAKKVRENLNAKYDIGFIDPGVDGDWQ*
Ga0115102_1040042413300009606MarineKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ*
Ga0115102_1041575113300009606MarineREDLGKSGQTPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNANLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0115104_1007397613300009677MarineVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNSNIMNSLALKRFVEVAKKVRANLNDKYDIGFIDPGVEGDWQ*
Ga0115104_1023524923300009677MarineMDNWDNAQKVLAGLKGAGKNPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0115104_1048188413300009677MarineKFAVTTKELYDKSFSFPKVRNYDYAVQNMNDLEAVEDNLNQNLGNDLALHRFVDTAKKVRENLNAKYDIGFIDPGVDGDWQ*
Ga0115104_1119760113300009677MarineMENWDNAVKIKKALEEKGKKPQFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNTNIMNSLALKRFVEVAKKVRANLNDKYDIGFIDPGVEGDWQ*
Ga0115105_1064527113300009679MarineEDEMQYQLGEFSRNFNMDNWDNAMKVKAGLAKVGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRYVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0115105_1067474013300009679MarineVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNANLSNKLALKRFIEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0115105_1081656013300009679MarineKGELGKAGKNVKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGLALERFVNVAKKVRANLNDKYDIGFIDPGVEGDWQ*
Ga0115105_1096333623300009679MarineVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNANLSNKLSLKRFVEVAKKVRANLNDKYDIGFIDPGVEGDWQ*
Ga0123373_11208123300009732MarineVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGLALDRFVKVAKQVRANLNDKYDIGFIDPGVEGDWQ*
Ga0123377_107167513300009735MarineMEIKSKLQEKGVNPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNANLSNHLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0115001_1097269013300009785MarineNMHYQLGEFSRNFLMVNWNNAMKIKDALDKDGKDHKFAVTTKELYDKSFSFPKVRYYDYAIEQMTELEHFEDNLNNNQSNKLALVRFIKVAKKVRANLNKKYDIGFIDPGVEGDW*
Ga0136655_115864613300010316Freshwater To Marine Saline GradientAGLKKEGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0129333_1074783013300010354Freshwater To Marine Saline GradientMENWNNAMKIKDELNKGGVFPRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNNNISNSLALERFIEVATRVRANLNDKYDIGFIDPGVDGDW*
Ga0138316_1007949413300010981MarineSRNFQMDSWNNAMKIKEKLNKGGVFPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNGLALTRFTEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0138324_1004038013300010987MarineELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNGLALTRFTEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0138324_1045445713300010987MarineMHYQLGEFSRNFQMESWSNAMHIKDKLNKKGSFPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNELEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFVDPGVEGDWQ*
Ga0136600_110611413300012036Saline LakeMNIYNHLKDEGKSPKIAVTTKELYDHSFSFPKVRNYDYAILNMNELEAAEDNLNKNILNAFALNQFIEVAKRVRGNLNHKYDIGFMDPADEGDWQ*
Ga0138258_176980513300012413Polar MarineMDNWDNAQKVLSGLKAAGKAPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFSKVAKKVRANLNDKYDIGFIDPGVEGEW*
Ga0138264_168074513300012414Polar MarineMENWKNAMKIKEELEKSGTSPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEYNLNSNLSNGQHLKKFVEIAKKVRANLNDKYDIGFIDPGVEGEWQ*
Ga0138261_122425513300012418Polar MarineELQFQLGEFSRNFNMDNWDNAQKVLSGLKAAGKAPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRYVEVAKKVRANLNDKYDIGFIDPGVEGEW*
Ga0129350_124559313300012523AqueousTKELYDKSFSFPKVRNYDYAVQNMNELEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ*
Ga0129350_138441613300012523AqueousMENWDNAMHIKDKLNKKGVFPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNTNLSNKLALDRFITVAKKVRANLNDKYDIGFIDPGVEGDWQ*
Ga0163179_1109558113300012953SeawaterPPPLELTQEELNFQLGEFSRNFKMENWDNAIKIKKAIEDKGKKPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNQNIMNSLHLKRFVEVAKKVRANLNDKYDIGFIDPGVEGDWQ*
Ga0163179_1178949113300012953SeawaterKVGKNPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRYIEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0164293_1073779623300013004FreshwaterVTTKELYDKSFSFPKVRNYDFTVEQMTELEHFEDNLNSNLTNELALTRFIEVAKKVRANLNDKWGSAFIDPGSY*
Ga0182057_125735713300016732Salt MarshMEIKGKLQASGANPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNANLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0182042_123506813300016733Salt MarshEELSYQLGNFSRNFEMTAWNNAMEIAAGLAKTGKTPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALKRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0182049_104983513300016736Salt MarshMQNWNDAMKISSELEKQGKKVKIAVTTKELYDHSFSFPKVRNYEFAVKNMNELEHYEDNLNNNISNAYALQKFVEVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0182091_144013213300016766Salt MarshLGEFSRNFQMENWNNAMHIKGKLNKKGINPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNANLSNQLALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0187219_121164423300017751SeawaterVTTKELYDKSFSFPKVRNYDYAVEQMNELEHFEDNLNNNLSNALALERFIKVAKKIRANLNDKYDIGFVDPGVESDWQ
Ga0181425_106519923300017771SeawaterMENWDNAMHIKGKLNTKGAFPKFAVTTKELYDKSFSFPKVRNYDYVVQHMIELEHYEDNLNANLSNKLALDRFITVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0181571_1047244213300017957Salt MarshAGELRKGGANPKVAVTTKELYDKSFSFPKVRNYDYAVQNMNELEAAEDNLNTNLSNGLALKRFVAVAKKVRANLNDKYDIGFVDPGVDGDWQ
Ga0181601_1069224213300018041Salt MarshSRNFEMSAWNNAMEIAAGLAKAGKTPRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0181568_1092709813300018428Salt MarshKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0192960_10313823300018515MarineMHYQLGEFSRNFQMESWTNAMHIKDKLSKKGVFPKYAVTTKELYDKSFSFPKVRNYDYAVQNMNELEHYEDNLNTNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0188858_11076013300018567Freshwater LakeVLSGLKAEGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFTEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0188834_102877013300018599Freshwater LakeDNAMKIKSALAKTGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFIEVAKKTRANLNDKYDIGFIDPGVEGDW
Ga0188846_104315313300018614Freshwater LakePLEMTEEELHYQLGEFSRNFAMENWNDAMKIKAELEKSGKHPKIAVTTKELYDHSFSFPKVRNYEYAVHNMNELEHYEDNLNTNISNLYHLQKFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0193133_101993013300018617MarineTWVGKAGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0188862_102313223300018622Freshwater LakeMEIKGKLAEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0193355_101509613300018628MarineEDELHYQLGEFSRNFQMENWTNAMHIKKKLGKKGINPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNQLALERFISTAKKVRANLNDKYDIGFIDPGVEGDWE
Ga0192969_102875523300018649MarineMHYQLGEFSRNFQMESWSNAMHIKDKLSKKGVNPKYAVTTKELYDKSFSFPKVRNYDYAVQNMNELEHYEDNLNTNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0192983_101808423300018684MarineLEISEEEMHYQLGEFSRNFQMESWSNAMHIKDKLSKKGVNPKYAVTTKELYDKSFSFPKVRNYDYAVQNMNELEHYEDNLNTNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0192944_102061523300018692MarineLEITEEEMHYQLGEFSRNFQMESWTNAMHIKDKLSKKGVFPKYAVTTKELYDKSFSFPKVRNYDYAVQNMNELEHYEDNLNTNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0192944_102206523300018692MarineMENWKNAMHIKGKLGDKGVFPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGLALDRFVGVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0193517_105736313300018725MarineVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNTNISNSLALKRFVEVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0193517_107697513300018725MarineHYQLGEFSRNFNMENWNNAQKIADGLAKAGKSPRFAVTTKELYDHSFSFPKVRNYDYAVENMNELEHYEDNLNNNLSNAYALQKFISVAKKVR
Ga0192967_107794213300018730MarineDSKNWENAMKIRSSLAESGQNPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNNLALTRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0193381_105644123300018732MarineMDNWDNAMEVKAGLAKAGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0193000_105327513300018745MarineTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNNLALDRFISVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0193000_107250913300018745MarineSRNFNMDNWDNAMKIKAGLAKVGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0193031_108415013300018765MarineELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNSNLSNNLALKRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0193181_105798813300018766MarineFSFPKVRNYDYAVQQMNELEHYEDNLNANLSNGLALERFVNVAKKVRANLNDKYDIGFVDPGVEGDWQ
Ga0192832_106570423300018782MarineKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGLALDRFVSVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0193124_104112313300018787MarineWKNAMHIKDKLNKKGVNPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGLALERFVQVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0192950_104933623300018791MarineTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGLALDRFVGVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0192950_105404213300018791MarineEFSRNFNMDNWDNAQKVLSGLKAAGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRYVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0192898_108911713300018806MarineWDNAMEVKKGLGKAGKTPKFAVTTKELYDKSFSYPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0193366_104816413300018827MarineLQYQLGEFSRNFNMDNWDNAMEVKAGLAKAGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0192949_109094513300018831MarineKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGLALDRFVGVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0194240_101905213300018832MarineLEITEEELHYQLGEFSRNFQMENWTNAMHIKSKLNKKGVFPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGLALERFVNVAKKVRANLNDKYDIGFVDPGVEGDWQ
Ga0194240_103212213300018832MarineAAAGKNPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0192870_109174813300018836MarineKVKAGLAGAGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0193302_105179723300018838MarineAFQLGEFSRNFQMENWKNAMHIKGKLNKKGVFPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNELEHYEDNLNSNLSNGLALDRFIQVAKKVRANLNDKYDIGFVDPGVEGDWQ
Ga0193253_108049713300018846MarineMESWNNAMHIKKKLGKKGINPKYAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNALALNRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0193253_109410413300018846MarineAGGNPKIAVTTKELYDKSFSFPKVRNYDYAVENMNELESAEDNLNTNLSNGLALKRFLEVAKRVRANLNDKYDIGFVDPGVDGEWQ
Ga0193253_113267613300018846MarinePEPLEISEEELHYQLGEFSRNFNMENWTNAQKIADGLAKAGKSPRFAVTTKELYDHSFSFPKVRNYDYAVENMNELEHYEDNLNNNLSNAYALQKFVQVAKKVR
Ga0192978_104316513300018871MarineMENWDNGIKIKKAIEEKGKKPNFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNTNVMNSLALKRFVEVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0193028_107828623300018905MarineVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGLALERFVTVAKKVRANLNDKYDIGFVDPGVEGDWQ
Ga0192868_1002546123300018913MarineMKVKAGLAKVGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0192868_1005983513300018913MarineGEFSRNFNMDNWDNAMKVKAGLAGAGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLPNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0192868_1006543513300018913MarineMTIKGKLNKQGVNPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHFEDNLNNNLSNKLALERFITVAKQVRSNLNDKYDIGFIDPGVEGDW
Ga0192820_1015710113300018932MarineMGAGKNPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0193531_1026167913300018961MarineMHYQLGEFSRNFQMESWNNAMHIKDKLNKKGVFPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNELEHYEDNLNSNLSNALALKRFIDVGKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0193178_1007011813300018967MarineDNWDNAMEVKKGLAKVGKNPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0192894_1012797113300018968MarineMHYQLGEFSRNFQMENWNNAMTVKGKLNGGGKFPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNNNLSNKLALDRFIAVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0192894_1022033413300018968MarineVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNANLSNKLALKRFVEIAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0192894_1032672213300018968MarineELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNNLALTRFIDTAKKVRANLNDKYDIGFIDPGVEGDW
Ga0192873_1029549413300018974MarineMDNWDNAQKVLAGLKGAGKNPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0192961_1024232113300018980MarineFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0193030_1009648523300018989MarineVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGLALERFVNVAKKVRANLNDKYDIGFVDPGVEGDWQ
Ga0193030_1010486613300018989MarineMTIKGKLNKAGVFPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNQNLSNGLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0193030_1015366023300018989MarineMENWKNAMHIKGKLADKGVFPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGLALDRFVGVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0193030_1016677513300018989MarineQLGEFSRNFQMENWKNAMYIKDKLNKKGIFPKYAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLGNGLALDRFVNVAKKVRANLNDKYDIGFVDPGVEGDWQ
Ga0193030_1017287113300018989MarineELYNKSFSFPKVRNYDYAVTNMNELEAANDNLNANLSNGLALKKFLEVAKRVRSNLNDKYDIGFTDPGVDGDW
Ga0193030_1018837013300018989MarineNNAMEIKDKLGKKGSFPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNSNLSNTLALDRFVKVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0193030_1019126113300018989MarineHYQLGEFSRNFQMESWNNAMHIKDKLNKKGSFPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNEIEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0193030_1022153813300018989MarineDELQYQLGEFSRNFNMDNWDNAMEVKKGLAKVGKAPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0193030_1022948813300018989MarineYQLGEFSRNFNMDNWDNAMEVKKGLAKVGKAPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0193030_1026869213300018989MarineQLGEFSRNFNMDNWDNAMKVKAGLAKVGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0193257_1019228813300018997MarineDKLNKKGSFPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNEIEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0193034_1014862913300019001MarineLGEFSRNFDMTNWNNAMKIKGELGKSGKNVKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNNLALTRFIDVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0192982_1029424513300019021MarineYDKSFSFPKVRNYDYAVENMNELEHYEDNLNTNVMNSLALKRFVEVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0193516_1017237623300019031MarineVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNANLSNKLALKRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0193516_1017560113300019031MarineSQEEINYQLGEFSRNFKMVNWDNAVKIKNKLEGDGKKVQFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNTNNSNSLALKRFVEVAKKVRTNLNDKYDIGFIDPGVEGDWQ
Ga0193516_1019489913300019031MarineFKMVNWDNAVKIKNKLEGDGKKVQFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNTNISNSLALKRFVEVAKKVRTNLNDKYDIGFIDPGVEGDWQ
Ga0193516_1025664113300019031MarineMENWKNAMHIKDKLAKKGVFPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGLALERFVNVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0192869_1026254513300019032MarineMEIKGKLAEAGSNPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNANLSNNLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0192869_1028990913300019032MarineVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNSNNMNSLALKRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0192869_1039877313300019032MarineELHYQLGEFSRNFDMKNWENAMKIRGELASSGQNPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNANLSNNLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0192869_1042093023300019032MarineVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNSNIMNSLALKRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0193037_1026467013300019033MarineHGGGNAMYVKGELGKAGKNPKFAVTTKELYDKSFSFPKVRNYDYAVAQMNELEHYEDNLNANLSNNLALTRFIDVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0192945_1010871023300019036MarineMHIKGKLADKGVFPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGLALDRFVGVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0192945_1028108113300019036MarineMHYQLGEFSRKFLMSNWNNAMKIKAELDKDGKQHKFAVTTKELYDKSFSFPKVRYYDYAVEQMTELEHFEDNLNNNQSNELALVRFIKVAKKVRANLNKKYDIGFVDPGVEGDWQ
Ga0192886_1025118613300019037MarineMENWKNAMHIKGKLADKGVLPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGLALDRFVGVAKKVRANLNDKCDIGFIDPGVEGDWQ
Ga0192886_1028611413300019037MarineLGKKGIFPKYAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGLALDRFIKVAKQVRANLNDKYDIGFIDPGVEGDWQ
Ga0193336_1028132313300019045MarineCPEPLEITEDNMHYQLGEFSRNFQMDSWNNAMKIKEKLNKGGVFPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNQNLSNGLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0193336_1032360723300019045MarineEFSRNFQMENWNNANHILGKLKKKGINPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNELEHYEDNLNSNLSNGLALERFISVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0193336_1055821813300019045MarineNWDNAMEVKKGLGKVGKNPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0192966_1019930623300019050MarineTWAEDELHYQLGEFSRNFDMKNWDNAMKIRGEVAASGQNPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNTLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0192826_1025918823300019051MarineMENWNNANHILGKLKKKGINPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNELEHYEDNLNANLSNALALERFISVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0192826_1030105213300019051MarineMENWNNAMHIKKKLAKKGIFPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGLALERFVKVAKQVRSNLNDKYDIGFIDPGVEGDWQ
Ga0192826_1033229513300019051MarineTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNANLSNKLALKRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0192826_1038341613300019051MarineLGEFSRNFEMENWDNAMHIHSELGKAGKAPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNDLEAVEDNLNSNLSNQLALKRFVDTAKQVRENLNAKYDIGFIDPGVDGDW
Ga0188866_101429323300019095Freshwater LakeMENWNNAMYINKKLKKKGIFPKYAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLGNGLALERFVKVAKQVRSNLNDKYDIGFIDPGVEGDWQ
Ga0193153_103006723300019097MarineFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGLALDRFVGVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0193045_104735413300019100MarineGGKPKFAVTTSDLYNKSFSFPKVRNYDYAVTNMDELIAANDNLNANLSNGLALKKFLEVAKRVRSNLNDKYDIGFTDPGVDGDWQ
Ga0192946_104079823300019103MarineQLGEFSRNFQMENWTNAMHIKGKLGKKGVFPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNELEHYEDNLNSNLSNALALERFVSVGKKVRANLNDKYDIGFVDPGVEGDWQ
Ga0192946_105580313300019103MarineNWVNAMHIKDQLAAEGVAPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNDLEAVEDNLNQNLGNDLALHRFIDTAKKVRENLNAKYDIGFIDPGVDGDWQ
Ga0192972_107979113300019108MarineFSRNFNMENWKNAMKIKEELEKSGTSPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGQHLKKFVEIAKKVRANLNDKYDIGFIDPGVEGEWQ
Ga0193054_103635813300019117MarineLGEFSRNFQMENWTNAMHIKGKLNAKGVNPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNANLSNGLALERFISVAKKVRANLNDKYDIGFVDPGVEGDWQ
Ga0193157_102908813300019118MarineNEIAGKLRAGGGKPKVSVTTFELYNKSFSFPKVRNYDYAVTNMNELEAANDNLNANLSNGLALKKFLEVAKRVRSNLNDKYDIGFTDPGVDGDW
Ga0192980_107498613300019123MarineAVTTKELYDKSFSFPKVRNYDYAVQNMNELEHYEDNLNTNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0188870_1006791913300019149Freshwater LakeMGEFSRNFKMENWDNAVKIKNALAEKGKKVKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNSNNTNSLALKRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0194244_1004632713300019150MarineKPLEISEDEMHYQLGEFSRNFQMESWSNAMHIKDKLNKKGSFPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNELEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0194244_1006373013300019150MarineDELQYQLGEFSRNFNMDNWDNAMEVKKGLAKVGKNPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0180035_110452213300019191EstuarineAFQLGSFSRNFEMTNWNNAMEIAAGLAKQGKTPRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALKRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0182064_115088613300019253Salt MarshDNAMKIRAELADKGQTPKFAVTTKELYDNSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0182097_109045013300019261Salt MarshMEIKSKLQEKGANPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNANLSNHLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0182086_130786613300020013Salt MarshMEIKSKLQEKGVNPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNANLSNHLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0206125_1025454713300020165SeawaterKKEGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0206124_1033390713300020175SeawaterSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0206129_1021923913300020182SeawaterMESWNNAMHIKKELSKKKGINAKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0211683_1028522413300020372MarineLQFQLGEFSRNFNMDNWDNAQKVLSGLKAAGKAPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRYVEVAKKVRANLNDKYDIGFIDPGVEGEW
Ga0211686_1028773813300020382MarineKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGEW
Ga0206687_153587413300021169SeawaterTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGLALERFIQVAKKVRANLNDKYDIGFVDPGVEGDWQ
Ga0206696_147971513300021334SeawaterMKNWKNAMHVKGELAKAGKNPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNANLSNNLALTRFIDTAKKVRANLNDKYDIGFIDPGVEGDW
Ga0206688_1096581713300021345SeawaterTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNTNIMNSLALKRFVDVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0206688_1105262213300021345SeawaterMENWDNAVKIKNKLEKGGKKAKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNTNIMNSLALKRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0206692_118780713300021350SeawaterPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNANLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0206690_1025879113300021355SeawaterLGKAGKNPKFAVTTKELYDKSFSFPKVRNYDYAVAQMNELEHYEDNLNANLSNNLALTRFIDTAKKVRANLNDKYDIGFIDPGVEGDW
Ga0206690_1045093313300021355SeawaterKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNSLALKRFIEVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0206689_1069131613300021359SeawaterAMEIKGKLSGSGAAVKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNNLALTRFIDVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0206689_1121610613300021359SeawaterMKNWDNAMEIKGKLGESGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0063090_106996113300021890MarineLNYQLGEFSRNFDMKNWDNAMEIKGKLGESGKAPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0063144_100968123300021899MarineMKNWDNAMEIKGKLAETGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0063086_101445313300021902MarineMENWDNAIKIKKSLAEKGSKPSFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNTNNMNSLALKRFVEVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0063086_110347113300021902MarineYINKKLKKKGIFPKYAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLGNGLALERFVKVAKQVRSNLNDKYDIGFIDPGVEGDWQ
Ga0063104_106112713300021913MarinePKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGQHLKKFVEIAKKVRANLNDKYDIGFIDPGVEGEWQ
Ga0063103_110627713300021927MarineDNWDNAMKVKEGLAAGGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRYVEVAKKVRANLNDKYDVGFIDPGVEGDW
Ga0063103_111504313300021927MarineEDELHYQLGEFSRNFDSKNWENAMKIRGELAKGGQNPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNNLALTRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0063134_109024013300021928MarineQYQLGEFSRNFQMVNWDNANEIAGKLRAGGAKPKFAVTTADLYNKSFSFPKVRNYDYAVQNMDELIAANDNLNANLSNGLALKKFLEVAKRVRSNLNDKYDIGFTDPGVDGDW
Ga0063138_111811213300021935MarineELSKKKGINAKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0063754_109311613300021937MarineLQYQLGEFSRNFSMDKWDNAMKVKSALAKTGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKTRANLNDKYDIGFIDPGVEGDW
Ga0063102_100026513300021941MarineMKNWDNAMEIKGKLGESGSAPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0063102_101813323300021941MarineMEIKGKLGDSGKAPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0222713_1063135513300021962Estuarine WaterMKIKGELEKQGKQVKIAVTTKELYDHSFSFPKVRNYDYAVQNMNELEHYEDNLNNNISNGYALQKFIEVAKKVRANLNDKYDIGFIDPGVEGDWQXANTLQKEIYLS
Ga0232113_102360913300023679SeawaterEISEDEMHYQLGVFSRNFQMESWNNAMHIKDKLNKKGSFPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNEIEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0228681_102037913300023683SeawaterMEIASGLAKTGKTPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALKRFIEVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0228687_102226513300023696SeawaterTEEEMNYQMGEFSRNFKMENWDNAVKIKNALAEKGKKVKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNSNNTNSLALKRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0228687_104010813300023696SeawaterGEFSRNFNMDNWDNAQKVLSGLKAAGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0228632_112204513300024420SeawaterRNFDMKNWDNAMEIKGKLASAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0208660_112597913300025570AqueousKGKLAEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0209405_114202813300025620Pelagic MarineKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0209095_115848813300025685Pelagic MarineKKKGINAKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0209505_113193113300025690Pelagic MarineKFAVTTKELYDKSFSFPKVRNYDYATEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0209715_111231713300025699Pelagic MarineMHIKKELSKKKGINAKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0247559_108837913300026443SeawaterDEMHYQLGEFSRNFQMESWNNAMHIKDKLNKKGSFPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNEIEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0247594_107738413300026448SeawaterELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNSNNTNSLALKRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0247594_110339113300026448SeawaterLYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0247578_109495113300026458SeawaterFPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNEIEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0247600_108006313300026461SeawaterMESWNNAMHIKDKLNKKGSFPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNEIEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0247568_109609113300026462SeawaterFSFPKVRNYDYAVENMNELEHYEDNLNSNNTNSLALKRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0247588_109372113300026465SeawaterPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGLALERFIQVAKKVRANLNDKYDIGFVDPGVEGDWQ
Ga0247588_112990013300026465SeawaterMTIKTELAKTGVFPKIAVTTKELYDKSFSFPKVRNYEYAVQQMNELEHYEDNLNTNISNSHHLSKFIEVAKKVRENLNAKYDNGFIDPGVEGDWQ
Ga0247603_111044313300026468SeawaterKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGLALERFIQVAKKVRANLNDKYDIGFVDPGVEGDWQ
Ga0247571_107146513300026495SeawaterMESWNNAMHIKKKLGKKGINPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0247571_117888513300026495SeawaterKFAVTTKELYDKSFSFPKVRNYDYATEQMNELEHYEDNLNNNLSNKLALTRYVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0247592_109909613300026500SeawaterMASWNNAMEIASGLAKTGKTPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALKRFIEVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0247592_114521413300026500SeawaterEFSRNFEMENWDNAMHIKAELADKGVNPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNDLEAVEDNLNQNLGNDLALHRFVDTAKKVRENLNAKYDIGFIDPGVDGDWQ
Ga0247605_117772223300026503SeawaterKKGIYPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGLALERFVKVAKQVRSNLNDKYDIGFIDPGVEGDWQ
Ga0247605_117803313300026503SeawaterPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNDLEAVEDNLNQNLGNDLALHRFVDTAKKVRENLNAKYDIGFIDPGVDGDWQ
Ga0208020_102257633300027159EstuarineMTILGELKKNGKTPKYAVTTKELYDHSFSFPKVRNYDYAIEQMTDLENVEDNLNKNLTNDYALTRFIEVAKKVRANLNKKYDIGFMDPGVEGDWQXAPH
Ga0208921_104183013300027188EstuarineAMEIAAGLAKSGKTPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0208921_106793513300027188EstuarineQGKPVKIAVTTKELYDHSFSFPKVRNYDYAVEQMNELEHYEDNLNQNIDNSLALARFVEVAKKVRANLNDKYDIGFIDPGVDGDW
Ga0208021_105051113300027191EstuarineELNYQLGEFSRNFDMKNWDNAMEIKGKLAGSGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0209710_123864713300027687MarineNNAMKIKGALGAKVKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHFEDNLNNNLSNALALERFITVAKKVRANLNDKYDIGFVDPGVESDWQ
Ga0209084_123272213300027749Freshwater LakeVTTKELYDKSFSFPKVRNYDFTVEQMTELEHFEDNLNSNLSNELALTRFIEVAKKVRANLNDKWGSAFIDPGSY
Ga0208304_1025275713300027751EstuarinePLEISEEELSFQLGQFSRNFEMSAWNNAMEIAAGLAKSGKTPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0209192_1014300713300027752MarineMKIKGALGAKVKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHFEDNLNNNLSNALALERFITVAKKVRANLNDKYDIGFVDPGVESDWQ
Ga0208671_1026551713300027757EstuarineEDELHYQLGEFSRNFNMENWNNAIKIRDELAKQGKPVKIAVTTKELYDHSFSFPKVRNYDYAVEQMNELEHYEDNLNQNIDNSLALARFVEVAKKVRANLNAKYDIGFIDPGVDGDW
Ga0209302_1050605213300027810MarineKGGASPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0209092_1041517513300027833MarineLSGLKAEGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKTRANLNDKYDIGFIDPGVEGDW
Ga0209092_1047734513300027833MarineMENWDNAIKIKKALEEKGSKPSYAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNTNNMNSLALKRFVEVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0256411_115566123300028134SeawaterMEIASGLAKTGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFTEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0256411_121911513300028134SeawaterMENWDNAVKIKKALEEKGKKPQFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNTNIMNSLALKRFVEVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0256412_121438513300028137SeawaterPLEITEDNMHYQLGEFSRNFQMDSWNNAMTVKGKLNKGGVFPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNQNLSNGLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0256412_122856313300028137SeawaterMTSWNNAMEIASGLAKTGKTPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALKRFIEVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0256412_123210013300028137SeawaterAVKIKNALAEKGKKVKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNSNNTNSLALKRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0256412_139121613300028137SeawaterPLEISEDNLAYQLGEFSRNFQMVNWDNANEIAGKLRAGGAKPKFAVTTSDLYNKSFSFPKVRNYDYAVQNMDELIAANDNLNANLSNGLALKKFLEVAKRVRSNLNDKYDIGFTDPGVDGDW
Ga0256417_120245713300028233SeawaterFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGLALDRFVKVAKQVRANLNDKYDIGFIDPGVEGDWQ
Ga0256413_132046613300028282SeawaterDQLAAQGVSPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNDLEAVEDNLNQNLGNDLALHRFVDTAKKVRENLNAKYDIGFIDPGVDGDWQ
Ga0247572_115415913300028290SeawaterVTTKELYDKSFSFPKVRNYDYAVQNMNEIEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0304731_1087979113300028575MarineSRNFQMDSWNNAMKIKEKLNKGGVFPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNGLALTRFTEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0307401_1027934113300030670MarineMKINGELKKSGKSIKIAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHFEDNLNNNLSNALALERFVTVAKKIRANLNDKYDIGFIDPGVESDWQ
Ga0307398_1072037913300030699MarineFSFPKVRNYDYAVENMNELEHYEDNLNVNNANSLALKRFVEVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0308137_105588013300030722MarineMHFQLGEFSRNFKMENWDNAMKVKEGLDKQGKKTRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNSNLSNKLALKRFIEIAKKVRANLNDKYDIGFIDPGVEGDW
Ga0073988_1228517113300030780MarineLGEFSRNFQMENWKNAMHIKSKLNKKGVFPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNELEHYEDNLNANLSNGLALDRFIQVAKKVRANLNDKYDIGFVDPGVEGDWQ
Ga0073988_1230128013300030780MarineSRNFNMDNWDNAMEVKGKLAKVGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0073964_1140604913300030788MarineFSRNFEMENWDNAMHIKSELAEQGVNPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNDLEAVEDNLNNNLSNQLALKRFVDTAKQVRANLNDKYDIGFIDPGVDGDWQ
Ga0073990_1000358913300030856MarineDELAYQLGEFSRNFNMDNWDNAMKVKAGLAAAGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0073990_1188525323300030856MarineMENWNNAMEIAGKLKADGTQVKLAVTTKELYDKSFSFPKVRNYDYAVENMNELEAAEDNLNKNISNGLQLKRFIEVAKKVRANLNAKYDIGFIDPGVDGDW
Ga0073990_1202748413300030856MarineQLGEFSRNFEMENWDNAMHIKSELADQGQFPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNDLEAVEDNLNNNLSNQLALKRFVDTAKAVRENLNAKYDIGFIDPGVDGDWQ
Ga0073990_1204591213300030856MarinePKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGLALERFVSVAKKVRANLNDKYDIGFVDPGVEGDWQ
Ga0073981_1163921023300030857MarineMDNWDNAQKVLAGLKAAGKNPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0073980_1135723223300031032MarineFAVTTKELYDKSFSFPKVRNYDYAVTQMNELEHYEDNLNSNLSNSLALERFVSVAKKVRANLNDKYDIGFVDPGVEGDWQ
Ga0073986_1188506113300031038MarineWDNANEIAGKLRDGGAKPKFAVTTKDLYDKSFSFPKVRNYDYAVANMNELEAAQDNLNANLSNGLALKKFLEVAKRVRANLNDKYDIGFVDPGVDGDW
Ga0073989_1333236213300031062MarineLNYQLGEFSRNFQMENWNNANHILKKLNKKGVFPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNELEHYEDNLNANLSNGQHLRKFIEIAKKVRANLNDKYDIGFIDPGVEGDW
Ga0073989_1336260813300031062MarineYDKSFSFPKVRNYDYAVQNMNDLEAVEDNLNSNLSNDLALQRFVETAKKVRENLNAKYDIGFIDPGVDGDWQ
Ga0073989_1344179513300031062MarineIKDKLEKKGVFPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNANLSNGLALSRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0073989_1355027713300031062MarineELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGLALDRFIKVAKQVRSNLNDKYDIGFIDPGVEGDWQ
Ga0308143_11559323300031540MarineMKIKGALGAKVKFAVTTKELYDNSFSFPKVRNYDYAVEQMNELEHFEDNLNNNLSNALALERFITVAKKVRANLNDKYDIGFVDPGVESDWQ
Ga0307489_1038271013300031569Sackhole BrineMEIAAGLAKSGKTPRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALTRFIEVAKKVRLNLNDKYDIGFVDPGNEGDW
Ga0308132_108959123300031580MarineMKNWDNAMEIKGKLGETGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0307386_1075182113300031710MarineVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNSNLSNKLALKRYIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0307397_1062351113300031734MarineDKSFSFPKVRNYDYAVENMNELEHYEDNLNTNIMNSLALKRFVEVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0307394_1020625013300031735MarineMKISGALGGKFKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHFEDNLNNNLSNALALERFVTVAKKIRANLNDKYDIGFVDPGVESDWQ
Ga0307387_1089852423300031737MarineMENWNNAMKISGALGGKYKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHFEDNLNNNLSNALALERFVTVAKKIRANLNDKYDIGFVDPGVESDWQ
Ga0307387_1099032713300031737MarineDKSFSFPKVRNYDYAVDQMNELEHFEDNLNKDLSNALALERFVTVAKKIRANLNDKYDIGFIDPGVESDWQ
Ga0307382_1037972413300031743MarineIKKKLAKKGIFPKYAITTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLGNGLALERFVKVAKQVRSNLNDKYDIGFIDPGVEGDWQ
Ga0307382_1043453323300031743MarineMEIKGKLAEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0307382_1052323413300031743MarineYIKKKLAKKGINPKFAVTTKELYDKSFSFPKVRNYDYAMQQMNELEHYEDNLNTNLSNGLALERFVKVAKQVRANLNDKYDIGFIDPGVEGDWQ
Ga0307389_1047872913300031750MarineMENWNNAMKINGELKKSGKSPKIAVTTKELYDKSFSFPKVRNYDYAVDQMNELEHFEDNLNKDLSNALALERFVTVAKKIRANLNDKYDIGFIDPGVESDWQ
Ga0307389_1091396313300031750MarineSEDSLHYQLGEFSRNFAMENWNNAMKISGALGGKYKFAVTTKELYDKSFSFPNVRNYDYAVEQMNELEHFEDNLNNNLSNALALERFVTVAKKIRANLNDKYDIGFVDPGVESDWQ
Ga0315907_1076420223300031758FreshwaterVTTKELYDKSFSFPKVRNYDFTVEQMTELEHFEDNLNSNLTNELALTRFIEVAKKVRANLNDKWGSAFIDPGSY
Ga0314779_103567213300032150SedimentAMEIAAGLAKSGKTPRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALTRFIEVAKKVRLNLNDKYDIGFVDPGNEGDW
Ga0314684_1068998213300032463SeawaterMKINAELKKGGKGPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHFEDNLNNNLDNALALERFVTVAKKVRANLNDKYDIGFIDPGVESDWQ
Ga0314668_1041610713300032481SeawaterMENWNNAMKINAELKKGGKGPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHFEDNLNNNLDNALALERFVTVAKKVRANLNDKYDIGFIDPGVESDW
Ga0314668_1054453313300032481SeawaterGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKTRANLNDKYDIGFIDPGVEGDW
Ga0314668_1065256413300032481SeawaterGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFTEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0314688_1025579423300032517SeawaterMENWNNAMKINAELKKGGKGPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHFEDNLNNNLDNALALERFVTVAKKVRANLNDKYDIGFIDPGVESDWQ
Ga0314689_1046096513300032518SeawaterPLDISEDSLHYQLGEFSRNFAMENWNNAMTINAELKKGGKGPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHFEDNLNNNLDNALALERFVTVAKKVRANLNDKYDIGFIDPGVESDW
Ga0314680_1080206413300032521SeawaterTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLGNGLALERFVKVAKQVRSNLNDKYDIGFIDPGVEGDWQ
Ga0314683_1077978313300032617SeawaterAKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0314673_1028879013300032650SeawaterMENWNNAMKINSELKKGGKGPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHFEDNLNNNLDNALALERFVTVAKKVRANLNDKYDIGFIDPGVESDW
Ga0314673_1044276913300032650SeawaterMYINKKLKKKGIFPKYAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLGNGLALERFVKVAKQVRSNLNDKYDIGFIDPGVEGDWQ
Ga0314685_1079500613300032651SeawaterGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFSEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0314678_1030676323300032666SeawaterELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKTRANLNDKYDIGFIDPGVEGDW
Ga0314687_1074088323300032707SeawaterMENWNNAMKIKGALGAKVKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHFEDNLNNNLSNALALERFITVAKKVRANLNDKYDIGFVDPGVESDWQ
Ga0314669_1030192523300032708SeawaterMENWNNAMYINKKLKKKGTFPKYAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLGNGLALERFVKVAKQVRSNLNDKYDIGFIDPGVEGDWQ
Ga0314681_1036722723300032711SeawaterMESWNNAMHIKKELSKKKGINAKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNTNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0314695_139289813300032724SeawaterLNYQLGEFSRNFDMKNWDNAMEIKGKLAEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0314693_1033600313300032727SeawaterMKINAELKKGGKGPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHFEDNLNNNLDNALALERFVTVAKKVRANLNDKYDIGFIDPGVESDW
Ga0314696_1059051213300032728SeawaterGEFSRNFQTENWVNAMHIKDQLAAEGVAPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNDLEAVEDNLNQNLGNDLALHRFIDTAKKVRENLNAKYDIGFIDPGVDGDWQ
Ga0314697_1036799513300032729SeawaterSEDNLHYQLGEFSRNFQTENWVNAMHIKDQLAAEGVAPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNDLEAVEDNLNQNLGNDLALHRFIDTAKKVRENLNAKYDIGFIDPGVDGDWQ
Ga0314699_1034658313300032730SeawaterEFSRNFSMDKWDNAMKVKSALAKAGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKTRANLNDKYDIGFIDPGVEGDW
Ga0314699_1055346913300032730SeawaterQTENWVNAMHIKDQLAAEGVAPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNDLEAVEDNLNQNLGNDLALHRFIDTAKKVRENLNAKYDIGFIDPGVDGDWQ
Ga0314714_1032304523300032733SeawaterMENWNNAMKINSELKKGGKGPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHFEDNLNNNLDNALALERFVTVAKKVRANLNDKYDIGFIDPGVESDWQ
Ga0314708_1047358313300032750SeawaterQLGEFSRNFQMESWNNAMHIKKELSKKKGINAKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0314692_1036303013300032754SeawaterMKINAELKKGGKGPKFAVTTKELYDKSFSFPKVRSYDYAVEQMNELEHFEDNLNNNLDNALALERFVTVAKKVRANLNDKYDIGFIDPGVESDW
Ga0307390_1102851613300033572MarineGKFKFAVTTKDLYDKSFSFPKVRNYDYAVEQMNELEHFEDNLNKDLSNALALERFVTVAKKIRANLNDKYDIGFIDPGVESDWQ
Ga0334989_0383068_171_3953300033984FreshwaterVTTKELYDKSFSFPKVRNYDFTVEQMTELEHFEDNLNSNLSNELALSRFIEVAKKVRAGLNDKWGSAFIDPGFY
Ga0335005_0338845_341_5383300034022FreshwaterVSTKELYDKSFTYPIVRNYEFSEESLTELEHFEDNLNKNPNNSLALTRFIEVAQKVRSGLSLKYG
Ga0334990_0290465_344_5413300034068FreshwaterVSTKELYDKSFTYPIVRNYEFSEESLAELEHFEDNLNKNPNNSLALTRFIEVAQKVRSGLSLKYG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.