| Basic Information | |
|---|---|
| Family ID | F009627 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 315 |
| Average Sequence Length | 43 residues |
| Representative Sequence | LTRLGVPGSLAEVYADRLDWHQVARLVQRGCPPRLALRIVL |
| Number of Associated Samples | 236 |
| Number of Associated Scaffolds | 315 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 5.10 % |
| % of genes near scaffold ends (potentially truncated) | 89.84 % |
| % of genes from short scaffolds (< 2000 bps) | 92.38 % |
| Associated GOLD sequencing projects | 217 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (52.063 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (27.302 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.619 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.78% β-sheet: 0.00% Coil/Unstructured: 65.22% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 315 Family Scaffolds |
|---|---|---|
| PF02467 | Whib | 25.40 |
| PF02515 | CoA_transf_3 | 4.44 |
| PF08044 | DUF1707 | 3.17 |
| PF10009 | DUF2252 | 3.17 |
| PF00456 | Transketolase_N | 1.59 |
| PF03729 | DUF308 | 1.59 |
| PF08327 | AHSA1 | 1.59 |
| PF04185 | Phosphoesterase | 1.59 |
| PF01569 | PAP2 | 1.27 |
| PF04972 | BON | 1.27 |
| PF12805 | FUSC-like | 1.27 |
| PF00582 | Usp | 0.95 |
| PF00689 | Cation_ATPase_C | 0.95 |
| PF00300 | His_Phos_1 | 0.95 |
| PF08386 | Abhydrolase_4 | 0.63 |
| PF12697 | Abhydrolase_6 | 0.63 |
| PF01654 | Cyt_bd_oxida_I | 0.63 |
| PF13401 | AAA_22 | 0.63 |
| PF01042 | Ribonuc_L-PSP | 0.63 |
| PF06897 | DUF1269 | 0.63 |
| PF00122 | E1-E2_ATPase | 0.63 |
| PF03631 | Virul_fac_BrkB | 0.32 |
| PF13673 | Acetyltransf_10 | 0.32 |
| PF00296 | Bac_luciferase | 0.32 |
| PF13246 | Cation_ATPase | 0.32 |
| PF03706 | LPG_synthase_TM | 0.32 |
| PF16859 | TetR_C_11 | 0.32 |
| PF00690 | Cation_ATPase_N | 0.32 |
| PF00781 | DAGK_cat | 0.32 |
| PF07730 | HisKA_3 | 0.32 |
| PF01988 | VIT1 | 0.32 |
| PF07690 | MFS_1 | 0.32 |
| PF03636 | Glyco_hydro_65N | 0.32 |
| PF01544 | CorA | 0.32 |
| PF13231 | PMT_2 | 0.32 |
| PF00723 | Glyco_hydro_15 | 0.32 |
| PF01370 | Epimerase | 0.32 |
| PF03807 | F420_oxidored | 0.32 |
| PF03358 | FMN_red | 0.32 |
| PF01039 | Carboxyl_trans | 0.32 |
| PF02770 | Acyl-CoA_dh_M | 0.32 |
| PF05201 | GlutR_N | 0.32 |
| PF00072 | Response_reg | 0.32 |
| PF00929 | RNase_T | 0.32 |
| PF13191 | AAA_16 | 0.32 |
| PF01434 | Peptidase_M41 | 0.32 |
| PF13564 | DoxX_2 | 0.32 |
| PF13561 | adh_short_C2 | 0.32 |
| PF00923 | TAL_FSA | 0.32 |
| PF00196 | GerE | 0.32 |
| PF13376 | OmdA | 0.32 |
| PF08281 | Sigma70_r4_2 | 0.32 |
| PF00004 | AAA | 0.32 |
| PF03779 | SPW | 0.32 |
| PF04542 | Sigma70_r2 | 0.32 |
| PF01575 | MaoC_dehydratas | 0.32 |
| PF01966 | HD | 0.32 |
| PF13302 | Acetyltransf_3 | 0.32 |
| PF00561 | Abhydrolase_1 | 0.32 |
| PF09335 | SNARE_assoc | 0.32 |
| PF01694 | Rhomboid | 0.32 |
| PF00528 | BPD_transp_1 | 0.32 |
| COG ID | Name | Functional Category | % Frequency in 315 Family Scaffolds |
|---|---|---|---|
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 4.44 |
| COG0474 | Magnesium-transporting ATPase (P-type) | Inorganic ion transport and metabolism [P] | 1.90 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 1.59 |
| COG0021 | Transketolase | Carbohydrate transport and metabolism [G] | 1.59 |
| COG3247 | Acid resistance membrane protein HdeD, DUF308 family | General function prediction only [R] | 1.59 |
| COG3959 | Transketolase, N-terminal subunit | Carbohydrate transport and metabolism [G] | 1.59 |
| COG1597 | Phosphatidylglycerol kinase, diacylglycerol kinase family | Lipid transport and metabolism [I] | 0.63 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.63 |
| COG4803 | Uncharacterized membrane protein | Function unknown [S] | 0.63 |
| COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.63 |
| COG2216 | K+ transport ATPase, ATPase subunit KdpB | Inorganic ion transport and metabolism [P] | 0.63 |
| COG1271 | Cytochrome bd-type quinol oxidase, subunit 1 | Energy production and conversion [C] | 0.63 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.32 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.32 |
| COG1814 | Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 family | Inorganic ion transport and metabolism [P] | 0.32 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.32 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.32 |
| COG3387 | Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family | Carbohydrate transport and metabolism [G] | 0.32 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.32 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.32 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.32 |
| COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 0.32 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.32 |
| COG1633 | Rubrerythrin, includes spore coat protein YhjR | Inorganic ion transport and metabolism [P] | 0.32 |
| COG1554 | Phosphatase/phosphodiesterase/kojibiose phosphorylase YcjT/PafA/Npp1, AlkP superfamily | Carbohydrate transport and metabolism [G] | 0.32 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.32 |
| COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 0.32 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.32 |
| COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 0.32 |
| COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 0.32 |
| COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 0.32 |
| COG0598 | Mg2+ and Co2+ transporter CorA | Inorganic ion transport and metabolism [P] | 0.32 |
| COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 0.32 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.32 |
| COG0465 | ATP-dependent Zn proteases | Posttranslational modification, protein turnover, chaperones [O] | 0.32 |
| COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 0.32 |
| COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 0.32 |
| COG0373 | Glutamyl-tRNA reductase | Coenzyme transport and metabolism [H] | 0.32 |
| COG0176 | Transaldolase/fructose-6-phosphate aldolase | Carbohydrate transport and metabolism [G] | 0.32 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 52.06 % |
| Unclassified | root | N/A | 47.94 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2065487018|GPINP_F5MS3JC02H6KDL | Not Available | 526 | Open in IMG/M |
| 3300001593|JGI12635J15846_10103408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2039 | Open in IMG/M |
| 3300002914|JGI25617J43924_10088080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1120 | Open in IMG/M |
| 3300002914|JGI25617J43924_10103761 | Not Available | 1015 | Open in IMG/M |
| 3300004080|Ga0062385_10357103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 859 | Open in IMG/M |
| 3300004092|Ga0062389_103754224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 570 | Open in IMG/M |
| 3300004114|Ga0062593_100472516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1151 | Open in IMG/M |
| 3300004633|Ga0066395_10124138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1278 | Open in IMG/M |
| 3300004633|Ga0066395_10891698 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300004635|Ga0062388_101370472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 709 | Open in IMG/M |
| 3300005168|Ga0066809_10048912 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
| 3300005174|Ga0066680_10309136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1009 | Open in IMG/M |
| 3300005332|Ga0066388_101672863 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
| 3300005332|Ga0066388_105747482 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300005338|Ga0068868_100505443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1059 | Open in IMG/M |
| 3300005367|Ga0070667_102128803 | Not Available | 528 | Open in IMG/M |
| 3300005435|Ga0070714_100315607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 1460 | Open in IMG/M |
| 3300005435|Ga0070714_102189020 | Not Available | 538 | Open in IMG/M |
| 3300005437|Ga0070710_10047924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2385 | Open in IMG/M |
| 3300005445|Ga0070708_100083425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2897 | Open in IMG/M |
| 3300005445|Ga0070708_102077450 | Not Available | 525 | Open in IMG/M |
| 3300005455|Ga0070663_101500569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 599 | Open in IMG/M |
| 3300005458|Ga0070681_10341550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1407 | Open in IMG/M |
| 3300005467|Ga0070706_100533735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1091 | Open in IMG/M |
| 3300005467|Ga0070706_100949497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 794 | Open in IMG/M |
| 3300005471|Ga0070698_100117604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2620 | Open in IMG/M |
| 3300005471|Ga0070698_100535795 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
| 3300005526|Ga0073909_10345394 | Not Available | 688 | Open in IMG/M |
| 3300005534|Ga0070735_10058529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2521 | Open in IMG/M |
| 3300005544|Ga0070686_100169715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1542 | Open in IMG/M |
| 3300005547|Ga0070693_100178381 | Not Available | 1366 | Open in IMG/M |
| 3300005547|Ga0070693_100867963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 674 | Open in IMG/M |
| 3300005548|Ga0070665_101047013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 828 | Open in IMG/M |
| 3300005548|Ga0070665_102603602 | Not Available | 507 | Open in IMG/M |
| 3300005563|Ga0068855_101121421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 821 | Open in IMG/M |
| 3300005591|Ga0070761_10031961 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2941 | Open in IMG/M |
| 3300005602|Ga0070762_10843172 | Not Available | 622 | Open in IMG/M |
| 3300005614|Ga0068856_100553907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1171 | Open in IMG/M |
| 3300005616|Ga0068852_100015999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5840 | Open in IMG/M |
| 3300005764|Ga0066903_107224867 | Not Available | 575 | Open in IMG/M |
| 3300005921|Ga0070766_10737106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 669 | Open in IMG/M |
| 3300005983|Ga0081540_1352199 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300006173|Ga0070716_100260854 | All Organisms → cellular organisms → Bacteria | 1185 | Open in IMG/M |
| 3300006173|Ga0070716_100469215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 922 | Open in IMG/M |
| 3300006175|Ga0070712_100968148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 735 | Open in IMG/M |
| 3300006176|Ga0070765_100711704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 948 | Open in IMG/M |
| 3300006176|Ga0070765_101810988 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 572 | Open in IMG/M |
| 3300006580|Ga0074049_12754013 | Not Available | 1003 | Open in IMG/M |
| 3300006804|Ga0079221_10144487 | All Organisms → cellular organisms → Bacteria | 1236 | Open in IMG/M |
| 3300006804|Ga0079221_10243272 | Not Available | 1017 | Open in IMG/M |
| 3300006804|Ga0079221_10262710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 989 | Open in IMG/M |
| 3300006903|Ga0075426_10196100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1464 | Open in IMG/M |
| 3300006903|Ga0075426_11457717 | Not Available | 520 | Open in IMG/M |
| 3300007076|Ga0075435_101659669 | Not Available | 561 | Open in IMG/M |
| 3300007258|Ga0099793_10510124 | Not Available | 598 | Open in IMG/M |
| 3300009029|Ga0066793_10157646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1323 | Open in IMG/M |
| 3300009092|Ga0105250_10584145 | Not Available | 516 | Open in IMG/M |
| 3300009098|Ga0105245_10156330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2160 | Open in IMG/M |
| 3300009101|Ga0105247_11577536 | Not Available | 538 | Open in IMG/M |
| 3300009143|Ga0099792_10710085 | Not Available | 651 | Open in IMG/M |
| 3300009162|Ga0075423_12081481 | Not Available | 615 | Open in IMG/M |
| 3300009162|Ga0075423_12966743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 520 | Open in IMG/M |
| 3300009520|Ga0116214_1007390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3919 | Open in IMG/M |
| 3300009523|Ga0116221_1196033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 876 | Open in IMG/M |
| 3300009545|Ga0105237_11423437 | Not Available | 700 | Open in IMG/M |
| 3300009698|Ga0116216_10189937 | Not Available | 1261 | Open in IMG/M |
| 3300009700|Ga0116217_10018431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5538 | Open in IMG/M |
| 3300009792|Ga0126374_10241822 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
| 3300010043|Ga0126380_10585228 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300010046|Ga0126384_11069363 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300010360|Ga0126372_10744917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 963 | Open in IMG/M |
| 3300010361|Ga0126378_13025446 | Not Available | 536 | Open in IMG/M |
| 3300010373|Ga0134128_10746952 | Not Available | 1085 | Open in IMG/M |
| 3300010373|Ga0134128_12597583 | Not Available | 558 | Open in IMG/M |
| 3300010376|Ga0126381_101755107 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 896 | Open in IMG/M |
| 3300010376|Ga0126381_103539381 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 613 | Open in IMG/M |
| 3300010376|Ga0126381_104310987 | Not Available | 551 | Open in IMG/M |
| 3300010379|Ga0136449_100592032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 1893 | Open in IMG/M |
| 3300010379|Ga0136449_101551550 | Not Available | 1009 | Open in IMG/M |
| 3300010396|Ga0134126_11406399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 771 | Open in IMG/M |
| 3300011270|Ga0137391_10257985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans rumicis | 1510 | Open in IMG/M |
| 3300012200|Ga0137382_10202252 | Not Available | 1364 | Open in IMG/M |
| 3300012200|Ga0137382_10955841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 616 | Open in IMG/M |
| 3300012202|Ga0137363_10859191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 770 | Open in IMG/M |
| 3300012207|Ga0137381_10432833 | Not Available | 1148 | Open in IMG/M |
| 3300012210|Ga0137378_10375225 | Not Available | 1321 | Open in IMG/M |
| 3300012354|Ga0137366_10956297 | Not Available | 599 | Open in IMG/M |
| 3300012918|Ga0137396_10336508 | Not Available | 1117 | Open in IMG/M |
| 3300012924|Ga0137413_11288086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → unclassified Rhodococcus → Rhodococcus sp. 14C212 | 586 | Open in IMG/M |
| 3300012929|Ga0137404_11206194 | Not Available | 696 | Open in IMG/M |
| 3300012951|Ga0164300_11008582 | Not Available | 536 | Open in IMG/M |
| 3300012971|Ga0126369_10228767 | All Organisms → cellular organisms → Bacteria | 1815 | Open in IMG/M |
| 3300012988|Ga0164306_10421417 | Not Available | 1008 | Open in IMG/M |
| 3300013307|Ga0157372_11977740 | Not Available | 670 | Open in IMG/M |
| 3300013307|Ga0157372_13290662 | Not Available | 515 | Open in IMG/M |
| 3300015372|Ga0132256_102668229 | Not Available | 599 | Open in IMG/M |
| 3300015373|Ga0132257_103677021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 558 | Open in IMG/M |
| 3300015374|Ga0132255_102303988 | Not Available | 822 | Open in IMG/M |
| 3300016270|Ga0182036_10498111 | Not Available | 965 | Open in IMG/M |
| 3300016341|Ga0182035_10814956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 820 | Open in IMG/M |
| 3300016341|Ga0182035_10959645 | Not Available | 756 | Open in IMG/M |
| 3300016341|Ga0182035_11668566 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300016357|Ga0182032_10647775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 883 | Open in IMG/M |
| 3300016387|Ga0182040_10295387 | All Organisms → cellular organisms → Bacteria | 1237 | Open in IMG/M |
| 3300016445|Ga0182038_12121113 | Not Available | 510 | Open in IMG/M |
| 3300017823|Ga0187818_10483438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 555 | Open in IMG/M |
| 3300017924|Ga0187820_1180615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 650 | Open in IMG/M |
| 3300017926|Ga0187807_1049417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora | 1304 | Open in IMG/M |
| 3300017926|Ga0187807_1179053 | Not Available | 683 | Open in IMG/M |
| 3300017928|Ga0187806_1199380 | Not Available | 678 | Open in IMG/M |
| 3300017932|Ga0187814_10109248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1022 | Open in IMG/M |
| 3300017933|Ga0187801_10468886 | Not Available | 530 | Open in IMG/M |
| 3300017942|Ga0187808_10098308 | All Organisms → cellular organisms → Bacteria | 1271 | Open in IMG/M |
| 3300017943|Ga0187819_10830716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 518 | Open in IMG/M |
| 3300017955|Ga0187817_10275848 | Not Available | 1071 | Open in IMG/M |
| 3300017955|Ga0187817_11022335 | Not Available | 530 | Open in IMG/M |
| 3300017959|Ga0187779_11357138 | Not Available | 505 | Open in IMG/M |
| 3300017961|Ga0187778_10470598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 832 | Open in IMG/M |
| 3300017970|Ga0187783_11107292 | Not Available | 570 | Open in IMG/M |
| 3300017994|Ga0187822_10390289 | Not Available | 511 | Open in IMG/M |
| 3300017995|Ga0187816_10064883 | All Organisms → cellular organisms → Bacteria | 1541 | Open in IMG/M |
| 3300017995|Ga0187816_10201720 | Not Available | 865 | Open in IMG/M |
| 3300018001|Ga0187815_10421399 | Not Available | 569 | Open in IMG/M |
| 3300018062|Ga0187784_11284578 | Not Available | 580 | Open in IMG/M |
| 3300020002|Ga0193730_1100034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 808 | Open in IMG/M |
| 3300020579|Ga0210407_11461846 | Not Available | 505 | Open in IMG/M |
| 3300020581|Ga0210399_10392038 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
| 3300020581|Ga0210399_10885619 | Not Available | 725 | Open in IMG/M |
| 3300020581|Ga0210399_11381232 | Not Available | 551 | Open in IMG/M |
| 3300020582|Ga0210395_10103182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2110 | Open in IMG/M |
| 3300020582|Ga0210395_10296639 | Not Available | 1215 | Open in IMG/M |
| 3300020582|Ga0210395_10673414 | Not Available | 774 | Open in IMG/M |
| 3300020583|Ga0210401_10801899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 801 | Open in IMG/M |
| 3300021086|Ga0179596_10038890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 1899 | Open in IMG/M |
| 3300021171|Ga0210405_10187614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1639 | Open in IMG/M |
| 3300021171|Ga0210405_10498458 | Not Available | 955 | Open in IMG/M |
| 3300021178|Ga0210408_10499975 | Not Available | 966 | Open in IMG/M |
| 3300021178|Ga0210408_10559843 | Not Available | 907 | Open in IMG/M |
| 3300021180|Ga0210396_10087896 | All Organisms → cellular organisms → Bacteria | 2818 | Open in IMG/M |
| 3300021180|Ga0210396_11146676 | Not Available | 653 | Open in IMG/M |
| 3300021181|Ga0210388_10018866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5557 | Open in IMG/M |
| 3300021181|Ga0210388_11614558 | Not Available | 538 | Open in IMG/M |
| 3300021401|Ga0210393_10277016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1362 | Open in IMG/M |
| 3300021401|Ga0210393_10559229 | Not Available | 934 | Open in IMG/M |
| 3300021401|Ga0210393_11062908 | Not Available | 654 | Open in IMG/M |
| 3300021402|Ga0210385_10353474 | Not Available | 1098 | Open in IMG/M |
| 3300021402|Ga0210385_11109351 | Not Available | 607 | Open in IMG/M |
| 3300021403|Ga0210397_10723683 | Not Available | 766 | Open in IMG/M |
| 3300021403|Ga0210397_10791969 | Not Available | 732 | Open in IMG/M |
| 3300021404|Ga0210389_10657258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 822 | Open in IMG/M |
| 3300021404|Ga0210389_11243691 | Not Available | 572 | Open in IMG/M |
| 3300021405|Ga0210387_11164521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 670 | Open in IMG/M |
| 3300021406|Ga0210386_11253542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 625 | Open in IMG/M |
| 3300021406|Ga0210386_11263955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 622 | Open in IMG/M |
| 3300021407|Ga0210383_10497724 | Not Available | 1052 | Open in IMG/M |
| 3300021407|Ga0210383_10849565 | Not Available | 780 | Open in IMG/M |
| 3300021407|Ga0210383_10904661 | Not Available | 752 | Open in IMG/M |
| 3300021420|Ga0210394_10868466 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 786 | Open in IMG/M |
| 3300021432|Ga0210384_10281076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1498 | Open in IMG/M |
| 3300021445|Ga0182009_10266682 | Not Available | 854 | Open in IMG/M |
| 3300021445|Ga0182009_10823528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 509 | Open in IMG/M |
| 3300021474|Ga0210390_10263158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1461 | Open in IMG/M |
| 3300021474|Ga0210390_10464521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1067 | Open in IMG/M |
| 3300021474|Ga0210390_10935011 | Not Available | 711 | Open in IMG/M |
| 3300021475|Ga0210392_10098127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1921 | Open in IMG/M |
| 3300021478|Ga0210402_11002580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 762 | Open in IMG/M |
| 3300021559|Ga0210409_10811499 | Not Available | 808 | Open in IMG/M |
| 3300021860|Ga0213851_1911184 | Not Available | 622 | Open in IMG/M |
| 3300022467|Ga0224712_10273984 | Not Available | 784 | Open in IMG/M |
| 3300022533|Ga0242662_10233735 | Not Available | 590 | Open in IMG/M |
| 3300022718|Ga0242675_1081067 | Not Available | 596 | Open in IMG/M |
| 3300025527|Ga0208714_1016005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1878 | Open in IMG/M |
| 3300025625|Ga0208219_1048642 | Not Available | 1065 | Open in IMG/M |
| 3300025901|Ga0207688_10431078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 820 | Open in IMG/M |
| 3300025906|Ga0207699_10784039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 700 | Open in IMG/M |
| 3300025910|Ga0207684_10929041 | Not Available | 730 | Open in IMG/M |
| 3300025911|Ga0207654_10937646 | Not Available | 628 | Open in IMG/M |
| 3300025912|Ga0207707_11061457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 662 | Open in IMG/M |
| 3300025915|Ga0207693_11450842 | Not Available | 508 | Open in IMG/M |
| 3300025917|Ga0207660_11597443 | Not Available | 526 | Open in IMG/M |
| 3300025919|Ga0207657_10359366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1148 | Open in IMG/M |
| 3300025921|Ga0207652_11250260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 645 | Open in IMG/M |
| 3300025927|Ga0207687_11683734 | Not Available | 544 | Open in IMG/M |
| 3300025928|Ga0207700_10113078 | Not Available | 2188 | Open in IMG/M |
| 3300025929|Ga0207664_10103144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2360 | Open in IMG/M |
| 3300025929|Ga0207664_10402958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1217 | Open in IMG/M |
| 3300025929|Ga0207664_10469854 | Not Available | 1124 | Open in IMG/M |
| 3300025929|Ga0207664_11555752 | Not Available | 583 | Open in IMG/M |
| 3300025934|Ga0207686_10467176 | Not Available | 973 | Open in IMG/M |
| 3300025936|Ga0207670_11528295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 568 | Open in IMG/M |
| 3300026095|Ga0207676_11364297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 704 | Open in IMG/M |
| 3300026142|Ga0207698_10758600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 970 | Open in IMG/M |
| 3300026551|Ga0209648_10527254 | Not Available | 670 | Open in IMG/M |
| 3300026890|Ga0207781_1014674 | Not Available | 812 | Open in IMG/M |
| 3300026984|Ga0208732_1025687 | Not Available | 542 | Open in IMG/M |
| 3300027064|Ga0208724_1004984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides iriomotensis | 1215 | Open in IMG/M |
| 3300027080|Ga0208237_1055654 | Not Available | 587 | Open in IMG/M |
| 3300027330|Ga0207777_1054161 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300027497|Ga0208199_1030418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1183 | Open in IMG/M |
| 3300027703|Ga0207862_1045919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1317 | Open in IMG/M |
| 3300027703|Ga0207862_1081742 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
| 3300027725|Ga0209178_1044152 | Not Available | 1421 | Open in IMG/M |
| 3300027765|Ga0209073_10437666 | Not Available | 542 | Open in IMG/M |
| 3300027853|Ga0209274_10075014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1639 | Open in IMG/M |
| 3300027854|Ga0209517_10730261 | Not Available | 506 | Open in IMG/M |
| 3300027857|Ga0209166_10281963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 877 | Open in IMG/M |
| 3300027884|Ga0209275_10088237 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1566 | Open in IMG/M |
| 3300027884|Ga0209275_10341502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 837 | Open in IMG/M |
| 3300027884|Ga0209275_10923581 | Not Available | 503 | Open in IMG/M |
| 3300027889|Ga0209380_10275880 | Not Available | 987 | Open in IMG/M |
| 3300027908|Ga0209006_10253816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1512 | Open in IMG/M |
| 3300027908|Ga0209006_10459363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1066 | Open in IMG/M |
| 3300027911|Ga0209698_11174614 | Not Available | 566 | Open in IMG/M |
| 3300027986|Ga0209168_10172551 | Not Available | 1090 | Open in IMG/M |
| 3300028742|Ga0302220_10334292 | Not Available | 548 | Open in IMG/M |
| 3300028782|Ga0307306_10158637 | Not Available | 632 | Open in IMG/M |
| 3300028789|Ga0302232_10058274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2032 | Open in IMG/M |
| 3300028799|Ga0307284_10312816 | Not Available | 632 | Open in IMG/M |
| 3300028801|Ga0302226_10050885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1970 | Open in IMG/M |
| 3300028906|Ga0308309_10187177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis | 1696 | Open in IMG/M |
| 3300029999|Ga0311339_11495856 | Not Available | 601 | Open in IMG/M |
| 3300030007|Ga0311338_10049566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5608 | Open in IMG/M |
| 3300030399|Ga0311353_10235224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1705 | Open in IMG/M |
| 3300030490|Ga0302184_10197614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 846 | Open in IMG/M |
| 3300030617|Ga0311356_11781172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 549 | Open in IMG/M |
| 3300030739|Ga0302311_10724730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 654 | Open in IMG/M |
| 3300031170|Ga0307498_10055541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1089 | Open in IMG/M |
| 3300031231|Ga0170824_115323547 | Not Available | 608 | Open in IMG/M |
| 3300031525|Ga0302326_12564886 | Not Available | 637 | Open in IMG/M |
| 3300031544|Ga0318534_10142144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1384 | Open in IMG/M |
| 3300031544|Ga0318534_10538930 | Not Available | 665 | Open in IMG/M |
| 3300031544|Ga0318534_10663306 | Not Available | 590 | Open in IMG/M |
| 3300031573|Ga0310915_10310510 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
| 3300031573|Ga0310915_10958515 | Not Available | 598 | Open in IMG/M |
| 3300031573|Ga0310915_11102054 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300031640|Ga0318555_10366130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 781 | Open in IMG/M |
| 3300031640|Ga0318555_10479301 | Not Available | 674 | Open in IMG/M |
| 3300031681|Ga0318572_10227058 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
| 3300031681|Ga0318572_10445054 | Not Available | 771 | Open in IMG/M |
| 3300031708|Ga0310686_103311796 | Not Available | 745 | Open in IMG/M |
| 3300031708|Ga0310686_105222159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1997 | Open in IMG/M |
| 3300031713|Ga0318496_10258890 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
| 3300031718|Ga0307474_10491136 | Not Available | 962 | Open in IMG/M |
| 3300031718|Ga0307474_10938562 | Not Available | 685 | Open in IMG/M |
| 3300031723|Ga0318493_10575071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 627 | Open in IMG/M |
| 3300031740|Ga0307468_100707733 | Not Available | 843 | Open in IMG/M |
| 3300031744|Ga0306918_11157409 | Not Available | 598 | Open in IMG/M |
| 3300031748|Ga0318492_10294966 | Not Available | 843 | Open in IMG/M |
| 3300031748|Ga0318492_10363967 | Not Available | 758 | Open in IMG/M |
| 3300031753|Ga0307477_11141627 | Not Available | 507 | Open in IMG/M |
| 3300031764|Ga0318535_10411280 | Not Available | 603 | Open in IMG/M |
| 3300031765|Ga0318554_10525544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 669 | Open in IMG/M |
| 3300031769|Ga0318526_10299158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 658 | Open in IMG/M |
| 3300031770|Ga0318521_10105724 | Not Available | 1556 | Open in IMG/M |
| 3300031777|Ga0318543_10475693 | Not Available | 560 | Open in IMG/M |
| 3300031782|Ga0318552_10556175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 586 | Open in IMG/M |
| 3300031792|Ga0318529_10448249 | Not Available | 601 | Open in IMG/M |
| 3300031793|Ga0318548_10229016 | Not Available | 913 | Open in IMG/M |
| 3300031797|Ga0318550_10405476 | Not Available | 660 | Open in IMG/M |
| 3300031798|Ga0318523_10364210 | Not Available | 719 | Open in IMG/M |
| 3300031799|Ga0318565_10223249 | Not Available | 916 | Open in IMG/M |
| 3300031799|Ga0318565_10453832 | Not Available | 620 | Open in IMG/M |
| 3300031819|Ga0318568_10039802 | All Organisms → cellular organisms → Bacteria | 2671 | Open in IMG/M |
| 3300031819|Ga0318568_10844639 | Not Available | 567 | Open in IMG/M |
| 3300031821|Ga0318567_10391980 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300031823|Ga0307478_10172000 | All Organisms → cellular organisms → Bacteria | 1731 | Open in IMG/M |
| 3300031823|Ga0307478_11345160 | Not Available | 593 | Open in IMG/M |
| 3300031831|Ga0318564_10309700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora olivasterospora | 696 | Open in IMG/M |
| 3300031860|Ga0318495_10313367 | Not Available | 697 | Open in IMG/M |
| 3300031860|Ga0318495_10534268 | Not Available | 510 | Open in IMG/M |
| 3300031879|Ga0306919_10429226 | Not Available | 1016 | Open in IMG/M |
| 3300031879|Ga0306919_10704766 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300031879|Ga0306919_10825330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 712 | Open in IMG/M |
| 3300031894|Ga0318522_10156964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora olivasterospora | 858 | Open in IMG/M |
| 3300031896|Ga0318551_10546025 | Not Available | 667 | Open in IMG/M |
| 3300031912|Ga0306921_10652784 | Not Available | 1213 | Open in IMG/M |
| 3300031912|Ga0306921_11961612 | Not Available | 625 | Open in IMG/M |
| 3300031912|Ga0306921_12286127 | Not Available | 567 | Open in IMG/M |
| 3300031942|Ga0310916_10899564 | Not Available | 742 | Open in IMG/M |
| 3300031945|Ga0310913_10183992 | All Organisms → cellular organisms → Bacteria | 1455 | Open in IMG/M |
| 3300031947|Ga0310909_11183290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 619 | Open in IMG/M |
| 3300031954|Ga0306926_10588863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1359 | Open in IMG/M |
| 3300031954|Ga0306926_10785386 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
| 3300031959|Ga0318530_10300713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 663 | Open in IMG/M |
| 3300032008|Ga0318562_10223475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1092 | Open in IMG/M |
| 3300032039|Ga0318559_10450263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 601 | Open in IMG/M |
| 3300032052|Ga0318506_10271352 | Not Available | 752 | Open in IMG/M |
| 3300032060|Ga0318505_10552532 | Not Available | 542 | Open in IMG/M |
| 3300032076|Ga0306924_10886312 | Not Available | 988 | Open in IMG/M |
| 3300032090|Ga0318518_10409662 | Not Available | 695 | Open in IMG/M |
| 3300032160|Ga0311301_10199387 | All Organisms → cellular organisms → Bacteria | 3436 | Open in IMG/M |
| 3300032160|Ga0311301_10551636 | All Organisms → cellular organisms → Bacteria | 1684 | Open in IMG/M |
| 3300032160|Ga0311301_11104230 | Not Available | 1031 | Open in IMG/M |
| 3300032160|Ga0311301_11364395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 888 | Open in IMG/M |
| 3300032160|Ga0311301_11371848 | Not Available | 885 | Open in IMG/M |
| 3300032160|Ga0311301_11373262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 884 | Open in IMG/M |
| 3300032174|Ga0307470_10200713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1274 | Open in IMG/M |
| 3300032180|Ga0307471_103183894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 582 | Open in IMG/M |
| 3300032180|Ga0307471_103699537 | Not Available | 541 | Open in IMG/M |
| 3300032180|Ga0307471_104328485 | Not Available | 501 | Open in IMG/M |
| 3300032261|Ga0306920_100320772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2307 | Open in IMG/M |
| 3300032770|Ga0335085_11452787 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300032782|Ga0335082_10946547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 725 | Open in IMG/M |
| 3300032783|Ga0335079_10897656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 911 | Open in IMG/M |
| 3300032805|Ga0335078_10114968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3859 | Open in IMG/M |
| 3300032829|Ga0335070_10991266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 776 | Open in IMG/M |
| 3300032892|Ga0335081_10309007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2089 | Open in IMG/M |
| 3300033289|Ga0310914_10653123 | Not Available | 946 | Open in IMG/M |
| 3300033475|Ga0310811_10265423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2016 | Open in IMG/M |
| 3300033475|Ga0310811_10907618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 794 | Open in IMG/M |
| 3300034124|Ga0370483_0210637 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300034268|Ga0372943_0971638 | Not Available | 566 | Open in IMG/M |
| 3300034818|Ga0373950_0080910 | Not Available | 678 | Open in IMG/M |
| 3300034820|Ga0373959_0202533 | Not Available | 525 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 27.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.71% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.08% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.76% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.44% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.13% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.17% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.17% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.17% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.17% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.86% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.90% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.90% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.90% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.59% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.27% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.27% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.27% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.27% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.27% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.95% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.95% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.63% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.63% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.63% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.63% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.63% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.63% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.63% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.32% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.32% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.32% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.32% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.32% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.32% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.32% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.32% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.32% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.32% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.32% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2065487018 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022718 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025527 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025625 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026890 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 51 (SPAdes) | Environmental | Open in IMG/M |
| 3300026984 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF048 (SPAdes) | Environmental | Open in IMG/M |
| 3300027064 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF003 (SPAdes) | Environmental | Open in IMG/M |
| 3300027080 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF009 (SPAdes) | Environmental | Open in IMG/M |
| 3300027330 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35 (SPAdes) | Environmental | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028742 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028801 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Host-Associated | Open in IMG/M |
| 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPINP_03522880 | 2065487018 | Soil | NWRVERLTGLGTPVPLAEAYADHLDWHRVARLVRRGCSPQLALRIVH |
| JGI12635J15846_101034081 | 3300001593 | Forest Soil | IPGSLAEIYADRIDWHQVARLVQRGCPPRLALRIVR* |
| JGI25617J43924_100880801 | 3300002914 | Grasslands Soil | SPVHNWRVSQLTRLGVPGPLAEVYADSIDWHQIARLVRRGCPPGLALRIAG* |
| JGI25617J43924_101037612 | 3300002914 | Grasslands Soil | RLERLGVPGPLAEIYADCIDWHQIAQLVRRGCPPGLALRNVG* |
| Ga0062385_103571032 | 3300004080 | Bog Forest Soil | LVHDWRVSQLTRLGIPVPLAEVYADRIDWHQIARLVQRGCPPRLALRIAN* |
| Ga0062389_1037542241 | 3300004092 | Bog Forest Soil | SLVHDWRALQLERLGIPELLAEIYADQIDWHQVARLVQRGCPPRMALRIVR* |
| Ga0062593_1004725163 | 3300004114 | Soil | MRLGFPGTLAEVYADRIDWHQIARLVRGGCPARLALRIVL* |
| Ga0066395_101241382 | 3300004633 | Tropical Forest Soil | RLVHRWRVTRLKRLGIPEPLAEAAADNVDWHQVAGLVQRGCSPRLALRIVR* |
| Ga0066395_108916981 | 3300004633 | Tropical Forest Soil | VHRWRVSQLTRLGIPGLLAEVYADHLDWHQVARLVQHGCPPRLALRIVG* |
| Ga0062388_1013704722 | 3300004635 | Bog Forest Soil | RAAQLRRLGIPAPLAEVYAGRLDWHQIARLVQRGCPPLLALRIVG* |
| Ga0066809_100489123 | 3300005168 | Soil | ARLTQLGISRAVAEVEADHLDWHQVARLVQHGCPPPLAMRIVQ* |
| Ga0066680_103091361 | 3300005174 | Soil | ERLGVPGPLAEIYADCIDWHQIAQLVRRGCPPGLALRIVS* |
| Ga0066388_1016728633 | 3300005332 | Tropical Forest Soil | RLTRLGVPGSLAEVYAGRLDWHEVARLVQRGCPPRLALRIAS* |
| Ga0066388_1057474822 | 3300005332 | Tropical Forest Soil | HNWQVARLTRLGVPGSLAEVYAGRLDWHEVARLVQRGCPPRLALRIAS* |
| Ga0068868_1005054433 | 3300005338 | Miscanthus Rhizosphere | DEPSVHNWRVSQLKRLGLPGSLAEVYADRVDWHQIARLVKHGCPPQLALRIIC* |
| Ga0070667_1021288031 | 3300005367 | Switchgrass Rhizosphere | VDRLTRLGVPGSLAEIHADRLDWHQVARLVQRGCPPRLALRTVR* |
| Ga0070714_1003156071 | 3300005435 | Agricultural Soil | LVHDWRVARLAQFGIPLSLAEVYADHIDWHQVARLVQRGCPPRLALRIAC* |
| Ga0070714_1021890201 | 3300005435 | Agricultural Soil | VARLTQLGIPRAVAEVEAGRLDWHQVARLVQHGCPTRLAMRIVL* |
| Ga0070710_100479241 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | RLAQFGIPLSLAEVYADRIDWHQVARLVQRGCPPRLALRIVR* |
| Ga0070708_1000834255 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VHNWRASRLRGLGVPGTLAEIYADRLEWHQVARLVQRGCPPLLAIRIVR* |
| Ga0070708_1020774502 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VAQLTRLGIPVLLAEIHADHLDWRQIARLVQRGCPPQLALRIVS* |
| Ga0070663_1015005691 | 3300005455 | Corn Rhizosphere | WRVARLAQFGIPESLAEVYADHIDWHHVARLVQRGCPPRLALRIVL* |
| Ga0070681_103415502 | 3300005458 | Corn Rhizosphere | HEWRVAQLVRLGLTESLAEVNADNVDWHEVARLVHDGCPPRLALRIAR* |
| Ga0070706_1005337351 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VHNWRVSQLTRLGISRPVAETYADRIDWHQVARLVQRGCPPQLAL |
| Ga0070706_1009494973 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | WRVSQLTRLGIPGMLAEIYADRIDWHQIARLVRRGCPPVLALRIVC* |
| Ga0070698_1001176045 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | TRLGVPGALAEVYADSIDWHQIARLVRRGCPPRLALRIVG* |
| Ga0070698_1005357951 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | QLTRLGIPGPLAEVYADRIDWHQTARLVCHGCPPRLALRIVC* |
| Ga0073909_103453942 | 3300005526 | Surface Soil | WRVSQLERLGVPGPLAHIYSDRIDWHQMARLVRYGCPPRLALRIVG* |
| Ga0070735_100585292 | 3300005534 | Surface Soil | MPNWRMSQLKRLGIPGPLAEIYADRIDWHQIARVVQRGCPPQLALRIVR* |
| Ga0070686_1001697154 | 3300005544 | Switchgrass Rhizosphere | HWRVSQLRRLGMPGPLAEIYADRIDWHQIARLVQHGCPLRLALRIVS* |
| Ga0070693_1001783814 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | SQLKRLGVLGPLAEIDADRIDWHQMARLVRCGCPPRLALRIVG* |
| Ga0070693_1008679631 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | HEWRVTQLMCLGIAESVAEVNADYVDWHQIAQLVQRGCPPRLALRIVR* |
| Ga0070665_1010470131 | 3300005548 | Switchgrass Rhizosphere | WRVQQLRRYGVPCGLAQIYADVVDWHALADLVRRGCPPGVALAIVS* |
| Ga0070665_1026036022 | 3300005548 | Switchgrass Rhizosphere | PVHNWRVSQLKRLGVLGPLAEIDADRIDWHQMARLVRCGCPPRLALRIVG* |
| Ga0068855_1011214212 | 3300005563 | Corn Rhizosphere | LGITESLAEANADNVDWHQIARLVQSGCPPRLALRIAR* |
| Ga0070761_100319613 | 3300005591 | Soil | VHNWRVDRLTRLGVPGSLAEVYADRLDWHQVARLVQRGCPPRLALRIAL* |
| Ga0070762_108431722 | 3300005602 | Soil | LVHNWRVSQLTRLGVPGTLAEIYADHIDWHQVARLVRRGCPPGLALRIVC* |
| Ga0068856_1005539071 | 3300005614 | Corn Rhizosphere | RWRVSQLMRLGIPGLLAEVYADHLDWHQVARLVQHGCPPRLALRIVG* |
| Ga0068852_10001599911 | 3300005616 | Corn Rhizosphere | PGPLAEIYADRLDWHQMARLVRCGCPPRLALRIVG* |
| Ga0066903_1072248673 | 3300005764 | Tropical Forest Soil | YKERPVHARRVSQLTRLDIPGPLAETYADHLDWQQIARLVRRGCPPLLTLRIVR* |
| Ga0070766_107371062 | 3300005921 | Soil | VHNWRVSQLTRLGIPGSLAEIYADRIDWHQVARLVQRGCPPRLALRIVR* |
| Ga0081540_13521992 | 3300005983 | Tabebuia Heterophylla Rhizosphere | VHTRRVARLTRLGIPALLAEIHADHLDWHQIARLVQRGCPPQLALHIVS* |
| Ga0070716_1002608541 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MHNWRVSRLTRLGIPGPLAEIYADRIDWHQVARLVRRGCPPRLA |
| Ga0070716_1004692152 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VSQLTRLGIPGPPAEVYADRIDWHQIARLVQPGCPPPLALRIAG* |
| Ga0070712_1009681482 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LSLAEVYADRIDWHQVARLVQRGCPPRLALRIVR* |
| Ga0070765_1007117042 | 3300006176 | Soil | VHNWRVSQLTRLGISRPLAEIYADNIDWHQIARLVQRGCPPHLALRIVR* |
| Ga0070765_1018109881 | 3300006176 | Soil | RLTRLGVPGSLAEVYADRLDWHQVARLVRRGCPPRLALRITL* |
| Ga0074049_127540134 | 3300006580 | Soil | PRAVAEVEADRLDWHQVARLVQHRLPPRLAMRIVL* |
| Ga0079221_101444873 | 3300006804 | Agricultural Soil | LYVHRWRVSQLTRLGIPGLLAEVYADHLDWHQVARLVQHGCPPRLALRIVG* |
| Ga0079221_102432721 | 3300006804 | Agricultural Soil | VSQLVRLGFPGTLAEVYADRIDWHQIARLVRGGCPARLALRIVL* |
| Ga0079221_102627102 | 3300006804 | Agricultural Soil | VSWLERLGVPGPLAEIYADCIDWHQIALLVLRGCPPGLALRNVG* |
| Ga0075426_101961004 | 3300006903 | Populus Rhizosphere | VHDWRVARLAQFGIPLSLAEVYADRIDWHQVARLVQRGCPPRLALRIVR* |
| Ga0075426_114577172 | 3300006903 | Populus Rhizosphere | EMLAEVYADHLDWHHVARLVQHGCPPQLALLIVG* |
| Ga0075435_1016596693 | 3300007076 | Populus Rhizosphere | LGMPGPLAEIYADRIDWHQIARLVQHGCPLRLALRIVS* |
| Ga0099793_105101241 | 3300007258 | Vadose Zone Soil | PVHNWRVSQLERLGVPGPLAEIYADRIDWHQMARLVRCGCPPRLALRIVG* |
| Ga0066793_101576462 | 3300009029 | Prmafrost Soil | GIPELLAEVYADRLDWHQIARLVQRGCPVRLAIRTAR* |
| Ga0105250_105841452 | 3300009092 | Switchgrass Rhizosphere | VARLTRLGIPALLAEIHADHLDWHQIARLVQRGCPPQLALRIVS* |
| Ga0105245_101563306 | 3300009098 | Miscanthus Rhizosphere | QLRRLGMPGPLAEIYADRIDWHQIARLVQHGCPLRLALRIVS* |
| Ga0105247_115775361 | 3300009101 | Switchgrass Rhizosphere | GNLAEEYADRIDWHEVARLVLKGCPPELALHIVG* |
| Ga0099792_107100853 | 3300009143 | Vadose Zone Soil | WRVSQLKRLGIPGSLAEVYADRVDWHQIARLVKHGCPPQLALRIIC* |
| Ga0075423_120814811 | 3300009162 | Populus Rhizosphere | TWRVARLTQLGIPRAVAEVEADRLDWHQVARLVQHGCPPRLAMRIVL* |
| Ga0075423_129667431 | 3300009162 | Populus Rhizosphere | VLDWRVSQVTRLGIPGPPAEVYADRIDWHQIARLVQPGCPPPLALRIAG* |
| Ga0116214_10073907 | 3300009520 | Peatlands Soil | TRLGVPGSLAEVYADRLDWHQVARLVQRGCPPRLALRIVL* |
| Ga0116221_11960333 | 3300009523 | Peatlands Soil | VRNWRVARLTQLGIPGALAEVNADHLDWHQVARLVQLGCPPRLALRIAR* |
| Ga0105237_114234371 | 3300009545 | Corn Rhizosphere | WRVSQLKRLGIPGSLAEIYADRVDWHQIARLVKHGCPPQLALRIIC* |
| Ga0116216_101899371 | 3300009698 | Peatlands Soil | QLTRLGIPGPLAEIYADRIDWHQVARLVQCGCPPHLALRIVR* |
| Ga0116217_100184311 | 3300009700 | Peatlands Soil | RLTRLGVPGSLAEVYADRLDWHQVARLVQRGCPPRLALRIVL* |
| Ga0126374_102418223 | 3300009792 | Tropical Forest Soil | RLGIPGALAEVYADHLDWHQIARLVQRGCPPLLALRIVA* |
| Ga0126380_105852283 | 3300010043 | Tropical Forest Soil | GIPGALAEVYADHLDWHQIARLVQRGCPPLLALRIVA* |
| Ga0126384_110693631 | 3300010046 | Tropical Forest Soil | RVSQLTRLDIPGPLVETYADHLDWQQIARRVRRGCPPLLTLRIVR* |
| Ga0126372_107449171 | 3300010360 | Tropical Forest Soil | MCLGIAESVAEVNADYVDWHQIAQLVQRGCPPRLALRIVR* |
| Ga0126378_130254461 | 3300010361 | Tropical Forest Soil | VHAWRVSQLIRLGIPGALAEVYADHLDWHQIARLVRRGCPPLLALRIVR* |
| Ga0134128_107469524 | 3300010373 | Terrestrial Soil | RLGFPGTLAEVYADRIDWHQVARLIRGGCPARLALRIVL* |
| Ga0134128_125975833 | 3300010373 | Terrestrial Soil | SVHDWRVSQLTRLGIPGPPAEIYADRIDWHQIARLVCRGCPPRLALRIIC* |
| Ga0126381_1017551072 | 3300010376 | Tropical Forest Soil | VHDWRVDRLTRLGLPGSLAEVYADRLDWHQVARLVQRGCPPRLALRIVL* |
| Ga0126381_1035393811 | 3300010376 | Tropical Forest Soil | LVHNWRAMQLRRLGIPAPLAEAAADHVDWHRVARLVQRGCPPQLALRIVR* |
| Ga0126381_1043109871 | 3300010376 | Tropical Forest Soil | LGIPGLLAEIYADRIDWHQVARLVQRGCPPQLALRIVR* |
| Ga0126381_1044915341 | 3300010376 | Tropical Forest Soil | IPGPVAEAQADRVDWHQVAALVRRGCPAVLALRIVR* |
| Ga0136449_1005920325 | 3300010379 | Peatlands Soil | CLLIRLGIPGPLAEADAHRTDWHEIARLVQHGCPPQLAFRIVR* |
| Ga0136449_1015515503 | 3300010379 | Peatlands Soil | VAQLTRLGIPGSLAEVYADRIDWHQIARLVQRGCPPRLALRIAS* |
| Ga0134126_114063992 | 3300010396 | Terrestrial Soil | LGIAESVAEVNADYVDWHQIAQLVQRGCPPRLALRIVR* |
| Ga0137391_102579852 | 3300011270 | Vadose Zone Soil | HHWRASRLRRLGMPGPMAEVYAGRIDWHQIARLVHHGCPLRLALRIVS* |
| Ga0137382_102022521 | 3300012200 | Vadose Zone Soil | PGPLAEIYADCIDWHQIAQLVRRGCPPGLALRIVG* |
| Ga0137382_109558411 | 3300012200 | Vadose Zone Soil | LKRLGIPGPLADAAADHVDWHQVAKLVRRGCPPQLALRIVR* |
| Ga0137363_108591912 | 3300012202 | Vadose Zone Soil | LSVHRWRVSQLTRLGIPGTLAEMYADRIDWHQVARLVRGGCPPRLALRIVR* |
| Ga0137381_104328331 | 3300012207 | Vadose Zone Soil | RLGVPGPLAEIYADRIDWHQMARLVRCGCPPRLALRIVG* |
| Ga0137378_103752252 | 3300012210 | Vadose Zone Soil | MTNHPCNNWRVSQLKRLGVPGPLAEIYADRIDWHQMARLVRCGCPPRLALRIVG* |
| Ga0137366_109562971 | 3300012354 | Vadose Zone Soil | RALAEVEADRLDWHQVARLVQHGCPPPLALRIVQ* |
| Ga0137396_103365082 | 3300012918 | Vadose Zone Soil | HNWRVSQLKRLGVPGPLAEIYADRIDWHQMARLVRCGCPPRLALRIVV* |
| Ga0137413_112880863 | 3300012924 | Vadose Zone Soil | PGLLAEGAASRVDWHEIAKLVQRGCPPLLALRIVR* |
| Ga0137404_112061942 | 3300012929 | Vadose Zone Soil | VSQLTRLGIPGTLAEVYADRIDWHQIARLIRGGCPARLALRIVV* |
| Ga0164300_110085821 | 3300012951 | Soil | ASQLRRLGMPGPLAEIYADRIDWHQIARLVHHGCQLRLALRIVS* |
| Ga0126369_102287673 | 3300012971 | Tropical Forest Soil | VHNWRVSQLKRLGIPGPLAEIYADRIDWHQIARLVQRGCPPRLALRIAR* |
| Ga0164306_104214171 | 3300012988 | Soil | TRLGIPGPLAEVYADRIDWHQIARLVCHGCPPWLALRIVG* |
| Ga0157372_119777401 | 3300013307 | Corn Rhizosphere | VSQLKRLSLSGPLAEIYADRIDWHQVARLVQRGCPPRLAPRIVS* |
| Ga0157372_132906621 | 3300013307 | Corn Rhizosphere | QEAVHDWRVSQLMRLGFPGTLAEVYADRIDWHQVARLIRGGCPARLALRIVL* |
| Ga0132256_1026682291 | 3300015372 | Arabidopsis Rhizosphere | VSQLRRLGTAGPLAEIYADRIDWHQIARLVQHGCPLRLALRIVS* |
| Ga0132257_1036770213 | 3300015373 | Arabidopsis Rhizosphere | WRVSQLKRLGLPGPLAEIHADRIDWHQMARLVRCGCPPRLALRIVG* |
| Ga0132255_1023039881 | 3300015374 | Arabidopsis Rhizosphere | RAVAEVEADRLDWHQVARLVQHGCPPRLAMRIVL* |
| Ga0182036_104981112 | 3300016270 | Soil | HKWRAAQLKRLGIPEPLAEVYADRLDWHQVARLVGRGCPPLLALRIVR |
| Ga0182035_108149562 | 3300016341 | Soil | TRLGIPGPPTEVYADRIDWHQIARLVQPGCPPPLSLRIAG |
| Ga0182035_109596451 | 3300016341 | Soil | NWRVDRLTRLGVPGSLAEVYADRLDWHQVARLVQRGCPPRLALRIVL |
| Ga0182035_116685661 | 3300016341 | Soil | TGLGVPPALAEAYADRLDWHQVARLVQRGCPPELALRIVH |
| Ga0182032_106477751 | 3300016357 | Soil | LGIPAALAEAYADRVDWHQVAKLAHRGCPPLLALRIIC |
| Ga0182040_102953873 | 3300016387 | Soil | LGIPGSLAEAYADRLDWHQIARLVQRGCPPLLALRIVR |
| Ga0182038_121211132 | 3300016445 | Soil | GVPGSLAEVYADRLDWHQVAQLVQRGCPPRLALRIVL |
| Ga0187818_104834382 | 3300017823 | Freshwater Sediment | VHNWRVARLTGLGIPGSLAEVDADHLDWHQVARLVQLGCPPRLALRIAR |
| Ga0187820_11806152 | 3300017924 | Freshwater Sediment | VDRLTRLGVPGSLAEVHADRLDWHQVAQLVRRGCPPRPALRIVL |
| Ga0187807_10494171 | 3300017926 | Freshwater Sediment | TRLGVSRPLAEAYADQLDWHQIARLVKRGCPPQLALRIVR |
| Ga0187807_11790532 | 3300017926 | Freshwater Sediment | TRLGVPGSLAEVYADRLDWHQVARLVLRGCPPRLALRIVL |
| Ga0187806_11993801 | 3300017928 | Freshwater Sediment | IPWLLAEVYADRLDWHQIAQLVQHGCPVRLAIRIAC |
| Ga0187814_101092482 | 3300017932 | Freshwater Sediment | ARLTGLGIPGSLAEVNADHLDWHQVARLVQRGCPPRLALRIAR |
| Ga0187801_104688861 | 3300017933 | Freshwater Sediment | RVDRLTRLGVPGSLAEVHADRLDWHQVARLVLRGCPPRLALRIVL |
| Ga0187808_100983083 | 3300017942 | Freshwater Sediment | LGVPGSLAEIYADRLDWHQVARLVQRGCPPRLALLIVL |
| Ga0187819_108307162 | 3300017943 | Freshwater Sediment | SGGPGSLAEVHADRLDWHQVAQLVRRGCPPRPALRIVL |
| Ga0187817_102758481 | 3300017955 | Freshwater Sediment | WRVDRLTRLGVPGSLAEVYADRLDWHQVARLVQRGCPPRLALRIVL |
| Ga0187817_110223352 | 3300017955 | Freshwater Sediment | VHDWRVDRLTRLGVPGSLAEIYADRLDWHQVARLVQRGCPPRLALRIAS |
| Ga0187779_113571382 | 3300017959 | Tropical Peatland | VARLTRLGIPGPLAEVHADHLDWHQIARLVQRGCPPQLALRIVS |
| Ga0187778_104705981 | 3300017961 | Tropical Peatland | WRVARLTRLGIPALLAEIHADHLDWHQIARLVQRGCPPQLALHIVS |
| Ga0187783_111072921 | 3300017970 | Tropical Peatland | TRLGIPAVLAEIHADHLDWHQIARLVQRGCPPLLALRIVG |
| Ga0187822_103902892 | 3300017994 | Freshwater Sediment | GVSRPLAEAYADQLDWHQIARLVKRGCPPQLALRIVR |
| Ga0187816_100648833 | 3300017995 | Freshwater Sediment | RLTRLGVPGSLAEVYADRLDWHQVARLVLRGCPPRLALRIVL |
| Ga0187816_102017203 | 3300017995 | Freshwater Sediment | LTRLGLPGSLAEVYADRLDWHQVARLVQRGCPPRLALRIVL |
| Ga0187815_104213992 | 3300018001 | Freshwater Sediment | HNWRVARLTGLGIPGSLAEVNADHLDWHQVARLVQRGCPPRLALRIAR |
| Ga0187784_112845781 | 3300018062 | Tropical Peatland | DLPVHTWRVAQLTRLGIPALLAEIHADHLDWHQIARLVQRGCPPQLALHIVS |
| Ga0193730_11000341 | 3300020002 | Soil | DEPSVHNWRVSQLKRLGIPGSLAEIYADRIDWHQIARLVKDGCPPQLALRIVR |
| Ga0210407_114618462 | 3300020579 | Soil | RASQLKRLGMPGPLAEVYADRIDWHQIARLVQHGCPVRLALRIVS |
| Ga0210399_103920381 | 3300020581 | Soil | DRLTRLGVPGSLAEIYADRLDWHQVARLVQRGCPPRLALRIAS |
| Ga0210399_108856192 | 3300020581 | Soil | TRLGVPGSLAEIYADRLDWHQVARLVQRGCPPRLALRIAS |
| Ga0210399_113812322 | 3300020581 | Soil | HRWRVSQLKRLGISEMLAEVYADHLDWHHVARLVQHGCPPQLALLIVG |
| Ga0210395_101031823 | 3300020582 | Soil | VHNWRVDRLTRLGVPGTLAEVYADRLDWHQVARLVQRGCPPRLALRIVLR |
| Ga0210395_102966391 | 3300020582 | Soil | RVTQLRRLGIPGSLAETYAERIDWHQVARLVHRGCPPRLALRIVR |
| Ga0210395_106734143 | 3300020582 | Soil | TGAVAEIYADCIDWHQIARLVQRGCPPHLALRIVS |
| Ga0210401_108018992 | 3300020583 | Soil | VHNWRVDRLTRLGVPGTLAEVYADRLDWHQVARLVQRGCPPRLALR |
| Ga0179596_100388902 | 3300021086 | Vadose Zone Soil | VHNWRVSQLERLGVPEPLAEAYADRADWHQVARLVQRGCPPRLALRIVC |
| Ga0210405_101876143 | 3300021171 | Soil | RLGVPGPLAHIYADRIDWHQMARLVRYGCPPRLALRIVG |
| Ga0210405_104984581 | 3300021171 | Soil | SPVCHWRVSQLRRFGISGPLAGIYADRIEWHQIARPVRRSCPPRLTLRIIL |
| Ga0210408_104999752 | 3300021178 | Soil | RLGVPGPLAEIYADRIDWHQMARLVRYGCPPRLALRIVG |
| Ga0210408_105598431 | 3300021178 | Soil | LGMPGPLAEIYADRIDWHQIARLVQHGCPLRLALRIVS |
| Ga0210396_100878964 | 3300021180 | Soil | VHNWRVDRLTRLGVPGSLAEVYADRLDWHQVARLVRRGCPPRLALRITL |
| Ga0210396_111466761 | 3300021180 | Soil | PVHNWRVSQLERLGVPGPLAHIYADRIDWHQMARLVRYGCPPRLALRIVG |
| Ga0210388_100188668 | 3300021181 | Soil | HNWRVTQLARLGVPGPLAETYADRIDWHQVARLVHRGCPPRLALRIVR |
| Ga0210388_116145581 | 3300021181 | Soil | VDRLTRLGIPRSLAEVYADRLDWHQVARLVQRGCPPRLALRIAV |
| Ga0210393_102770162 | 3300021401 | Soil | VSQLTRLGIPGPLAEIYADRIDWHQVARLVQHGCPPRLALRIVR |
| Ga0210393_105592294 | 3300021401 | Soil | RLGIPGSLAETYAERIDWHQVARLVHRGCPPRLALRIVR |
| Ga0210393_110629081 | 3300021401 | Soil | LGVPGSLAEIYADRLDWHQVARLVQRGCPPRLALRIAS |
| Ga0210385_103534741 | 3300021402 | Soil | HDWRVLQLIRLGIPGALAEVYADRIDWHQVAQLVRRGCPPQLALRIVR |
| Ga0210385_111093511 | 3300021402 | Soil | IPGSLAETYADRIDWHQVARLVHRGCPPRLALRIVR |
| Ga0210397_107236831 | 3300021403 | Soil | SGPMAEIYADRIDWHQIARLVRRGCPPRLALRIAL |
| Ga0210397_107919691 | 3300021403 | Soil | RHLGVPGPLAEIYADRIDWHQMARLVRYGCPPRLALRIVG |
| Ga0210389_106572582 | 3300021404 | Soil | VHNWRVSQLERLGVPEPLAEAYADRADWHQVARLVQHGCPLRLALRIVC |
| Ga0210389_112436911 | 3300021404 | Soil | DRLTRLGVPGTLAEVYADRLDWHQVARLVQRGCPPRLALRIAS |
| Ga0210387_111645211 | 3300021405 | Soil | HNWRVDRLTRLGVPGSLAEVYADRLDWHQVARLVRRGCPPRLALRITL |
| Ga0210386_112535422 | 3300021406 | Soil | RVTQLKRLGVPAPLAEADADRVDWHTIAGLVRRGCPPRLAMRIAL |
| Ga0210386_112639552 | 3300021406 | Soil | EKRLVHDWRVSQLTRLGIPRSLAEVYADRIDWHQIARLVQRGCPPRLALRIAS |
| Ga0210383_104977241 | 3300021407 | Soil | NRLTRLGVPGSLAEVYADRLDWHQVARLVQRGCPPRLALRIVL |
| Ga0210383_108495651 | 3300021407 | Soil | VEEGRVHHWRASQLRRLGIPGPLAEVHADHLDWHQIARLVQHGCPPRLALRIVR |
| Ga0210383_109046612 | 3300021407 | Soil | PPPSYRIPGPAEVYADRIDWHQIAGLVWHGSPPRLALRIVC |
| Ga0210394_108684663 | 3300021420 | Soil | NWRVSPLTRLGIPGTLAEIHADRIDWHQIARLVRRGCPPRLALRIVL |
| Ga0210384_102810761 | 3300021432 | Soil | RLGVPGPLAEIYADRIDWHQMARLVRCGCPPRLALRIVG |
| Ga0182009_102666821 | 3300021445 | Soil | PGPLAELYADRIDWHQIARLVRRGCPPRLALRIIC |
| Ga0182009_108235281 | 3300021445 | Soil | LAQFGIPRSLAEVYADHIDWHQIARLVQRGCPPRLALRIVR |
| Ga0210390_102631583 | 3300021474 | Soil | VHEWRVAQLKRLGVPAPLAEADADRVDWHKIAGLVRRGCPPRLAMRIVL |
| Ga0210390_104645211 | 3300021474 | Soil | RLGISGPLAEIYADGVDWHQIARLVQRGCPPHLALRIVR |
| Ga0210390_109350113 | 3300021474 | Soil | HNWRVSQLTRLGITGAVAEVYADCIDWHQIARLVQRGCPPHLALRIVS |
| Ga0210392_100981273 | 3300021475 | Soil | SESHVNRWRVARLKRLGIPAPLAEVHADHLDWHQIARLVQRGCPPRLALRIVR |
| Ga0210402_110025801 | 3300021478 | Soil | LTRLGIPGLLAEIHSDHLDWHQIARLVQRGCPPQLALRIVS |
| Ga0210409_108114993 | 3300021559 | Soil | VHNWRVSQLTRLGIGGAVAEIYADCIDWHQIARLVQRGCPPYLALRIVS |
| Ga0213851_19111841 | 3300021860 | Watersheds | PGPLAEVNADHLDWHQVARLVQLGCPPRLALRIVR |
| Ga0224712_102739842 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | GVPGPLAPIYADRIDWHQMARLVRYGCPPRLALRIVG |
| Ga0242662_102337351 | 3300022533 | Soil | HEWRVAQLVRLGIAAPLAEVNADNVDWHQIDQLVQCGCPPRLALRIAR |
| Ga0242675_10810672 | 3300022718 | Soil | PEPLAEVYADHLDWHQIARLVQHGCPPRLALRIVL |
| Ga0208714_10160051 | 3300025527 | Arctic Peat Soil | VHNWRVARLTQLGIPGPLAEVNADHLDWHQVARLVRLGCPPRLALRIAR |
| Ga0208219_10486422 | 3300025625 | Arctic Peat Soil | PQSLAEVYADHIDWHQIGRLVQRGCLPRLALRIVR |
| Ga0207688_104310781 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | LTRLGIPGLLAEIHADHLDWRQIARLVQRGCPPRLALRIVS |
| Ga0207699_107840392 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | AQFGIPLSLAEVYADRIDWHQVARLVQRGCPPRLALRIVR |
| Ga0207684_109290412 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | SVHNWRASRLRGLGVPGTLAEIYADRLDWHQVARLVQRGCPPLLAIRIVR |
| Ga0207654_109376461 | 3300025911 | Corn Rhizosphere | WRVSQLKRLGLPASLAEIYADRIDWHQIARLVKHGCPPQLALRIIC |
| Ga0207707_110614572 | 3300025912 | Corn Rhizosphere | QLMCLGIAESVAEVNADYVDWHQIAQLVQRGCPPRLALRIVR |
| Ga0207693_114508421 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | LPAHTWRVAQLTRLGIPGLLAEIHADHLDWRQIARLVQRGRPPQLALRIVS |
| Ga0207660_115974431 | 3300025917 | Corn Rhizosphere | TRLGVPGSLAEIHADRLDWHQVARLVQRGCPPRLALRIAS |
| Ga0207657_103593661 | 3300025919 | Corn Rhizosphere | VHNWRASQLERLGVPGPLAEIYADRLDWHQMARLVRCGCPPRLALRIVG |
| Ga0207652_112502603 | 3300025921 | Corn Rhizosphere | TRLGIPGLLAEIHADHLDWRQIARLVQRGCPPRLALRIVS |
| Ga0207687_116837341 | 3300025927 | Miscanthus Rhizosphere | DRLTRLGVPGSLAEIHADRLDWHQVARLVQRGCPPRLALRIAS |
| Ga0207700_101130784 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | ERLGVPGPLAEIYADRLDWHQMARLVRCGCPPRLALRIVG |
| Ga0207664_101031441 | 3300025929 | Agricultural Soil | EGRRLHEWRVAQLVRLGITESLAEVNADNVDWHQIARLVQSGCPPRLALRIAR |
| Ga0207664_104029581 | 3300025929 | Agricultural Soil | PGSLAEAYADRIDWHQVARLVQRGCPPRLALRIAC |
| Ga0207664_104698541 | 3300025929 | Agricultural Soil | LGVPGPLAHIYSDRIDWHQMARLVRYGCPPRLALRIVG |
| Ga0207664_115557521 | 3300025929 | Agricultural Soil | RRLGLPGPLAEIYADRIDWHQIARLVQHGCPLRLALRIVS |
| Ga0207686_104671761 | 3300025934 | Miscanthus Rhizosphere | RRLGMPGPLAEIYADRIDWHQIARLVQHGCPLRLALRIVS |
| Ga0207670_115282953 | 3300025936 | Switchgrass Rhizosphere | RVARLTRLGIPALLAEIHADHLDWHQIARLVQRGCSPQLALRIVS |
| Ga0207676_113642971 | 3300026095 | Switchgrass Rhizosphere | GIPVLLAEIHADHLDWRQIARLVQRGCPPQLALRIVS |
| Ga0207698_107586002 | 3300026142 | Corn Rhizosphere | MCLGIAESVAEANADYVDWHQIAQLVQRGCPPRLALRIVR |
| Ga0209648_105272542 | 3300026551 | Grasslands Soil | IPGSFAEIYADRIDWHQIARLVRRGCPPRLALRIAG |
| Ga0207781_10146741 | 3300026890 | Tropical Forest Soil | TQLGIPRAVAEVQADRLDWHQVARLVQHGCPPQLALRIAR |
| Ga0208732_10256871 | 3300026984 | Forest Soil | QLARLGIPGPLAEIYADRIDWHQVARLVHRGCPPHLALRIVR |
| Ga0208724_10049841 | 3300027064 | Forest Soil | NWRVTQLRRLGIPGSLAETYAERIDWHQVARLVHRGCPPRLALRIVR |
| Ga0208237_10556541 | 3300027080 | Forest Soil | RLGVPGSLAEVYADRLDWHQVARLVQRGWPPRLALRIVL |
| Ga0207777_10541611 | 3300027330 | Tropical Forest Soil | GLGVPPALAEAYADRLDWHQVARLVQRGCPPELALRIVH |
| Ga0208199_10304182 | 3300027497 | Peatlands Soil | LGVPGSLAEVYADRLDWHQVARLVQRGCPPRLALRIVL |
| Ga0207862_10459193 | 3300027703 | Tropical Forest Soil | LVHNWRVARLTQLGIPGPLAEVDADHLDWHQVARLVQHGCPPQLALRIVG |
| Ga0207862_10817422 | 3300027703 | Tropical Forest Soil | RLTGLGVPPALAEAYADRLDWHQVARLVQRGCPPELALRIVH |
| Ga0209178_10441523 | 3300027725 | Agricultural Soil | HNWRVSQLERLGVPGPLAEIYADRLDWHQMARLVRCGCPPRLALRIAG |
| Ga0209073_104376662 | 3300027765 | Agricultural Soil | RLGIPGPLAEIYADRLDWHQMARLVRCGCPPRLALRIVG |
| Ga0209274_100750144 | 3300027853 | Soil | VHNWRVDRLTRLGVPGSLAEVYADRLDWHQVARLVQRGCPPRLALRIAL |
| Ga0209517_107302611 | 3300027854 | Peatlands Soil | PESLAEVYADQIDWHQVARLVQRGCPPRLALRIVR |
| Ga0209166_102819631 | 3300027857 | Surface Soil | KRLGVPGSLAEIYADRIDWHQLARLVRCGCPPRLALRIVG |
| Ga0209275_100882375 | 3300027884 | Soil | GISGPLAEIYADGVDWHQIARLVQRGCPPHLALRIVR |
| Ga0209275_103415022 | 3300027884 | Soil | QLKRLGVPAPLAEADADRVDWHKIAGLVRRGCPPRLAMRIVL |
| Ga0209275_109235811 | 3300027884 | Soil | TRLGIPGLLAEGAASRVDWHEIARLVQRGCPPLLALRIVR |
| Ga0209380_102758801 | 3300027889 | Soil | HNWRVSQLTRLGIAGSVAEIYADCIDWHQIARLVQRGCPPYLALRIVS |
| Ga0209006_102538161 | 3300027908 | Forest Soil | PGPLAEVYADCLDWHQVARLVQRGCSARLAIRIAH |
| Ga0209006_104593631 | 3300027908 | Forest Soil | IPGSLAEIYADRIDWHQIARLVQRGCPARLALRIAG |
| Ga0209698_111746142 | 3300027911 | Watersheds | LVHSWRVERLTRIGVPGALAEVYADHLDWHEVARLVQRGCPPQLALRIAR |
| Ga0209168_101725512 | 3300027986 | Surface Soil | MPNWRVSQLKRLGIPGPLAEIYADRIDWHQIARLVQRGCPPQLALRIVR |
| Ga0302220_103342923 | 3300028742 | Palsa | HNWRVSQLKRLGLSGSLAESYADRIDWHQIARLVKHGCSPQLALRIVR |
| Ga0307306_101586372 | 3300028782 | Soil | TRLGVPGSLAEVYADRLDWHQIARLVQRGCPPRLALRIAL |
| Ga0302232_100582745 | 3300028789 | Palsa | WRVSQLTRLGIPRPLAEAYADHLDWHQLAELLQRGCPPRLALRIVR |
| Ga0307284_103128163 | 3300028799 | Soil | LQLMRLGLPGTLAEVYADRIDWHQVARLVRCGCPARLALRIVL |
| Ga0302226_100508853 | 3300028801 | Palsa | QLKRLGLSGSLAESYADRIDWHQIARLVKHGCSPQLALRIVR |
| Ga0308309_101871771 | 3300028906 | Soil | VHNWRVSQLTRLGISRPLAEIYADNIDWHQIARLVQRGCPPHLALRIVR |
| Ga0311339_114958562 | 3300029999 | Palsa | LGIPGPLAELYADQIDWHQIARLVQRGRPPRLALRIAG |
| Ga0311338_100495667 | 3300030007 | Palsa | GLSGSLAESYADRIDWHQIARLVKHGCSPQLALRIVR |
| Ga0311353_102352243 | 3300030399 | Palsa | SGSLAESYADRIDWHQIARLVKHGCSPQLALRIVR |
| Ga0302184_101976141 | 3300030490 | Palsa | RVSQLARLGIPGTLAEVYADRIDWHQIACLVQRGCPARLALRIVS |
| Ga0311356_117811722 | 3300030617 | Palsa | LGDEASVVHEWRTVQLTRLGIPRPLAEDAADAVDCHQIAALVRRGCPPQLALRIVR |
| Ga0302311_107247303 | 3300030739 | Palsa | KWLVHDWRVSQLARLGIPGTLAEVYADRIDWHQIACLVQRGCPARLALRIVS |
| Ga0307498_100555413 | 3300031170 | Soil | LGIPGTLAEVYADRIDWHQIARLVRGGCPARLALRIVV |
| Ga0170824_1153235471 | 3300031231 | Forest Soil | QLVRLGIAAPLAEVNADNVDWHQIDQLVQCGCPPRLALRIAR |
| Ga0302326_125648862 | 3300031525 | Palsa | WRVSQLTRLGIPGTLAEVYADRIDWHQIARLVQRGCPARLALRIVS |
| Ga0318534_101421441 | 3300031544 | Soil | VHDWRVARLAQFGIPRSLAEVYADHIDWHQVARLVQRGCPPRLALRIVR |
| Ga0318534_105389303 | 3300031544 | Soil | NWRVSQLKRLGLPGLLAEIYADQIDWHQLARLVQRGCPPQLALRIIR |
| Ga0318534_106633062 | 3300031544 | Soil | LGIPRSLAEAYSDHLDWHQIAQLLQLGCPPRLALRIAR |
| Ga0310915_103105101 | 3300031573 | Soil | VHNWRVSQLTRLGVPWGLAEIYADRIDWHQVARLVQRGCPPRLALRIVR |
| Ga0310915_109585152 | 3300031573 | Soil | LVHNWRVSQLTRLGVPWGLAEIYADRIDWHQVARLVQRGCPPRLALRIVR |
| Ga0310915_111020541 | 3300031573 | Soil | IPGLLAEVYADHLDWHQVARLVQHGCPPGPALRILG |
| Ga0318555_103661303 | 3300031640 | Soil | VPRGLAEIYADRIDWHQVARLVQRGCPPRLALRIVR |
| Ga0318555_104793013 | 3300031640 | Soil | RLGLPGLLAEIYADQIDWHQLARLVQRGCPPQLALRIIR |
| Ga0318572_102270583 | 3300031681 | Soil | TERAVHAWRVSQLTRLGIPGALAEAYADRLDWHQIARLVQRGCPPLLALRIVR |
| Ga0318572_104450542 | 3300031681 | Soil | LTRLGVPGSLAEVYADRLDWHQVARLVQRGCPPRLALRIVL |
| Ga0310686_1033117963 | 3300031708 | Soil | EQSSVHNWSGSQLRCLGLSGPLAESYAHCIDWHPVARLVQCGCPLRLALRIVC |
| Ga0310686_1052221593 | 3300031708 | Soil | RLGIPALLAEIHADHLDWHQIARLVQRGCPPQLALRIVS |
| Ga0318496_102588903 | 3300031713 | Soil | RLGIPVPLAEVYADRIDWHQIARLVQRGCPPRLALRIAG |
| Ga0307474_104911361 | 3300031718 | Hardwood Forest Soil | QLKRLGMPGPLAEVYADRIDWHQIARLVQHGCPLRLALRIVS |
| Ga0307474_109385621 | 3300031718 | Hardwood Forest Soil | QLRRLGIPGSLAETYADRIDWHQVARLVHRGCPPRLALRIVH |
| Ga0318493_105750711 | 3300031723 | Soil | AQFGIPRSLAEVYADHIDWHQVARLVQRGCPPRLALRIVR |
| Ga0307468_1007077331 | 3300031740 | Hardwood Forest Soil | LERLGVPGPLAEIYADRLDWHQLARLVRCGCPPRLALRIVG |
| Ga0306918_111574092 | 3300031744 | Soil | RLGLPAPLAEAAADSVDWHQIARLVQRGCPPQLALRIIR |
| Ga0318492_102949661 | 3300031748 | Soil | NWRVTRLTRLGVPGSLAEVYADRVDWHQVARLMQGGCPPRLALRIAS |
| Ga0318492_103639673 | 3300031748 | Soil | NWRVSQLRRLGLPGLLAEIYADQIDWHQLARLVQRGCPPQLALRIIR |
| Ga0307477_111416271 | 3300031753 | Hardwood Forest Soil | LVHDWRVSQLTRLGIPVPLAEIYADCVDWQQVARLVRRGCPARLALRIVS |
| Ga0318535_104112803 | 3300031764 | Soil | SVHDWRVSQLTRLGIPGPPAEVYADRIDWHQIARLVQRGCPPWLALRIVR |
| Ga0318554_105255441 | 3300031765 | Soil | PEPLADALATRVDWHQVAALVKRGCPPLLALRIVL |
| Ga0318526_102991581 | 3300031769 | Soil | PGPLAEVDADHLDWHQVARLVQHGCPPQLALRIVR |
| Ga0318521_101057241 | 3300031770 | Soil | VHDWRVSQPTRLGIPVPLAEVYADRIDWHQIARLVQRGCLPRLALRIAG |
| Ga0318543_104756931 | 3300031777 | Soil | PVPLAEVYADRIDWHQIARLVQRGCLPRLALRIAG |
| Ga0318552_105561751 | 3300031782 | Soil | RVARLAQFGIPRSLAEVYADHIDWHQVARLVQRSCPPRLALRIVR |
| Ga0318529_104482493 | 3300031792 | Soil | LGLPGLLAEIYADQIDWHQLARLVQRGCPPLLALRIIG |
| Ga0318548_102290162 | 3300031793 | Soil | LTQLGVPGSLAEVYADRLDWHQVARLVQRGCPPRLALRIVL |
| Ga0318550_104054761 | 3300031797 | Soil | HNWRVSQLKRLGLPGLLAEIYADQIDWHQLARLVQRGCPPQLALRIIR |
| Ga0318523_103642103 | 3300031798 | Soil | RVSQLKRLGLSGLLAEIYADQIDWHQVARLVQRGCPPLLALRIIG |
| Ga0318565_102232491 | 3300031799 | Soil | NWRVSQLKRLGLSGLLAEIYADQIDWHQVARLVQRGCPPLLALRIIG |
| Ga0318565_104538321 | 3300031799 | Soil | PGLLAEIYADQIDWHQLARLVQRGCPPQLALRIIR |
| Ga0318568_100398023 | 3300031819 | Soil | VHAWRVAQLTRLGIPQSLAEAYADHLDWHQIARLVQRGCPPRLALRIVR |
| Ga0318568_108446391 | 3300031819 | Soil | IHNWRVSQLRRLGLPGLLAEIYADQIDWHQLARLVQRGCPPQLALRIIR |
| Ga0318567_103919803 | 3300031821 | Soil | RKERAVHAWRVSQLTRLGIPGSLAEAYADRLDWHQIARLVQRGCPPLLALRIVR |
| Ga0307478_101720004 | 3300031823 | Hardwood Forest Soil | SPVHNWRVSQLERLGIPEPLAEIFADHIDWHQIARLVQRGCPPSLALRILC |
| Ga0307478_113451601 | 3300031823 | Hardwood Forest Soil | WRVTQLRRLGIPGSLAETYADRIDWHQVARLVHRGCPPRLALRIVR |
| Ga0318564_103097002 | 3300031831 | Soil | IPGLLAEVYADHLDWHQVARLVQHGCPPRLALRIVG |
| Ga0318495_103133671 | 3300031860 | Soil | IPGPLAEVYADRIDWHQIARLVCHGCPPRLALRIVC |
| Ga0318495_105342681 | 3300031860 | Soil | LTRLGIPGALAEAYADRLDWHQIARLVQRGCPPLLALRIVR |
| Ga0306919_104292261 | 3300031879 | Soil | PGSLAEVYADRVDWHQVARLMQGGCPPRLALRIAS |
| Ga0306919_107047661 | 3300031879 | Soil | VPPALAEAYADRLDWHQVARLVQRGCPPELALRIVH |
| Ga0306919_108253301 | 3300031879 | Soil | SPVHSWRVSQLTRLGLPGPLAEIYADRIDWHQIARLVRNGCPPRLALRIVC |
| Ga0318522_101569641 | 3300031894 | Soil | HVHRWRVSQLTRLGIPGLLAEVYADHLDWHQVARLVQHGCPPGPALRILG |
| Ga0318551_105460251 | 3300031896 | Soil | RLGVPRGLAEIYADRIDWHQVARLVQRGCPPRLALRIVR |
| Ga0306921_106527844 | 3300031912 | Soil | RLGLSGLLAEIYADQIDWHQVARLVQRGCPPLLALRIIG |
| Ga0306921_119616122 | 3300031912 | Soil | VHDWRVSQLTRLGIPVPLAEVYADRIDWHQIARLVQRGCPPRLALRIAG |
| Ga0306921_122861271 | 3300031912 | Soil | RLGVPWGLAEIYADRIDWHQVARLVQRGCPPRLALRIVR |
| Ga0310916_108995642 | 3300031942 | Soil | DRLTRLGVPGSLAEVYADRLDWHQVARLVQRGCPPRLALRIVL |
| Ga0310913_101839923 | 3300031945 | Soil | GIPRSLAEAYSDHLDWHQIAQLLQLGCPPRLALRIAR |
| Ga0310909_111832902 | 3300031947 | Soil | DWRVARLAQFGIPRSLAEVYADHIDRHHVARLVQRSCPPRLALRIVR |
| Ga0306926_105888631 | 3300031954 | Soil | TRLGIPGSVAEAVADRVDWHQIAALIRRGCPPRLALRIVL |
| Ga0306926_107853862 | 3300031954 | Soil | LGVPPALAEAYADRLDWHQVARLVQRGCPPELALRIVH |
| Ga0318530_103007133 | 3300031959 | Soil | WRVSQLTRLGVPWGLAEIYADRIDWHQVARLVQRGCPPRLALRIVR |
| Ga0318562_102234751 | 3300032008 | Soil | VARLTRLGIPALLAEIHADHLDWHQIAQLVLRGCPPQLALRILS |
| Ga0318559_104502631 | 3300032039 | Soil | PGPLAEVDADHLDWDQAARLVQHGCPPQLALRIVR |
| Ga0318506_102713521 | 3300032052 | Soil | RVDRLTRLGVPGSLAEVYADRLDWHQVARLVQRGCPPRLALRIVL |
| Ga0318505_105525321 | 3300032060 | Soil | KRLGLPGLLAEIYADQIDWHQLARLVQRGCPPLLALRIIG |
| Ga0306924_108863121 | 3300032076 | Soil | GIPETLAGVVAAHVDWHQVAGLVQRGCPPRLALRIAL |
| Ga0318518_104096623 | 3300032090 | Soil | LTRLGVPWGLAEIYADRIDWHQVARLVQRGCPPRLALRIVR |
| Ga0311301_101993874 | 3300032160 | Peatlands Soil | RLTRLGVPGSLAEVYADRLDWHQVARLVQRGCPPRLALRIVL |
| Ga0311301_105516364 | 3300032160 | Peatlands Soil | VHNWRVSQLTRLGIPGLLAEVYADRLDWHQIAQLVQRGCPARLAIRIAC |
| Ga0311301_111042301 | 3300032160 | Peatlands Soil | VHNWRVTRLTGLGVPGSLAEVNADHLDWHQVARLVQLGCPPRLALRIVR |
| Ga0311301_113643951 | 3300032160 | Peatlands Soil | LGIPGALAEVNADHLDWHQVARLVQRGCPPRLALRIARR |
| Ga0311301_113718482 | 3300032160 | Peatlands Soil | VAQLTRLGIPGSLAEVYADRIDWHQIARLVQRGCPPRLALRIAS |
| Ga0311301_113732623 | 3300032160 | Peatlands Soil | TQLGISRTVAEVEADRLDWHQVARLVQRGCPPRLALRIAR |
| Ga0307470_102007131 | 3300032174 | Hardwood Forest Soil | LTRLGIPVLLAEIHADHLDWRQIARLVQRGCPPQLALRIVS |
| Ga0307471_1031838941 | 3300032180 | Hardwood Forest Soil | RLGIPGPPAEVYADRIDWHQIARLVQPGCPPPLALRIAG |
| Ga0307471_1036995372 | 3300032180 | Hardwood Forest Soil | LGISEMLAEVYADHLDWHRVARLVQHGCPPQLALLIVG |
| Ga0307471_1043284851 | 3300032180 | Hardwood Forest Soil | SRLERLGVPGTLAEIYADRIDWHQVARLVRRGCPPELALRIVS |
| Ga0306920_1003207721 | 3300032261 | Soil | WRVARLAQFGIPRSLAEVYADHIDRHQVARLVQRSCPPRLALRIVR |
| Ga0335085_114527871 | 3300032770 | Soil | GVPPVLAEAYADRLDWHQVARLVQRGCPPELALRIVH |
| Ga0335082_109465471 | 3300032782 | Soil | QFGIPRSLAEVYADHIDWHQVARLVQRGCPPRLALRVVR |
| Ga0335079_108976563 | 3300032783 | Soil | LGVPGSLAEVYADRLDWHQVARLVQRGCTPRLALRIVL |
| Ga0335078_101149684 | 3300032805 | Soil | VHNWRMTRLTRLGIPRALAEAYADRLDWHQVARLVQHGCPPRLALRIAR |
| Ga0335070_109912662 | 3300032829 | Soil | TRLGVPAPLAEIHADHLDWHQIARLVLRGCPPQLALRIVS |
| Ga0335081_103090074 | 3300032892 | Soil | NWRVSQLTRFGIPRVVAEVYADRIDWHEIARLVRRGCPPLLALRIVL |
| Ga0310914_106531231 | 3300033289 | Soil | EESSIHNWRVSQLKRLGLSGLLAEIYADQIDWHQVARLVQRGCPPLLALRIIG |
| Ga0310811_102654236 | 3300033475 | Soil | PGTLAEVYADRIDWHQIARLVRGGCPARLALRIVL |
| Ga0310811_109076181 | 3300033475 | Soil | AVARLTGLGIPGSLAEVNADHLDWHQVARLVQRGCPPRLALRIAR |
| Ga0370483_0210637_493_654 | 3300034124 | Untreated Peat Soil | VTALVHDWRVSRLTQLGVPGPLAEVYADRLDWHQIAHLVRRGCPVRLAIRIAR |
| Ga0372943_0971638_2_121 | 3300034268 | Soil | RLGVPRPLAEVYADHLDWHQVARLVQRGCSARLAIRIAL |
| Ga0373950_0080910_549_677 | 3300034818 | Rhizosphere Soil | RLTQLGIARAVAEVEADRLDWHQVARLVQHGCPPRLAMRIVL |
| Ga0373959_0202533_13_147 | 3300034820 | Rhizosphere Soil | VARLTQLGIPRAVAEVEADRLDWHQVARLVQHGCPPRLAMRIVL |
| ⦗Top⦘ |