Basic Information | |
---|---|
Family ID | F009504 |
Family Type | Metagenome |
Number of Sequences | 317 |
Average Sequence Length | 43 residues |
Representative Sequence | MVSNVLEVDEDDLLKRVKTFKKKYADDPEYKKLRAALPKDWPL |
Number of Associated Samples | 186 |
Number of Associated Scaffolds | 317 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 83.23 % |
% of genes near scaffold ends (potentially truncated) | 20.82 % |
% of genes from short scaffolds (< 2000 bps) | 76.34 % |
Associated GOLD sequencing projects | 154 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.47 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (98.107 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (26.498 % of family members) |
Environment Ontology (ENVO) | Unclassified (49.211 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (59.621 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.39% β-sheet: 0.00% Coil/Unstructured: 67.61% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 317 Family Scaffolds |
---|---|---|
PF14518 | Haem_oxygenas_2 | 25.87 |
PF00296 | Bac_luciferase | 9.46 |
PF03632 | Glyco_hydro_65m | 4.42 |
PF01042 | Ribonuc_L-PSP | 4.42 |
PF00583 | Acetyltransf_1 | 1.58 |
PF13468 | Glyoxalase_3 | 0.95 |
PF13673 | Acetyltransf_10 | 0.95 |
PF01546 | Peptidase_M20 | 0.95 |
PF00486 | Trans_reg_C | 0.63 |
PF11611 | DUF4352 | 0.63 |
PF04073 | tRNA_edit | 0.32 |
PF07690 | MFS_1 | 0.32 |
PF14690 | zf-ISL3 | 0.32 |
PF01053 | Cys_Met_Meta_PP | 0.32 |
PF07676 | PD40 | 0.32 |
PF12867 | DinB_2 | 0.32 |
PF13485 | Peptidase_MA_2 | 0.32 |
COG ID | Name | Functional Category | % Frequency in 317 Family Scaffolds |
---|---|---|---|
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 9.46 |
COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 4.42 |
COG1554 | Phosphatase/phosphodiesterase/kojibiose phosphorylase YcjT/PafA/Npp1, AlkP superfamily | Carbohydrate transport and metabolism [G] | 4.42 |
COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.32 |
COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.32 |
COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.32 |
COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.32 |
COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.32 |
COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.32 |
COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.32 |
COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.32 |
COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.32 |
COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.32 |
COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 0.32 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 98.11 % |
Unclassified | root | N/A | 1.89 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000887|AL16A1W_10106049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 551 | Open in IMG/M |
3300001359|A3035W6_1014505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 929 | Open in IMG/M |
3300001661|JGI12053J15887_10349939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 715 | Open in IMG/M |
3300002557|JGI25381J37097_1081979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 533 | Open in IMG/M |
3300002558|JGI25385J37094_10032741 | All Organisms → cellular organisms → Bacteria | 1828 | Open in IMG/M |
3300002558|JGI25385J37094_10075721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1059 | Open in IMG/M |
3300002558|JGI25385J37094_10173274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 578 | Open in IMG/M |
3300002561|JGI25384J37096_10215586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 562 | Open in IMG/M |
3300002562|JGI25382J37095_10021097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2526 | Open in IMG/M |
3300002562|JGI25382J37095_10098513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1039 | Open in IMG/M |
3300002908|JGI25382J43887_10128548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1310 | Open in IMG/M |
3300002908|JGI25382J43887_10282983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 740 | Open in IMG/M |
3300002908|JGI25382J43887_10289354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 726 | Open in IMG/M |
3300002911|JGI25390J43892_10074173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 779 | Open in IMG/M |
3300003319|soilL2_10207244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1850 | Open in IMG/M |
3300003321|soilH1_10351718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1084 | Open in IMG/M |
3300004156|Ga0062589_100486062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1035 | Open in IMG/M |
3300005166|Ga0066674_10382010 | Not Available | 657 | Open in IMG/M |
3300005167|Ga0066672_10005756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 5517 | Open in IMG/M |
3300005167|Ga0066672_10080864 | All Organisms → cellular organisms → Bacteria | 1944 | Open in IMG/M |
3300005167|Ga0066672_10293734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1054 | Open in IMG/M |
3300005171|Ga0066677_10017399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 3259 | Open in IMG/M |
3300005171|Ga0066677_10083304 | All Organisms → cellular organisms → Bacteria | 1665 | Open in IMG/M |
3300005171|Ga0066677_10131766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1354 | Open in IMG/M |
3300005171|Ga0066677_10132352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Gordoniaceae → Gordonia → Gordonia paraffinivorans | 1351 | Open in IMG/M |
3300005171|Ga0066677_10237752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1031 | Open in IMG/M |
3300005171|Ga0066677_10349216 | Not Available | 847 | Open in IMG/M |
3300005171|Ga0066677_10528135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 677 | Open in IMG/M |
3300005172|Ga0066683_10101183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1748 | Open in IMG/M |
3300005172|Ga0066683_10176719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1315 | Open in IMG/M |
3300005172|Ga0066683_10184178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1287 | Open in IMG/M |
3300005174|Ga0066680_10206499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1242 | Open in IMG/M |
3300005174|Ga0066680_10338899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 959 | Open in IMG/M |
3300005175|Ga0066673_10024201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2844 | Open in IMG/M |
3300005176|Ga0066679_10234016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1180 | Open in IMG/M |
3300005177|Ga0066690_10065301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2262 | Open in IMG/M |
3300005177|Ga0066690_10293570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1097 | Open in IMG/M |
3300005178|Ga0066688_10005606 | All Organisms → cellular organisms → Bacteria | 5748 | Open in IMG/M |
3300005178|Ga0066688_10113654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1666 | Open in IMG/M |
3300005178|Ga0066688_10270752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1090 | Open in IMG/M |
3300005179|Ga0066684_10675704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 693 | Open in IMG/M |
3300005180|Ga0066685_10492102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 850 | Open in IMG/M |
3300005180|Ga0066685_10967315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 564 | Open in IMG/M |
3300005180|Ga0066685_11090855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 522 | Open in IMG/M |
3300005406|Ga0070703_10028205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1677 | Open in IMG/M |
3300005406|Ga0070703_10283053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 685 | Open in IMG/M |
3300005444|Ga0070694_100548953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 925 | Open in IMG/M |
3300005444|Ga0070694_100935988 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 717 | Open in IMG/M |
3300005445|Ga0070708_100061593 | All Organisms → cellular organisms → Bacteria | 3352 | Open in IMG/M |
3300005445|Ga0070708_100077144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 3010 | Open in IMG/M |
3300005445|Ga0070708_100089673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2798 | Open in IMG/M |
3300005445|Ga0070708_100767425 | Not Available | 907 | Open in IMG/M |
3300005445|Ga0070708_101209823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 707 | Open in IMG/M |
3300005446|Ga0066686_10003923 | All Organisms → cellular organisms → Bacteria | 6849 | Open in IMG/M |
3300005446|Ga0066686_10016076 | All Organisms → cellular organisms → Bacteria | 4064 | Open in IMG/M |
3300005446|Ga0066686_10052862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2486 | Open in IMG/M |
3300005446|Ga0066686_10118672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1722 | Open in IMG/M |
3300005447|Ga0066689_10042153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2404 | Open in IMG/M |
3300005450|Ga0066682_10039722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2811 | Open in IMG/M |
3300005450|Ga0066682_10136491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1557 | Open in IMG/M |
3300005467|Ga0070706_101030052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 759 | Open in IMG/M |
3300005467|Ga0070706_101075788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 741 | Open in IMG/M |
3300005467|Ga0070706_101467241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 624 | Open in IMG/M |
3300005468|Ga0070707_100073641 | All Organisms → cellular organisms → Bacteria | 3293 | Open in IMG/M |
3300005518|Ga0070699_101723995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 574 | Open in IMG/M |
3300005536|Ga0070697_100052040 | All Organisms → cellular organisms → Bacteria | 3328 | Open in IMG/M |
3300005536|Ga0070697_101092826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 710 | Open in IMG/M |
3300005540|Ga0066697_10282538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 979 | Open in IMG/M |
3300005545|Ga0070695_100091778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2029 | Open in IMG/M |
3300005552|Ga0066701_10136182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1468 | Open in IMG/M |
3300005552|Ga0066701_10507634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 746 | Open in IMG/M |
3300005555|Ga0066692_10965617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 521 | Open in IMG/M |
3300005557|Ga0066704_10108129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1833 | Open in IMG/M |
3300005558|Ga0066698_10443740 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 886 | Open in IMG/M |
3300005558|Ga0066698_10810481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 606 | Open in IMG/M |
3300005559|Ga0066700_10007363 | All Organisms → cellular organisms → Bacteria | 5477 | Open in IMG/M |
3300005561|Ga0066699_10583601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 803 | Open in IMG/M |
3300005561|Ga0066699_10647665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 757 | Open in IMG/M |
3300005566|Ga0066693_10262551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 685 | Open in IMG/M |
3300005566|Ga0066693_10377045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 574 | Open in IMG/M |
3300005569|Ga0066705_10098443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1735 | Open in IMG/M |
3300005569|Ga0066705_10260134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1100 | Open in IMG/M |
3300005569|Ga0066705_10294631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1028 | Open in IMG/M |
3300005569|Ga0066705_10971548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 503 | Open in IMG/M |
3300005575|Ga0066702_10762723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 576 | Open in IMG/M |
3300005575|Ga0066702_10979913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 506 | Open in IMG/M |
3300005576|Ga0066708_10050937 | All Organisms → cellular organisms → Bacteria | 2317 | Open in IMG/M |
3300005576|Ga0066708_10923521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 544 | Open in IMG/M |
3300005586|Ga0066691_10182674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1217 | Open in IMG/M |
3300005586|Ga0066691_10455014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 765 | Open in IMG/M |
3300006032|Ga0066696_10020750 | All Organisms → cellular organisms → Bacteria | 3362 | Open in IMG/M |
3300006034|Ga0066656_10020764 | All Organisms → cellular organisms → Bacteria | 3510 | Open in IMG/M |
3300006034|Ga0066656_10363797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 935 | Open in IMG/M |
3300006034|Ga0066656_10826873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 593 | Open in IMG/M |
3300006046|Ga0066652_100076053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2635 | Open in IMG/M |
3300006049|Ga0075417_10074211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1510 | Open in IMG/M |
3300006173|Ga0070716_100258166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1191 | Open in IMG/M |
3300006791|Ga0066653_10022096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2401 | Open in IMG/M |
3300006797|Ga0066659_10100810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1964 | Open in IMG/M |
3300006800|Ga0066660_10002399 | All Organisms → cellular organisms → Bacteria | 8566 | Open in IMG/M |
3300006852|Ga0075433_10015432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 6265 | Open in IMG/M |
3300006852|Ga0075433_11893980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 512 | Open in IMG/M |
3300007076|Ga0075435_100902022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 771 | Open in IMG/M |
3300007076|Ga0075435_101011176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 726 | Open in IMG/M |
3300007258|Ga0099793_10507409 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 600 | Open in IMG/M |
3300009012|Ga0066710_100041259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 5571 | Open in IMG/M |
3300009012|Ga0066710_100892282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1368 | Open in IMG/M |
3300009012|Ga0066710_103123830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 639 | Open in IMG/M |
3300009012|Ga0066710_103582704 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300009038|Ga0099829_10091717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2348 | Open in IMG/M |
3300009038|Ga0099829_10163870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1782 | Open in IMG/M |
3300009038|Ga0099829_10267162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1398 | Open in IMG/M |
3300009088|Ga0099830_11142708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 646 | Open in IMG/M |
3300009089|Ga0099828_10441962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1173 | Open in IMG/M |
3300009089|Ga0099828_10484301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1116 | Open in IMG/M |
3300009089|Ga0099828_10967398 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 759 | Open in IMG/M |
3300009089|Ga0099828_11831027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 533 | Open in IMG/M |
3300009090|Ga0099827_10177934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1757 | Open in IMG/M |
3300009090|Ga0099827_10443512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1112 | Open in IMG/M |
3300009090|Ga0099827_10629419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 926 | Open in IMG/M |
3300009090|Ga0099827_11238236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 649 | Open in IMG/M |
3300009090|Ga0099827_11440809 | Not Available | 599 | Open in IMG/M |
3300009090|Ga0099827_11918749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 516 | Open in IMG/M |
3300009137|Ga0066709_102297751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 739 | Open in IMG/M |
3300009137|Ga0066709_103166503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 601 | Open in IMG/M |
3300009137|Ga0066709_103257347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 591 | Open in IMG/M |
3300009143|Ga0099792_10590488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 707 | Open in IMG/M |
3300009147|Ga0114129_11395666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 864 | Open in IMG/M |
3300010301|Ga0134070_10437431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 521 | Open in IMG/M |
3300010304|Ga0134088_10128734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1200 | Open in IMG/M |
3300010304|Ga0134088_10490391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 605 | Open in IMG/M |
3300010304|Ga0134088_10702099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 508 | Open in IMG/M |
3300010321|Ga0134067_10090896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1034 | Open in IMG/M |
3300010321|Ga0134067_10387021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 558 | Open in IMG/M |
3300010322|Ga0134084_10224517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 667 | Open in IMG/M |
3300010323|Ga0134086_10390560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 557 | Open in IMG/M |
3300010326|Ga0134065_10302191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 613 | Open in IMG/M |
3300010329|Ga0134111_10022578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2134 | Open in IMG/M |
3300010333|Ga0134080_10103274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1174 | Open in IMG/M |
3300010335|Ga0134063_10300344 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
3300010336|Ga0134071_10151809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1127 | Open in IMG/M |
3300010336|Ga0134071_10197542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 991 | Open in IMG/M |
3300012003|Ga0120163_1085274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 706 | Open in IMG/M |
3300012010|Ga0120118_1000138 | All Organisms → cellular organisms → Bacteria | 29042 | Open in IMG/M |
3300012189|Ga0137388_11194565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 698 | Open in IMG/M |
3300012198|Ga0137364_10102601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2016 | Open in IMG/M |
3300012198|Ga0137364_10128347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1814 | Open in IMG/M |
3300012198|Ga0137364_10622045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 814 | Open in IMG/M |
3300012198|Ga0137364_10952521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 650 | Open in IMG/M |
3300012198|Ga0137364_11256780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 553 | Open in IMG/M |
3300012199|Ga0137383_11042419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 594 | Open in IMG/M |
3300012199|Ga0137383_11289980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 521 | Open in IMG/M |
3300012200|Ga0137382_10092268 | All Organisms → cellular organisms → Bacteria | 1984 | Open in IMG/M |
3300012200|Ga0137382_10159898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1532 | Open in IMG/M |
3300012200|Ga0137382_10348563 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
3300012202|Ga0137363_10310293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1297 | Open in IMG/M |
3300012203|Ga0137399_10015229 | All Organisms → cellular organisms → Bacteria | 4834 | Open in IMG/M |
3300012203|Ga0137399_10024562 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 4026 | Open in IMG/M |
3300012203|Ga0137399_10418607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1119 | Open in IMG/M |
3300012203|Ga0137399_10623794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 907 | Open in IMG/M |
3300012203|Ga0137399_10784832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 802 | Open in IMG/M |
3300012203|Ga0137399_11261799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 622 | Open in IMG/M |
3300012206|Ga0137380_10003033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 14485 | Open in IMG/M |
3300012206|Ga0137380_10559126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1003 | Open in IMG/M |
3300012207|Ga0137381_10477153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1088 | Open in IMG/M |
3300012208|Ga0137376_10021660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 4945 | Open in IMG/M |
3300012208|Ga0137376_10282687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1440 | Open in IMG/M |
3300012208|Ga0137376_10496175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1059 | Open in IMG/M |
3300012208|Ga0137376_11417336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 586 | Open in IMG/M |
3300012208|Ga0137376_11683704 | Not Available | 525 | Open in IMG/M |
3300012209|Ga0137379_10119114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2539 | Open in IMG/M |
3300012211|Ga0137377_10087569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2939 | Open in IMG/M |
3300012211|Ga0137377_11493539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 602 | Open in IMG/M |
3300012285|Ga0137370_10144896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1370 | Open in IMG/M |
3300012351|Ga0137386_10172622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1550 | Open in IMG/M |
3300012356|Ga0137371_11180751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 572 | Open in IMG/M |
3300012361|Ga0137360_11277269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 634 | Open in IMG/M |
3300012363|Ga0137390_10195967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2007 | Open in IMG/M |
3300012582|Ga0137358_10687151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 684 | Open in IMG/M |
3300012685|Ga0137397_10614630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 808 | Open in IMG/M |
3300012918|Ga0137396_10161661 | All Organisms → cellular organisms → Bacteria | 1635 | Open in IMG/M |
3300012918|Ga0137396_10235412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1349 | Open in IMG/M |
3300012918|Ga0137396_10298996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1190 | Open in IMG/M |
3300012918|Ga0137396_10872073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 661 | Open in IMG/M |
3300012922|Ga0137394_11365593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 570 | Open in IMG/M |
3300012923|Ga0137359_10425811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1175 | Open in IMG/M |
3300012925|Ga0137419_10081276 | All Organisms → cellular organisms → Bacteria | 2192 | Open in IMG/M |
3300012927|Ga0137416_10447499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1104 | Open in IMG/M |
3300012927|Ga0137416_11365434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 641 | Open in IMG/M |
3300012929|Ga0137404_11576069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 609 | Open in IMG/M |
3300012930|Ga0137407_11906643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 567 | Open in IMG/M |
3300012975|Ga0134110_10309516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 684 | Open in IMG/M |
3300013294|Ga0120150_1004095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 3437 | Open in IMG/M |
3300014157|Ga0134078_10496712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 566 | Open in IMG/M |
3300015193|Ga0167668_1079183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 640 | Open in IMG/M |
3300015356|Ga0134073_10239013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 622 | Open in IMG/M |
3300015358|Ga0134089_10227381 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 757 | Open in IMG/M |
3300015358|Ga0134089_10523296 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 522 | Open in IMG/M |
3300015359|Ga0134085_10395469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 620 | Open in IMG/M |
3300015371|Ga0132258_11289111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1846 | Open in IMG/M |
3300017656|Ga0134112_10290236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 656 | Open in IMG/M |
3300017659|Ga0134083_10288912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 693 | Open in IMG/M |
3300018027|Ga0184605_10040848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1948 | Open in IMG/M |
3300018027|Ga0184605_10042139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1921 | Open in IMG/M |
3300018027|Ga0184605_10172792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 977 | Open in IMG/M |
3300018027|Ga0184605_10278679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 759 | Open in IMG/M |
3300018027|Ga0184605_10470475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 551 | Open in IMG/M |
3300018028|Ga0184608_10000039 | All Organisms → cellular organisms → Bacteria | 27363 | Open in IMG/M |
3300018054|Ga0184621_10186083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 746 | Open in IMG/M |
3300018061|Ga0184619_10035506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2120 | Open in IMG/M |
3300018076|Ga0184609_10502108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 552 | Open in IMG/M |
3300018431|Ga0066655_10054013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2085 | Open in IMG/M |
3300018431|Ga0066655_10427296 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 874 | Open in IMG/M |
3300018431|Ga0066655_10716833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 678 | Open in IMG/M |
3300018431|Ga0066655_11275419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 525 | Open in IMG/M |
3300018431|Ga0066655_11354031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 514 | Open in IMG/M |
3300018433|Ga0066667_10004803 | All Organisms → cellular organisms → Bacteria | 5782 | Open in IMG/M |
3300018433|Ga0066667_10060145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2345 | Open in IMG/M |
3300018433|Ga0066667_10537925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 968 | Open in IMG/M |
3300018433|Ga0066667_10954613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 739 | Open in IMG/M |
3300018433|Ga0066667_11384238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 617 | Open in IMG/M |
3300018433|Ga0066667_11591844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 581 | Open in IMG/M |
3300018468|Ga0066662_10018897 | All Organisms → cellular organisms → Bacteria | 3814 | Open in IMG/M |
3300018468|Ga0066662_10019320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 3781 | Open in IMG/M |
3300018468|Ga0066662_10076400 | All Organisms → cellular organisms → Bacteria | 2269 | Open in IMG/M |
3300018468|Ga0066662_10543924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1071 | Open in IMG/M |
3300018468|Ga0066662_11723480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 655 | Open in IMG/M |
3300018482|Ga0066669_10209243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1502 | Open in IMG/M |
3300018482|Ga0066669_10717127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 881 | Open in IMG/M |
3300018482|Ga0066669_11167227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 695 | Open in IMG/M |
3300018482|Ga0066669_11882955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 556 | Open in IMG/M |
3300019879|Ga0193723_1005508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 4286 | Open in IMG/M |
3300019885|Ga0193747_1001017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 8022 | Open in IMG/M |
3300019885|Ga0193747_1018166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1723 | Open in IMG/M |
3300020001|Ga0193731_1026640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1519 | Open in IMG/M |
3300020004|Ga0193755_1134847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 761 | Open in IMG/M |
3300020006|Ga0193735_1042514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1367 | Open in IMG/M |
3300020022|Ga0193733_1188805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 536 | Open in IMG/M |
3300021080|Ga0210382_10015387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2683 | Open in IMG/M |
3300021080|Ga0210382_10104121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1184 | Open in IMG/M |
3300021418|Ga0193695_1080826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 704 | Open in IMG/M |
3300022534|Ga0224452_1192964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 626 | Open in IMG/M |
3300022756|Ga0222622_10326820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1063 | Open in IMG/M |
3300025885|Ga0207653_10191286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 768 | Open in IMG/M |
3300025910|Ga0207684_10010485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 8155 | Open in IMG/M |
3300025910|Ga0207684_10011992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 7548 | Open in IMG/M |
3300025910|Ga0207684_10097731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2507 | Open in IMG/M |
3300025910|Ga0207684_10132121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2142 | Open in IMG/M |
3300025922|Ga0207646_10000633 | All Organisms → cellular organisms → Bacteria | 45775 | Open in IMG/M |
3300025922|Ga0207646_10005443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 13390 | Open in IMG/M |
3300025981|Ga0207640_10012970 | All Organisms → cellular organisms → Bacteria | 4762 | Open in IMG/M |
3300026295|Ga0209234_1091076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1154 | Open in IMG/M |
3300026295|Ga0209234_1224758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 621 | Open in IMG/M |
3300026297|Ga0209237_1067008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1708 | Open in IMG/M |
3300026297|Ga0209237_1068342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1684 | Open in IMG/M |
3300026297|Ga0209237_1237108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 562 | Open in IMG/M |
3300026297|Ga0209237_1238686 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 559 | Open in IMG/M |
3300026298|Ga0209236_1006869 | All Organisms → cellular organisms → Bacteria | 6871 | Open in IMG/M |
3300026300|Ga0209027_1019305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2582 | Open in IMG/M |
3300026301|Ga0209238_1068107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1254 | Open in IMG/M |
3300026301|Ga0209238_1087243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1076 | Open in IMG/M |
3300026307|Ga0209469_1139628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 543 | Open in IMG/M |
3300026309|Ga0209055_1002998 | All Organisms → cellular organisms → Bacteria | 10446 | Open in IMG/M |
3300026309|Ga0209055_1048310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1849 | Open in IMG/M |
3300026310|Ga0209239_1062270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1650 | Open in IMG/M |
3300026312|Ga0209153_1262693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 553 | Open in IMG/M |
3300026313|Ga0209761_1112951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1334 | Open in IMG/M |
3300026315|Ga0209686_1000581 | All Organisms → cellular organisms → Bacteria | 18627 | Open in IMG/M |
3300026315|Ga0209686_1006422 | All Organisms → cellular organisms → Bacteria | 5100 | Open in IMG/M |
3300026316|Ga0209155_1001746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 10144 | Open in IMG/M |
3300026317|Ga0209154_1003613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 8363 | Open in IMG/M |
3300026318|Ga0209471_1000709 | All Organisms → cellular organisms → Bacteria | 21284 | Open in IMG/M |
3300026318|Ga0209471_1208426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 735 | Open in IMG/M |
3300026323|Ga0209472_1219767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 622 | Open in IMG/M |
3300026331|Ga0209267_1259901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 596 | Open in IMG/M |
3300026332|Ga0209803_1032680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2443 | Open in IMG/M |
3300026333|Ga0209158_1096889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1129 | Open in IMG/M |
3300026334|Ga0209377_1075062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1446 | Open in IMG/M |
3300026335|Ga0209804_1004845 | All Organisms → cellular organisms → Bacteria | 7670 | Open in IMG/M |
3300026335|Ga0209804_1064979 | All Organisms → cellular organisms → Bacteria | 1744 | Open in IMG/M |
3300026524|Ga0209690_1011012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 4831 | Open in IMG/M |
3300026530|Ga0209807_1000241 | All Organisms → cellular organisms → Bacteria | 24346 | Open in IMG/M |
3300026536|Ga0209058_1137414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1177 | Open in IMG/M |
3300026536|Ga0209058_1245223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 636 | Open in IMG/M |
3300026537|Ga0209157_1017510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 4536 | Open in IMG/M |
3300026537|Ga0209157_1377916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 511 | Open in IMG/M |
3300026538|Ga0209056_10116876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2129 | Open in IMG/M |
3300026540|Ga0209376_1038254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2898 | Open in IMG/M |
3300026542|Ga0209805_1004011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 8271 | Open in IMG/M |
3300026550|Ga0209474_10224890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1178 | Open in IMG/M |
3300026550|Ga0209474_10272352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1025 | Open in IMG/M |
3300026550|Ga0209474_10279389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1005 | Open in IMG/M |
3300027681|Ga0208991_1045755 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1322 | Open in IMG/M |
3300027738|Ga0208989_10220781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 623 | Open in IMG/M |
3300027748|Ga0209689_1092566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1577 | Open in IMG/M |
3300027748|Ga0209689_1265018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 689 | Open in IMG/M |
3300027846|Ga0209180_10569670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 628 | Open in IMG/M |
3300027846|Ga0209180_10792340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 508 | Open in IMG/M |
3300027873|Ga0209814_10090434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1294 | Open in IMG/M |
3300027875|Ga0209283_10537056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 748 | Open in IMG/M |
3300027882|Ga0209590_10305788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1021 | Open in IMG/M |
3300027903|Ga0209488_10122911 | All Organisms → cellular organisms → Bacteria | 1954 | Open in IMG/M |
3300028536|Ga0137415_10065974 | All Organisms → cellular organisms → Bacteria | 3483 | Open in IMG/M |
3300028711|Ga0307293_10245161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 569 | Open in IMG/M |
3300028715|Ga0307313_10285921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 513 | Open in IMG/M |
3300028716|Ga0307311_10059560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1025 | Open in IMG/M |
3300028717|Ga0307298_10208062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 577 | Open in IMG/M |
3300028792|Ga0307504_10214372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 689 | Open in IMG/M |
3300028796|Ga0307287_10035069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1804 | Open in IMG/M |
3300028814|Ga0307302_10440435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 645 | Open in IMG/M |
3300028819|Ga0307296_10802887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 513 | Open in IMG/M |
3300028878|Ga0307278_10453555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 562 | Open in IMG/M |
3300028884|Ga0307308_10576100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 540 | Open in IMG/M |
3300031720|Ga0307469_11187278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 721 | Open in IMG/M |
3300031820|Ga0307473_10871540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 648 | Open in IMG/M |
3300032180|Ga0307471_100444625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1434 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 26.50% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 21.77% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 15.77% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.89% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 6.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.68% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 3.47% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.84% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.21% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.89% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.95% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.95% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.63% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.63% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.63% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.32% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.32% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.32% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.32% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000887 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-65cm-16A)- 1 week illumina | Environmental | Open in IMG/M |
3300001359 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A30-35cm)- 6 month illumina | Environmental | Open in IMG/M |
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300002557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm | Environmental | Open in IMG/M |
3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300011999 | Permafrost microbial communities from Nunavut, Canada - A28_65cm_6M | Environmental | Open in IMG/M |
3300012003 | Permafrost microbial communities from Nunavut, Canada - A20_80cm_0.25M | Environmental | Open in IMG/M |
3300012010 | Permafrost microbial communities from Nunavut, Canada - A7_35cm_12M | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300013294 | Permafrost microbial communities from Nunavut, Canada - A3_65cm_0M | Environmental | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
3300021418 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2 | Environmental | Open in IMG/M |
3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
AL16A1W_101060491 | 3300000887 | Permafrost | MVSNVLEVDEGELLKRVRTFKKKYADDPEYKKLRAALPKDWP |
A3035W6_10145052 | 3300001359 | Permafrost | MVSNVLEIDEADLLKQVRTFKKKYADDPEYKKLRGALPKDWPL* |
JGI12053J15887_103499392 | 3300001661 | Forest Soil | MVSNVLEVDQDDLLKQIKAFKNKYADDAEYRKLRAALPKDWPV* |
JGI25381J37097_10819792 | 3300002557 | Grasslands Soil | MVSNVLEVDEDDLLKRVKTFKKKYADDPEYKKLRAALPGDWPL* |
JGI25385J37094_100327414 | 3300002558 | Grasslands Soil | MVSNVLEIDQAELVRRLKTFKKKYAADAEYKRLRAELPRDWRF* |
JGI25385J37094_100757212 | 3300002558 | Grasslands Soil | MVSNVLESDQAELVRKLKTFKKKYAADAEYKRLRAELPRDWPF* |
JGI25385J37094_101732742 | 3300002558 | Grasslands Soil | MVSNVLEMEQAELARKLRTFKKKYAADPEYRELRAGLPKDWPL* |
JGI25384J37096_102155862 | 3300002561 | Grasslands Soil | MVSNVLEIDQAELVRKLKTFKKKYAADAEYKRLRAELPRDWRF* |
JGI25382J37095_100210972 | 3300002562 | Grasslands Soil | MVSNVLEVDQNELIKQLKTFKKKYADNAEYKKQRASLPKDWPF* |
JGI25382J37095_100985131 | 3300002562 | Grasslands Soil | MVSNVLEVDEDDLLKQVKTFKKKYADDPEYKKLRAALPKDWPL* |
JGI25382J43887_101285483 | 3300002908 | Grasslands Soil | MVSNVLEVDQDDLIKQLKTFKKKYAGDREYKPLRASLPKEWPF* |
JGI25382J43887_102829832 | 3300002908 | Grasslands Soil | MVSNVLEVDQDELVKQLKSFKKKYADDVEYKKVRASLPKDWPF* |
JGI25382J43887_102893541 | 3300002908 | Grasslands Soil | MVSNVLEIDQAELVRXLKTFKKXYAADAEYKRLRAELPRDWRF* |
JGI25390J43892_100741732 | 3300002911 | Grasslands Soil | MVSNVLEVDQDDLVKQLKTFKKKYAEDAEYKKLRATLPKDWPF* |
soilL2_102072444 | 3300003319 | Sugarcane Root And Bulk Soil | MVSNVLEMDQQELIDLLKTFKKKYADDPEYAKVRAALPKTWPL* |
soilH1_103517181 | 3300003321 | Sugarcane Root And Bulk Soil | ETTGMVSNVLEIDQQELIDLLKSFKRKYADDPEYAKLRAELPKTWPI* |
Ga0062589_1004860622 | 3300004156 | Soil | MVSNVLDVDEDDLLKRVRTFKKKYADDPDYTKLRAALPKDWPL* |
Ga0066674_103820101 | 3300005166 | Soil | MVSNVLEVDQDDLVKQLKSFKKKYADDVEYKKLRASLPKDWPF* |
Ga0066672_100057567 | 3300005167 | Soil | MVSNVLEVDEDDLLKRVKTFKKKYANDPEYKKLRAALPKDWPL* |
Ga0066672_100808642 | 3300005167 | Soil | MVSNVLEVDQDDLLKQVKTFKKKYADDPDYKKLRAILPKDWPL* |
Ga0066672_102937342 | 3300005167 | Soil | MVSNVLEIEQAALVKQLKTFKKKYVADPEFKKLRADLPKDWPF* |
Ga0066677_100173992 | 3300005171 | Soil | MVSNVLEVDQDDVLKQVRTFKKKYADDPEYKKLRAALPKDWPL* |
Ga0066677_100833042 | 3300005171 | Soil | MVSNVLEIDQAELIRKLKTFKRKYADDPEYRKARALLPKDWPL* |
Ga0066677_101317661 | 3300005171 | Soil | EETTGMVSNVLEVDQDDLLKQVKTFKKKYADDPDYKKLRAILPKDWPL* |
Ga0066677_101323521 | 3300005171 | Soil | MVSNVLEVDPGDLLKQVKAFKKKYAEDSDYKKLRAALPKDWPL* |
Ga0066677_102377522 | 3300005171 | Soil | MVSNVLEIDQAELVRKLKTFKKKYAADAQYKRLRAELPRDWPF* |
Ga0066677_103492161 | 3300005171 | Soil | EETTGMVSNVLEVDQDDLLKQVKTFKKKYADDPDYKKLRAVLPKDWPL* |
Ga0066677_105281351 | 3300005171 | Soil | GFEETTGMVSNVLEVDQDDLVKQLKTFKKKYAEDAEYKKLRATLPKDWPC* |
Ga0066683_101011832 | 3300005172 | Soil | MVSNVLEVDQDDLLKQVKTFKKKYADDPDYKKLRAVLPKDWPL* |
Ga0066683_101767192 | 3300005172 | Soil | MVSNVLEVDQDDLVKQLKSFKKKYADDPEYKKLRASLPKDWPF* |
Ga0066683_101841782 | 3300005172 | Soil | MVSNVLEVDEDDLLKRVKTFKKKYADDPEYKKLRAALPRDWPL* |
Ga0066680_102064992 | 3300005174 | Soil | MVSNVLEVDQDDLLKQVKTLKKKYAEDSEYKKLRAALPKDWPL* |
Ga0066680_103388994 | 3300005174 | Soil | MVSNVIEVDQDDLVRQLKTFKKKYAGDEEYRKLRASLPKDWPF* |
Ga0066673_100242012 | 3300005175 | Soil | MVSNVLEIDRGDLVRRLKSFKKKYADDAEFRKLRAGLPKDWPF* |
Ga0066679_102340164 | 3300005176 | Soil | MVSNVLEVDQDDLLKQIKGFKKKYADDSEYKKLRALLPKDWPL* |
Ga0066690_100653014 | 3300005177 | Soil | MVSNVLEVDEDDLLKRVKTFKKKYADDPEYRKLRAALPKDWPL* |
Ga0066690_102935702 | 3300005177 | Soil | MVSNVLEMDQRELVKLLRTFKKKYADDAQYRKLRAELPKDWPF* |
Ga0066688_100056069 | 3300005178 | Soil | MGSNVLEIDQAELVRKLKTFKKKYAADAQYKRLRAELPRDWPF* |
Ga0066688_101136544 | 3300005178 | Soil | MVSNVLEVDEDDLLKRVKTFKKKYADDPEYKKLRAALPKDWPL* |
Ga0066688_102707522 | 3300005178 | Soil | MVSNVLEIERAALVKQLKTFKKKYAADPEFKKLRADLPKDWPF* |
Ga0066684_106757042 | 3300005179 | Soil | MVSNVLEVDEDELLKAVRSFKKKYADDPEYKKLRAALPKDWPI* |
Ga0066685_104921022 | 3300005180 | Soil | MVSNVLEVDEDELLKRVKTFKKKYAADPEYKKLRAALPRDWPL* |
Ga0066685_109673152 | 3300005180 | Soil | MVSNVLEVDEDDLLKRVKTFKKKYADDLEYKKLRAALPRDWPL* |
Ga0066685_110908552 | 3300005180 | Soil | EETTGMVSNVLEVDQDDLLKQVKTFKKKYAEDPEYNKLRAALPKEWPL* |
Ga0070703_100282052 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSNVLEVDEDKLLKRVRTFKKKYADDADYKKLRSALPKDWPV* |
Ga0070703_102830532 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSNVLEVDEDELLKRVKTFKKKYADDPEYKTLRAMLPKEWPL* |
Ga0070694_1005489533 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSNVLEVDQDDLLKRIKTFKKKYADDPEYKKLRAALPKDWPL* |
Ga0070694_1009359882 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSNVLEVDEDELLKRVKTFKKKYADDPEYKTLRAMLPKEW |
Ga0070708_1000615932 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSNVLEVDAGDLLKRLRAFKKQYADDPEYKTLRAALPKEWPL* |
Ga0070708_1000771444 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSNVIEVDQDDLVKQLKTFKKKYAGDEEYRKLRASLPKDWPF* |
Ga0070708_1000896735 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSNVLEVDEEELLKRVRTFKKKYTEDAEYKKLRAALPRDWPL* |
Ga0070708_1007674252 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSNVLEMEQAELARKLRTFKKKYAADAEYNTLRAGLPRDWPL* |
Ga0070708_1012098231 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSNVLEVDQRELVKLLRTFKKRYASDAEYKRLRAELPRDWPF* |
Ga0066686_100039238 | 3300005446 | Soil | MVSNVLEIEQAALVKQLKTFKKKYAADPEFKKLRADLPKDWPF* |
Ga0066686_100160767 | 3300005446 | Soil | MVSNVLEVDPDDLLKQVKTFKKKYAEDSDYKKLRAALPKDWPL* |
Ga0066686_100528622 | 3300005446 | Soil | MVSNVLEVDEDELLKRVKTFKKKYAADPEYKKLRAALPGDWPL* |
Ga0066686_101186721 | 3300005446 | Soil | MVSNVLEVDEDDLLKRVKTFKKKYADDAEYRKLRGALPKDWPL* |
Ga0066689_100421532 | 3300005447 | Soil | MVSNVLEIEQAALVKQLKSFKKKYAADPEFKKLRADLPKDWPF* |
Ga0066682_100397225 | 3300005450 | Soil | MVSNVLEVDQDDLLKQVKTFKKKYAEDPEYNKLRAALPKAWPL* |
Ga0066682_101364912 | 3300005450 | Soil | MVSNVLEVDQDDLIKRIKTFKKKYADDPEYKRLRAALPKDWPL* |
Ga0070706_1010300522 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSNVLEVDQDKLIKQLKTFKKTYAADAEYKKLRASLPKDWPF* |
Ga0070706_1010757882 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSNVLEVDDDELLKRVKTFKKKYANDPEYKKLRAVLPRDWPL* |
Ga0070706_1014672412 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSNVLEVDEEELLTRVRTFKKKYSEDAEYKKLRAALPRDWPL* |
Ga0070707_1000736416 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSNVLEVDAGDLLKRLRAFKKRYADDPEYKTLRAALPKEWPL* |
Ga0070699_1017239951 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSNVLEMEQAELARKLRTFKKKYDADPEYRELRAGLPKDWPL* |
Ga0070697_1000520402 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSNVLEVDQRELVKLLRTFKKRYASDAEYRKLRAELPKEWPF* |
Ga0070697_1010928261 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSNVLELDEDDLLKRVRTFKKKYADDPEYKKLRAELPKEWPL* |
Ga0066697_102825383 | 3300005540 | Soil | MVSNVLEVDQDDLIKRIKTFKKKYADDSVYKSLRTALPKDWPL* |
Ga0070695_1000917782 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSNVLEVDEEELLKRVRTFKKKYADDADYKKLRSALPKDWPV* |
Ga0066701_101361822 | 3300005552 | Soil | MVSNVLEIDQAELVRKLKTFKKKYAADAEYKRLRAELPRDWPF* |
Ga0066701_105076342 | 3300005552 | Soil | MVSNVLEMDQAEIVRRLLSFKKTYARDPEYRKLRAELPKDWPL* |
Ga0066692_109656172 | 3300005555 | Soil | MVSNVLEVDQDDLLKQVKTFKKKYAEDSDYKKLRAALPKDWPL* |
Ga0066704_101081293 | 3300005557 | Soil | MVSNVLEVDQDDLLKQVKTFKKKYSDDPDYKKLRAALPNDWPL* |
Ga0066698_104437401 | 3300005558 | Soil | MVSNVLEVDQDDLIKRIKTFKKKYADDSEYKKLRTALPKDWPL* |
Ga0066698_108104811 | 3300005558 | Soil | MVSNVLEMDQAEIVRRLLSFKKTYARDPEYRKLRAELPKEWPL* |
Ga0066700_100073638 | 3300005559 | Soil | MVSNVLEMDRAEVVRRLKSFKKKYADDAEFRKLRAGLPKDWPF* |
Ga0066699_105836012 | 3300005561 | Soil | MVSNVLEIDRGDLVRRLKSFKKKYADDPEFRKLRAGLPKDWPF* |
Ga0066699_106476652 | 3300005561 | Soil | MVSNVLEVDQDDLLKQVKTFKKKYADDPDYKKLRA |
Ga0066693_102625512 | 3300005566 | Soil | EIDRGDLVRRLKSFKKKYADDAEFRKLRAGLPKDWPF* |
Ga0066693_103770451 | 3300005566 | Soil | MVSNVLEVDEDELLKAARSFKKKYADDPEYKKLRAALPKDWPL* |
Ga0066705_100984434 | 3300005569 | Soil | MVSNVLEVDQDDLLKQVKTFKKKYPEDPEYKKLRAALPKDWPL* |
Ga0066705_102601342 | 3300005569 | Soil | MVSNVLEIEQAALVKQLKTFKKKYAADPAFKKLRADLPKDWPF* |
Ga0066705_102946313 | 3300005569 | Soil | MVSNVLEVDQDDLLRQVKTFKRKYADDPDYKKLRAVLPKDWPL* |
Ga0066705_109715482 | 3300005569 | Soil | MVSNVLQVDEDELLKAARTFKKKYADDPEYRKLRAALPKDWPL* |
Ga0066702_107627232 | 3300005575 | Soil | FEETTGMVSNVLEVDEDDLLKRVKTFKKKYANDPEYKKLRAALPKDWPL* |
Ga0066702_109799132 | 3300005575 | Soil | MVSNVLEVDEDDLLKRVKTFKKKYVDDPEYKKLRAALPGDWPL* |
Ga0066708_100509372 | 3300005576 | Soil | MVSNVLEVDEDELLKAVRSFKKKYADDHEYKKLRAALPKDWPI* |
Ga0066708_109235212 | 3300005576 | Soil | VLEVDEDELLKAVRTFKKKYADDPEYKKLRAALPKDWPL* |
Ga0066691_101826744 | 3300005586 | Soil | MVSNVLEVDEDELLKRVKTFKKKYADDPEYNKLRAALPKDWPL* |
Ga0066691_104550142 | 3300005586 | Soil | MVSNVLEVDQGELVKLLRTFKKRYAGDAEYRKLRAELPKEWPF* |
Ga0066696_100207505 | 3300006032 | Soil | MVSNVLEIEQAALVKQLKTFKKRYAADPEFKKLRAELPKDWPF* |
Ga0066656_100207642 | 3300006034 | Soil | MVSNVLEVDPDDLLKQVKTFKKKYAEDSEYKKLRAALPKEWPL* |
Ga0066656_103637971 | 3300006034 | Soil | SNVLEVDQDDLIKRIKTFKKKYADDPEYKRLRAALPKDWPL* |
Ga0066656_108268733 | 3300006034 | Soil | NVLEVDQDDLLKQVKTFKKKYADDPDYKKLRAVLPKDWPL* |
Ga0066652_1000760536 | 3300006046 | Soil | MVSNVLEVDQDDLLKQVKTFKKKYAEDPEYNKLRAALPKEWPL* |
Ga0075417_100742113 | 3300006049 | Populus Rhizosphere | MVSNVLEVDQDDLIKRIRTFKKKYADDPEYKKLRAVLPKEWPL* |
Ga0070716_1002581663 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSNVLEVDEEELLKRVRTFKKKYTEDAEYKKLRDALPRDWPL* |
Ga0066653_100220962 | 3300006791 | Soil | MVSNVLEVDQDDLLKQVKTFKKKYAEDPEYNKLRAALPKACPL* |
Ga0066659_101008103 | 3300006797 | Soil | MVSNVLEVDQDDLVKQLKTFKKKYAEDAEYKKLRATLPKAWPF* |
Ga0066660_1000239910 | 3300006800 | Soil | MVSNVLEIERAALVKQLKTFKKRYAADPEFKKLRADLPKDWPF* |
Ga0075433_1001543210 | 3300006852 | Populus Rhizosphere | MVSNVLEVDAGDLLKRLRAFKKKYADDAEYKTLRAALPKEWPL* |
Ga0075433_118939802 | 3300006852 | Populus Rhizosphere | MVSNVLEVDQDDLLKQIKTFKKKYADDPEYKKLRAALPKDWPL* |
Ga0075435_1009020222 | 3300007076 | Populus Rhizosphere | MVSNVLEVDQDDLLRRIKTFKKKYATDPEYQKLRADLPKEWPL* |
Ga0075435_1010111762 | 3300007076 | Populus Rhizosphere | MVSNVLEIDQRELVKLLKTFKKKYADDPEWKRLRAELPKDWPF* |
Ga0099793_105074092 | 3300007258 | Vadose Zone Soil | MVSNVLEVDEDDLLKRVKTFKKKYAGDPEYKKLRAALPGDWPL* |
Ga0066710_1000412594 | 3300009012 | Grasslands Soil | MVSNVLEIDRGDLVRRLKSFKKKYADDPEFRKLRAGLPKDWPF |
Ga0066710_1008922823 | 3300009012 | Grasslands Soil | MVSNVLEVDEDDLLKRVKTFKKKYADDAEYRKLRGALPKEWPL |
Ga0066710_1031238302 | 3300009012 | Grasslands Soil | MVSNVLEIERAALVKQLKSFKKKYAADPEFKKLRAELPKDWPF |
Ga0066710_1035827042 | 3300009012 | Grasslands Soil | FEETTGMVSNVLEVDQEELIDLLKTYKKKYAGDPEYAKLRAELPKGWPL |
Ga0099829_100917173 | 3300009038 | Vadose Zone Soil | MVSNVLEVDAGDLLKRLRAFKKQYADDPEYKALRAALPKEWPL* |
Ga0099829_101638701 | 3300009038 | Vadose Zone Soil | EEELLKRVRTFKKRYTEDDEYKKLRAALPRDWPL* |
Ga0099829_102671621 | 3300009038 | Vadose Zone Soil | MVSNVLEVDDDDLLRRVKTFKKKYANDPEYKRLRAALPKDWPL* |
Ga0099830_111427082 | 3300009088 | Vadose Zone Soil | VLEVDEDELLKRVKTFKKRYADDPEYRKLRAALPKDWPL* |
Ga0099828_104419622 | 3300009089 | Vadose Zone Soil | MVSNVLEVDQRELVRKLKTFKKKYAGDAEYKNLRAELPRDWPF* |
Ga0099828_104843013 | 3300009089 | Vadose Zone Soil | MVSNVLEVDAGDFLKRLRAFKKQYADDPEYKALRAALPKEWPL* |
Ga0099828_109673981 | 3300009089 | Vadose Zone Soil | ETTGMVSNVLEVDEDELLKRVKTFKKRYADDPEYRKLRAALPKDWPL* |
Ga0099828_118310272 | 3300009089 | Vadose Zone Soil | EVDEDDLLKRVKTFKRKYADDPEYKKLRAALPKDWPL* |
Ga0099827_101779344 | 3300009090 | Vadose Zone Soil | IEMDQRELTRLLKSFKKKYADDAEYRRLRAELPKDWPF* |
Ga0099827_104435122 | 3300009090 | Vadose Zone Soil | MVSNVLEVDEDDLLKQVKTFKKKYADDPEYKKLRAGLPKDWPL* |
Ga0099827_106294191 | 3300009090 | Vadose Zone Soil | MVSNVLEVDQRELVRKLKTFKKKYASDAEYKKLRAELPKDWPF* |
Ga0099827_112382362 | 3300009090 | Vadose Zone Soil | MVSNVLEVDQDDLVKQLKSFKKKYAEDVEYKKLRASLPKDWPF* |
Ga0099827_114408092 | 3300009090 | Vadose Zone Soil | MVSNVLEMEQAELARKLRTFKKKYAADPEYQKVRAGLPKDWPM* |
Ga0099827_119187491 | 3300009090 | Vadose Zone Soil | MVSNVLEVDEEELLKRVRTFKKRYTEDDEYKKLRAALPRDWPL* |
Ga0066709_1022977511 | 3300009137 | Grasslands Soil | TGMVSNVLEVDQEELIDLLKTYKKKYAGDPEYAKLRAELPKTWPL* |
Ga0066709_1031665032 | 3300009137 | Grasslands Soil | MVSNVLEVDQTELIRKLRSFKKKYAGDADYKKARAALPKDWPL* |
Ga0066709_1032573471 | 3300009137 | Grasslands Soil | MVSNVLEVDQDDLLKQVRTFKKKYAADPEYKKLRAALPKDWPL* |
Ga0099792_105904882 | 3300009143 | Vadose Zone Soil | MVSNVLEVDEEELAKRVRTFKKKYADDPEYKKLRGALPKDWPL* |
Ga0114129_113956661 | 3300009147 | Populus Rhizosphere | ETTGMVSNVLEVDQDDLIKRIRTFKKKYADDPEYKKLRAVLPKEWPL* |
Ga0134070_104374311 | 3300010301 | Grasslands Soil | QDDLLKQVKTFKKKYAEDSEYKKLRAALPKEWPL* |
Ga0134088_101287342 | 3300010304 | Grasslands Soil | MVSNVLEMDQAEIVRRLLSFKKTYARDPEYHKLRAELPKDWPL* |
Ga0134088_104903912 | 3300010304 | Grasslands Soil | MVSNVLEVDEDDLLKRVKTFKKKYAGDPEYKKLRAALPRDWPL* |
Ga0134088_107020992 | 3300010304 | Grasslands Soil | FEETTGMVSNVLEVDEDELLKRVKTFKKKYAADPEYKKLRAALPGDWPL* |
Ga0134067_100908961 | 3300010321 | Grasslands Soil | LGFQETTGMVSNVLEVDQDDLLRQVKTFKRKYADDPDYKKLRAVLPKDWPL* |
Ga0134067_103870211 | 3300010321 | Grasslands Soil | ETTGMVSNVLEVDQDDLLKQVKTFKKKYADDPDYKKLRAILPKDWPL* |
Ga0134084_102245172 | 3300010322 | Grasslands Soil | MVSNVLEVDQDDLLKQVKTFKKKYADDPDYKKLSAVLPKDWPL* |
Ga0134086_103905601 | 3300010323 | Grasslands Soil | SLGFEETTGMVSNVLEVDPGDLLKQVKAFKKKYAEDPEYKKLRAALPKAWPL* |
Ga0134065_103021913 | 3300010326 | Grasslands Soil | LGFEETTGMVSNVLEVDQDDLLKQVKTFKKKYADDPDYKKLRAVLPKDWPL* |
Ga0134111_100225783 | 3300010329 | Grasslands Soil | MVSNVLEVDQDELVKQLKSFKKKYADDPEYKKLRASLPKDWPF* |
Ga0134080_101032742 | 3300010333 | Grasslands Soil | MVSNVLEVDQDELVKQLKSFKKKYADDVEYKKLRASLPKDWPF* |
Ga0134063_103003443 | 3300010335 | Grasslands Soil | LGFEETTGMVSNVLEVDQEELIDLLKTYKKKYAGDPEYAKLRAELPKGWPL* |
Ga0134071_101518092 | 3300010336 | Grasslands Soil | MVSNVLEIDQAELVRRLKTFKKKYADDPEYKKLRAALPKDWPL* |
Ga0134071_101975423 | 3300010336 | Grasslands Soil | MVSNVLEVDQDDLIKRIKTFKKKYADDPEYKKLRAALPRDWPL* |
Ga0120148_10568713 | 3300011999 | Permafrost | EGELLKRVRTFKKKYADDPEYKKLRAALPKDWPI* |
Ga0120163_10852742 | 3300012003 | Permafrost | MVSNVLEVDEDELLKRVRTFKREYADDTDYKKLRAALPKDWPI* |
Ga0120118_100013823 | 3300012010 | Permafrost | MVSNVLEVDEGELMKRVRTFKKKYADDPEYKKLRAALPKDWPI* |
Ga0137388_111945652 | 3300012189 | Vadose Zone Soil | MVSNVLEVDEEELLKRVRTFKKRYSEDDEYKKLRAALPRDWPL* |
Ga0137364_101026012 | 3300012198 | Vadose Zone Soil | MVSNVLEVNEDDLLKQVKTFKKKYGDDAEYKKLRAVLPKEWPL* |
Ga0137364_101283471 | 3300012198 | Vadose Zone Soil | LGFEETTGMVSNVLEVDEDELLKAARGFKKKYADDPEYKKLRAALPKDWPL* |
Ga0137364_106220452 | 3300012198 | Vadose Zone Soil | MVSNVLEVDQDDLITQLKTFKKKYAQDAEYKKLRAALPKDWPF* |
Ga0137364_109525211 | 3300012198 | Vadose Zone Soil | MVSNVLEVDEDELLKAARSFKKKYADDPEYKKLRAA |
Ga0137364_112567802 | 3300012198 | Vadose Zone Soil | GFEETTGMVSNVLEVDEDDLLKRVKTFKKKYADDPEYKKLRAALPKDWPL* |
Ga0137383_110424192 | 3300012199 | Vadose Zone Soil | MVSNVLEVDEDELLKRVKTFKKKYADDPGYKKLRAALPKDWPL* |
Ga0137383_112899801 | 3300012199 | Vadose Zone Soil | MVSNVLEVDQDDLLKQVKTFKKKYAEDSEYKKLRAALPKAWPL* |
Ga0137382_100922682 | 3300012200 | Vadose Zone Soil | MVSNVLEVDEDELLKAARTFKKKYADDPEYKKLRAALPKDWPL* |
Ga0137382_101598984 | 3300012200 | Vadose Zone Soil | VSNVLEVDEDELLKAARGFKKKYADDPEYKKLRAALPKDWPL* |
Ga0137382_103485632 | 3300012200 | Vadose Zone Soil | MVSNVLEVDEDELLRAAKTFKKKYADDPEYKKLRAALPKEWPL* |
Ga0137363_103102932 | 3300012202 | Vadose Zone Soil | MVSNVLEVDEDDLLKRVRTFKKKYADDPEYKRLRAALPKDWPL* |
Ga0137399_100152295 | 3300012203 | Vadose Zone Soil | MVSNVLEVDEEELVKRIRTFKKKYADDPEYKKLRAALPKDWPL* |
Ga0137399_100245624 | 3300012203 | Vadose Zone Soil | MVSNVLEVDQDDLVKQLKTFKKKYAEDAEYKKLRASLPKDWPF* |
Ga0137399_104186071 | 3300012203 | Vadose Zone Soil | MVSNVLEVDEDDLLKRVKAFKKKYADEHEYKKHRAP |
Ga0137399_106237942 | 3300012203 | Vadose Zone Soil | MVSNVLEVDEDELLKQVKAFKKKYADDAEYKKLRAVLPKDWPL* |
Ga0137399_107848323 | 3300012203 | Vadose Zone Soil | VLEVDEDDLLKRMKTFKKKYADDPEYKKLRALLPKDWPL* |
Ga0137399_112617992 | 3300012203 | Vadose Zone Soil | MVSNVLEVDEDDLLKRVKTFKKKYANDPEYRTLRAALPKDWPL* |
Ga0137380_100030339 | 3300012206 | Vadose Zone Soil | MVSNVLEVDGDDLLKRVKTFKKKYANDPEYKKLRAALPRDWPL* |
Ga0137380_105591264 | 3300012206 | Vadose Zone Soil | MVSNVLEVDARDLLKRLRAFKKKYADDPEYKTLRQALPKEWPL* |
Ga0137381_104771532 | 3300012207 | Vadose Zone Soil | MVSNVLEVDEDELLKRVRTFKKKYAGDPVYQKLRAALPREWPL* |
Ga0137376_100216605 | 3300012208 | Vadose Zone Soil | MVSNVLEMDRADVVRRLKAFKKKYAGDAEFRKLRAGLPKDWPF* |
Ga0137376_102826872 | 3300012208 | Vadose Zone Soil | MVSNVLEVDQDDLLKQVKTFKKKYAEDPEYKKLRAALPKEWPL* |
Ga0137376_104961751 | 3300012208 | Vadose Zone Soil | MVSNVLEVDEDELLKRVKTFKKNYAGDPGYKKLRAALPKDWPL* |
Ga0137376_114173362 | 3300012208 | Vadose Zone Soil | VSNVLEVDEDDLLKRVKTFKKKYADDPEYKKLRAALPRDWPL* |
Ga0137376_116837041 | 3300012208 | Vadose Zone Soil | MVSNVLEVDEDELLKAARAFKKKYADDPEYKKLRAALPKEWPL* |
Ga0137379_101191143 | 3300012209 | Vadose Zone Soil | MVSNVLEVDQDDLLKQVKTFKKKYAGDPDYKKLRAVLPKDWPL* |
Ga0137377_100875692 | 3300012211 | Vadose Zone Soil | MVSNVLEVDQDDLLKQVKTFKKKYADDPDYKKLRAALPKDWPL* |
Ga0137377_114935391 | 3300012211 | Vadose Zone Soil | MVSNVLEVDEDELQKRVRTFKKKYAGDPVYQKLRAALPRDWPL* |
Ga0137370_101448962 | 3300012285 | Vadose Zone Soil | MVSNVLEVDEDELLQAVRTFKKKYADDPEYKKVRAALPKDWPL* |
Ga0137386_101726223 | 3300012351 | Vadose Zone Soil | MVSNVLEVDGDDLLKRVKTFKKKYANDPEYKKLRAPLPRDWPL* |
Ga0137371_111807512 | 3300012356 | Vadose Zone Soil | MVSNVLEVDHDDLLKQVKTFKKKYPEDPEYKNLRAALPKDWPL* |
Ga0137360_112772692 | 3300012361 | Vadose Zone Soil | MVSNVLEVDEDDLLKRVKTFKKKYADDPEYNKLRAALPKDWPI* |
Ga0137390_101959672 | 3300012363 | Vadose Zone Soil | MVSNVLEVDAGDLLKRLRAFKRKYADDPEYKTLRAALPKEWPL* |
Ga0137358_106871512 | 3300012582 | Vadose Zone Soil | MVSNVLEVDEDELLKRVKTFKKKYAADSEYKKLRAALPKDWPI* |
Ga0137397_106146301 | 3300012685 | Vadose Zone Soil | MVSNVLEVDEDDLLKRVKTFKKKYADDPEYKKLRTLLPKDWPL* |
Ga0137396_101616612 | 3300012918 | Vadose Zone Soil | MVSNVLEVDQDDLVKQLKTFKKKYAVDAEYKKLRASLPKDWPF* |
Ga0137396_102354122 | 3300012918 | Vadose Zone Soil | MVSNVLEVDEDDLLKRVKTFRKKYADDPEYKKLRALLPKDWPL* |
Ga0137396_102989962 | 3300012918 | Vadose Zone Soil | MVSNVLEVDEDELMKRVKTFTKKYADDPEYKKLRAALPKDWPL* |
Ga0137396_108720732 | 3300012918 | Vadose Zone Soil | MVSNVLEVDEDELLKQVKAFKKKYADDAEYKKLRAALPKDWPL* |
Ga0137394_113655932 | 3300012922 | Vadose Zone Soil | MVSNVLEVDEDDLFKRVKTFKKKYADDPEYKKLRALLPKDWPL* |
Ga0137359_104258112 | 3300012923 | Vadose Zone Soil | MVSNVLEVDEDELLKRVKTFKKKYAADPEYKKLRAALPKDWPI* |
Ga0137419_100812765 | 3300012925 | Vadose Zone Soil | MVSNVLEVDEDDLLKRMKTFKKKYADDPEYKKLRALLPKDWPL* |
Ga0137416_104474992 | 3300012927 | Vadose Zone Soil | MVSNVLEVDEDDLLKRVRTFRKKYADDPEYKKLRALLPKDWPL* |
Ga0137416_113654341 | 3300012927 | Vadose Zone Soil | MVSNVLEVDEDELLKRVKTFKKKYADDPEYTKLRAALPKDWPL* |
Ga0137404_115760692 | 3300012929 | Vadose Zone Soil | MVSNVLEVDEDDLLKRVKTFKKKYADDPEYKKLRALLPKDWPL* |
Ga0137407_119066431 | 3300012930 | Vadose Zone Soil | EVDEDELLKRVKTFKKKYAADPEYKKLRAALPKDWPI* |
Ga0134110_103095163 | 3300012975 | Grasslands Soil | MVSNVLEVDQDDLLKQVKTFKRKYADDPDYKKLRAVLPKDWPL* |
Ga0120150_10040953 | 3300013294 | Permafrost | MVSNVLEVDEGELLKRVRTFKKKYADDPEYKKLRAALPKDWPI* |
Ga0134078_104967122 | 3300014157 | Grasslands Soil | EETTGMVSNVLEIDRGDLVRRLKSFKKKYADDAEFRKLRAGLPKDWPF* |
Ga0167668_10791832 | 3300015193 | Glacier Forefield Soil | MVSNVLEVDEGELMKRVKTFKKKYADDPEYKKLRAALPKDWPI* |
Ga0134073_102390131 | 3300015356 | Grasslands Soil | MVSNVLEIEQAALVKQLKTFKKKYVADPEFKKLRAELPKDWPF* |
Ga0134089_102273812 | 3300015358 | Grasslands Soil | FEETTGMVSNVLEMDQAEIVRRLLSFKKTYARDPEYRKLRAELPKEWPL* |
Ga0134089_105232962 | 3300015358 | Grasslands Soil | GFEETTGMVSNVLEIDQAELVRKLKTFKKKYAADAQYKRLRAELPRDWPF* |
Ga0134085_103954692 | 3300015359 | Grasslands Soil | MVSNVLEVDQDDLLKQVKTFKKKYAEDSEYKKLRAALPKEWPL* |
Ga0132258_112891111 | 3300015371 | Arabidopsis Rhizosphere | MVSNVLDMDQDDLVALLKTFKKKYADDADYAKLRADLPKAWPM* |
Ga0134112_102902362 | 3300017656 | Grasslands Soil | QGFEETTGMVSNVIEVDQDDLVRQLKTFKKKYAGDEEYRKLRASLPKDWPF |
Ga0134083_102889122 | 3300017659 | Grasslands Soil | MVSNVLEVDQDDLLKQVKTFKKKYAEDSDYKKLRAALPKDWPL |
Ga0184605_100408484 | 3300018027 | Groundwater Sediment | MVSNVLEVDEDELLKQIRTFKKKYADDPEYKKLRAALPKDWPI |
Ga0184605_100421393 | 3300018027 | Groundwater Sediment | MVSNVLEVDEDDLLKRVKTFKKKYQGDPEYTKLRAALPKEWPL |
Ga0184605_101727922 | 3300018027 | Groundwater Sediment | MVSNVLEVDEDDLLKRVKTFKKKYADDPEYKKLRASLPTDWPI |
Ga0184605_102786792 | 3300018027 | Groundwater Sediment | SNVLEVDEDELLKRVRTFKKKYADDPEYKKLRAALPKDWPL |
Ga0184605_104704752 | 3300018027 | Groundwater Sediment | MVSNVLEVDEDELLKRVRTFKKKYADDPEYKKLRAALPKDWPL |
Ga0184608_1000003916 | 3300018028 | Groundwater Sediment | MVSNVLEVDEDDLLKRVKTFKKKYEGDPEYTKLRAALPKEWPL |
Ga0184621_101860831 | 3300018054 | Groundwater Sediment | MVSNVLEVDEDDLLKRVKTFKKKYADDPEYKKLRAALPKDWPL |
Ga0184619_100355062 | 3300018061 | Groundwater Sediment | MVSNVLEVDEDDLLKRVKTFKKKYADDPEYKKLRASLPKDWPI |
Ga0184609_105021082 | 3300018076 | Groundwater Sediment | MVFNVLDVDEDDLIKRVRTFKKKYADDPDYAKLRGALPEDWPL |
Ga0066655_100540133 | 3300018431 | Grasslands Soil | MVSNVLEVDQDDLVKQLKSFKKKYADDPEYKKLRASLPKDWPF |
Ga0066655_104272962 | 3300018431 | Grasslands Soil | MVSNVLEVDQDDLLKQVKTFKKKYAEDSEYKKLRAALPKEWPL |
Ga0066655_107168331 | 3300018431 | Grasslands Soil | MVATVREVDAGGLLKQVKAFKKKYAEDSDYKKLRAALPKDWPL |
Ga0066655_112754191 | 3300018431 | Grasslands Soil | MVSNVLEIDQAELVRKLKTFKKKYAADAQYKRLRAELPRDWPF |
Ga0066655_113540312 | 3300018431 | Grasslands Soil | TTGMVSNVLEVDQDDLLKQVKTFKKKYADDPDYKKLRAVLPKDWPL |
Ga0066667_100048036 | 3300018433 | Grasslands Soil | MVSNVLEIEQAALVKQLKTFKKRYAADPEFKKLRADLPKDWPF |
Ga0066667_100601454 | 3300018433 | Grasslands Soil | MVSNVLEVDPDDLLKQVKTFKKKYAEDSDYKKLRAALPKDWPL |
Ga0066667_105379252 | 3300018433 | Grasslands Soil | MVSNVLEVDQDDLLRQVKTFKRKYADDPDYKKLRAVLPKDWPL |
Ga0066667_109546132 | 3300018433 | Grasslands Soil | MVSNVLEVDEDDLLKRVKTFKKKYADDPEYKKLRAALPRDWPL |
Ga0066667_113842382 | 3300018433 | Grasslands Soil | MVSNVLEMDRAEVVRRLKAFKKKYAGDAEFRKLRAGLPKDWPF |
Ga0066667_115918441 | 3300018433 | Grasslands Soil | MVSNVLEIDRGDLVRRLKSFKKKYADDAEFRKLRAGLPKDWPF |
Ga0066662_100188978 | 3300018468 | Grasslands Soil | MVSNVLEIDQAELVRKLKTFKKKYAADAEYKRLRAELPRDWRF |
Ga0066662_100193202 | 3300018468 | Grasslands Soil | MVSNVLEIERAALVKQLKTFKKKYAADPEFKKLRADLPKDWPF |
Ga0066662_100764002 | 3300018468 | Grasslands Soil | MVSNVIEVDQDDLVRQLKTFKKKYAGDEEYRKLRASLPKDWPF |
Ga0066662_105439241 | 3300018468 | Grasslands Soil | MVSNVLEVDQDDLIKQLKTFKKKYAGDREYKPLRASLPKEWPF |
Ga0066662_117234802 | 3300018468 | Grasslands Soil | MVSNVLEMEQAELARKLRTFKKKYAADPEYRELRAGLPKDWPL |
Ga0066669_102092432 | 3300018482 | Grasslands Soil | MVSNVLEVDEDELLKAAKTFKKKYADDPEYRKLRAALPKDWPL |
Ga0066669_107171272 | 3300018482 | Grasslands Soil | MVSNVLEVDQDDLLKQVKTFKKKYAEDPEYNKLRAALPKAWPL |
Ga0066669_111672272 | 3300018482 | Grasslands Soil | MVSNVLEVDQDDLLKQVKTFKKKYADDPDYKKLRAVLPKDWPL |
Ga0066669_118829551 | 3300018482 | Grasslands Soil | MVSNVLEMDRAEVVRRLKSFKKKYADDAEFRKLRAGLPKDWPF |
Ga0193723_10055085 | 3300019879 | Soil | MVSNVLEVDEDELLKRVRTFKKKYAADPDYKKLRAYLPRDWPL |
Ga0193747_100101712 | 3300019885 | Soil | MVSNVLEVDEDELLKAAKTFKKKYADDPEYKKLRAALPKDWPL |
Ga0193747_10181662 | 3300019885 | Soil | MVSNVLEVDEDELLKRVRGFKKKYGDDPEYKKLRAALPKDWPL |
Ga0193731_10266401 | 3300020001 | Soil | MVSNVLEVDEDELLKAARTFKKKYADDPEYKKLRAALPKDWPL |
Ga0193755_11348472 | 3300020004 | Soil | TTGMVSNVLEVDEDELLKRVKTFKKKYADDPEYKKLRGALPKDWPL |
Ga0193735_10425143 | 3300020006 | Soil | VSNVLEVDEDELLKAARTFKKKYADDPEYKKLRAALPKDWPL |
Ga0193733_11888051 | 3300020022 | Soil | MVSNVLEVDEDELLKRVRGFKKKYADDPEYKKLRAALPKDWPL |
Ga0210382_100153874 | 3300021080 | Groundwater Sediment | MVSNVLEVDEDDLLKRVKTFKKKYAEDPEYKRLRAALPRDWPI |
Ga0210382_101041212 | 3300021080 | Groundwater Sediment | MVSNVLEVDQDDLIKQLKTFKKKYAQDAEYKKLRSALPKDWPF |
Ga0193695_10808262 | 3300021418 | Soil | MVSNVLEVDEDELLKRVKTFKKKYADDPEYKKLRAALPKDWPL |
Ga0224452_11929642 | 3300022534 | Groundwater Sediment | MVSNVLEVDEDDLLKRVKTFKKKYAEDPEYKKLRAALPKEWPL |
Ga0222622_103268202 | 3300022756 | Groundwater Sediment | MVSNVLEVDEDELLKRVRIFKKKYADDPQYKKLRAALPKDWPL |
Ga0207653_101912862 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSNVLEVDEDELLKRVKTFKKKYADDPEYKTLRAMLPKEWPL |
Ga0207684_1001048511 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSNVLELDEDELLKRVKTFKKKYADDPEYKTLRAVLPKEWPL |
Ga0207684_100119924 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSNVLEVDQDGLLKRIKTFKKKYADDPEYKKLRAALPKDWPL |
Ga0207684_100977312 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSNVLEVDDDELLKRVKTFKKKYANDPEYKKLRAVLPRDWPL |
Ga0207684_101321213 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSNVLEVDQDKLIKQLKTFKKTYAADAEYKKLRASLPKDWPF |
Ga0207646_1000063348 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSNVLEVDAGDLLKRLRAFKKRYADDPEYKTLRAALPKEWPL |
Ga0207646_1000544314 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSNVLEVDQDDLLKRIKTFKKKYADDPEYKKLRAALPKDWPL |
Ga0207640_100129704 | 3300025981 | Corn Rhizosphere | MVSNVLEVDEEELLKRVRTFKKKYADDADYKKLRSALPKDWPV |
Ga0209234_10910762 | 3300026295 | Grasslands Soil | MVSNVLEVDEDDLLKRVKTFKKKYADDPEYKKLRAALPGDWPL |
Ga0209234_12247582 | 3300026295 | Grasslands Soil | MVSNVLEVDQDDVLKQVKTFKKKYADDPEYKKLRAALPKDWPL |
Ga0209237_10670082 | 3300026297 | Grasslands Soil | MVSNVLEVDEDELLKRVKTFKKKYADDPEYKKLRATLPRDWPL |
Ga0209237_10683422 | 3300026297 | Grasslands Soil | MVSNVLEVDEDDLLKQVKTFKKKYADDPEYKKLRAALPKDWPL |
Ga0209237_12371082 | 3300026297 | Grasslands Soil | MVSNVLEVDQDDLLKQVKTLKKKYAEDSEYKKLRAALPKDWPL |
Ga0209237_12386862 | 3300026297 | Grasslands Soil | MVSNVLEVDQDELVKQLKSFKKKYADDVEYKKLRASLPKDWPF |
Ga0209236_10068692 | 3300026298 | Grasslands Soil | MVSNVLEIDQAELVRRLKTFKKKYAADAEYKRLRAELPRDWRF |
Ga0209027_10193052 | 3300026300 | Grasslands Soil | MVSNVLEVDEDELLKAVRTFKKKYAGDPEYKKLRAALPTEWPL |
Ga0209238_10681072 | 3300026301 | Grasslands Soil | MVSNVLEVDQDDLLKQVKTFKKKYAEDPEYNKLRAALPKEWPL |
Ga0209238_10872432 | 3300026301 | Grasslands Soil | MVSNVLEVDQDDLVKQLKTFKKKYAEDAEYKKLRATLPKDWPF |
Ga0209469_11396282 | 3300026307 | Soil | VLEVDQDDLLKQVKTFKKKYAEDPEYNKLRAALPKAWPL |
Ga0209055_10029989 | 3300026309 | Soil | MVSNVLEIEQAALVKQLKSFKKKYAADPEFKKLRADLPKDWPF |
Ga0209055_10483101 | 3300026309 | Soil | MVSNVLEVDPGDLLKQVKAFKKKYAEDSDYKKLRAALPKDWPL |
Ga0209239_10622703 | 3300026310 | Grasslands Soil | MVSNVLEVDEDDLLKRVKTFKKKYANDPEYKKLRAALPKDWPL |
Ga0209153_12626931 | 3300026312 | Soil | MVSNVLEVDQDDLLKQVKTFKKKYADDPDYKKLRAILPKDWPL |
Ga0209761_11129513 | 3300026313 | Grasslands Soil | SNVLEIDQAELVRRLKTFKKKYAADAEYKRLRAELPRDWRF |
Ga0209686_10005816 | 3300026315 | Soil | MVSNVLEIEQAALVKQLKTFKKKYVADPEFKKLRADLPKDWPF |
Ga0209686_10064227 | 3300026315 | Soil | MVSNVLEVDQDDVLKQVRTFKKKYADDPEYKKLRAALPKDWPL |
Ga0209155_10017462 | 3300026316 | Soil | MVSNVLEIDRGDLVRRLKSFKKKYADDPDYKKLRAVLPKDWPL |
Ga0209154_10036133 | 3300026317 | Soil | MVSNVLEIERAALVKQLKTFKKRYAADPEFKKLRADLPKDWPF |
Ga0209471_100070919 | 3300026318 | Soil | MVSNVLEVDEDDLLKRVKTFKKKYPDDPEYKKLRAALPGDWPL |
Ga0209471_12084261 | 3300026318 | Soil | DQDDLLKQIKGFKKKYADDSEYKKLRAVLPKDWPL |
Ga0209472_12197672 | 3300026323 | Soil | ETTGMVSNVLEIDRGDLVRRLKSFKKKYADDPEFRKLRAGLPKDWPF |
Ga0209267_12599011 | 3300026331 | Soil | MVSNVLEVDQDDLVKQLKTFKKKYAEDAEYKKLRATLP |
Ga0209803_10326802 | 3300026332 | Soil | MVSNVLEIEQAALVKQLKTFKKKYAADPAFKKLRADLPKDWPF |
Ga0209158_10968892 | 3300026333 | Soil | MVSNVLEVDQDDLLKQIKGFKKKYADDSEYKKLRAVLPKDWPL |
Ga0209377_10750623 | 3300026334 | Soil | MVSNVLEVDQGDLLKQVKTFKKKYAEDSDYKKLRAALPKDWPL |
Ga0209804_10048459 | 3300026335 | Soil | MVSNVLEIEQAALVKQLKTFKKKYAADPEFKKLRADLPKDWPF |
Ga0209804_10649795 | 3300026335 | Soil | MVSNVLEIDQAELVRKLKTFKKKYAADAQYKRLRAELPRDW |
Ga0209690_10110125 | 3300026524 | Soil | MVSNVLEVDPDDLLKQVKTFKKKYAEDSDYKKLRAALPKDWPF |
Ga0209807_10002415 | 3300026530 | Soil | MVSNVLEVDQDDLLKQVKTFKKKYPEDPEYKKLRAALPKDWPL |
Ga0209058_11374143 | 3300026536 | Soil | MVSNVLEMDQAEIVRRLLSFKKTYARDPEYRKLRAELPKEWPL |
Ga0209058_12452231 | 3300026536 | Soil | EVDQDDLLKQVKTFKKKYADDPDYKKLRAVLPKDWPL |
Ga0209157_10175107 | 3300026537 | Soil | MVSNVLEVDEDDLLKRVKTFKKKYADDAEYRKLRGALPKDWPL |
Ga0209157_13779161 | 3300026537 | Soil | MVSNVLEVDEDELLKRVKTFKKKYAADPEYKKLRAALPGDWPL |
Ga0209056_101168764 | 3300026538 | Soil | MVSNVLEVDQDDLLKQVRTFKKKYAADPEYKKLRAALPKDWPL |
Ga0209376_10382541 | 3300026540 | Soil | EETTGMVSNVLEVDQDDLLKQVKTFKKKYADDPDYKKLRAVLPKDWPL |
Ga0209805_10040111 | 3300026542 | Soil | SNVLEVDQDDLLKQVKTFKKKYADDPDYKKLRAVLPKDWPL |
Ga0209474_102248902 | 3300026550 | Soil | MVSNVLEVDPGDLLKQVKAFKKKYAEDSDYKKLRAGRRTSG |
Ga0209474_102723521 | 3300026550 | Soil | AMDRAEVVRRLKSFKKKYADDAEFRKLRAGLPKDWPF |
Ga0209474_102793891 | 3300026550 | Soil | FEETTGMVSNVLEIDQAELIRKLKTFKHKYADDPEYRKARALLPKDWPL |
Ga0208991_10457551 | 3300027681 | Forest Soil | MVSNVLEVDQDDLLKQIKAFKNKYADDAEYRKLRAALPKDWPV |
Ga0208989_102207812 | 3300027738 | Forest Soil | MVSNVLEVDQDDLLKQIKAFKNKYADDAEYRKLRAAL |
Ga0209689_10925661 | 3300027748 | Soil | VDQDDLVKQLKTFKKKYAEDAEYKKLRATLPKDWPF |
Ga0209689_12650182 | 3300027748 | Soil | MVSNVLEVDQDDLVKQLKTFKKKYAEDAEYKKLRA |
Ga0209180_105696701 | 3300027846 | Vadose Zone Soil | MVSNVLEVDAGDLLKRLRAFKKQYADDPEYKALRAALPKEWPL |
Ga0209180_107923402 | 3300027846 | Vadose Zone Soil | MVSNVLEVDDDDLLRRVKTFKKKYANDPEYKRLRAALPKDWPL |
Ga0209814_100904342 | 3300027873 | Populus Rhizosphere | MVSNVLEVDQDDLIKRIRTFKKKYADDPEYKKLRAVLPKEWPL |
Ga0209283_105370562 | 3300027875 | Vadose Zone Soil | MVSNVLEVDAGDFLKRLRAFKKQYADDPEYKALRAALPKEWPL |
Ga0209590_103057881 | 3300027882 | Vadose Zone Soil | MVSNVLEVDQRELVRKLKTFKKKYASHAEYKKLRAELPKDWPF |
Ga0209488_101229112 | 3300027903 | Vadose Zone Soil | MVSNVLEVDEDDLLKRVRTFRKKYADDSEYTKLRAALP |
Ga0137415_100659744 | 3300028536 | Vadose Zone Soil | MVSNVLEVDEDDLLKRVRTFRKKYADDPEYKKLRALLPKDWPL |
Ga0307293_102451611 | 3300028711 | Soil | MVSNVLEVDVDDLLKRVKTFKKKYADDPEYKKLRGALPKDWPI |
Ga0307313_102859211 | 3300028715 | Soil | MVSNVLEVDEDELLKAAKTFKKKYADDPEYKKLRAALPKD |
Ga0307311_100595601 | 3300028716 | Soil | VLEVDEDELLKRVRTFKKKYADDPEYTKLRAALPKDWPL |
Ga0307298_102080622 | 3300028717 | Soil | MVSNVLEVDEDELLKRVRTFKKKYADDPEYTKLRAALPKDWPL |
Ga0307504_102143721 | 3300028792 | Soil | MVSNVLEVDEDDLLKRVKTFKKKYADDPEYKKLRALLPKDWPL |
Ga0307287_100350692 | 3300028796 | Soil | MVSNVLEVDEDDLLKRVKTFKKKYADDPEYKKLRAALPKEWPL |
Ga0307302_104404351 | 3300028814 | Soil | MVSNVLEVDEDDLLKRVKTFKKKYAEDPEYKKLRAALPKEWP |
Ga0307296_108028872 | 3300028819 | Soil | MVSNVLEVDEDDLLKRVKTFKKKYADDPEYKKLRAALPK |
Ga0307278_104535552 | 3300028878 | Soil | MVSNVLEVDQDDLIKQLKTFKKKYAQDAEYKKLRAALPKDWPF |
Ga0307308_105761001 | 3300028884 | Soil | MVSNVLEVDEDELLKRVRTFRKKYAADPDYKKLRAYLPRDWPM |
Ga0307469_111872782 | 3300031720 | Hardwood Forest Soil | MVSNVLEVDEDELLKRVRTFKKKYAGDPVYQKLRAALPRDWPI |
Ga0307473_108715402 | 3300031820 | Hardwood Forest Soil | MVSNVLEMDQAELIRKLKSFKRKYADDAEYKKARALLPKDWPL |
Ga0307471_1004446253 | 3300032180 | Hardwood Forest Soil | MVSNVLEVDEDELLKRVRTFKRKYADDLEYQKLRAALPRDWPI |
⦗Top⦘ |