| Basic Information | |
|---|---|
| Family ID | F009428 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 318 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MRSAPYDLSRSAARADALFASTLQRSDEPSAAQVKQAIAAA |
| Number of Associated Samples | 236 |
| Number of Associated Scaffolds | 318 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 99.05 % |
| % of genes near scaffold ends (potentially truncated) | 96.86 % |
| % of genes from short scaffolds (< 2000 bps) | 90.57 % |
| Associated GOLD sequencing projects | 223 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (66.352 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (40.880 % of family members) |
| Environment Ontology (ENVO) | Unclassified (43.711 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (40.252 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.83% β-sheet: 0.00% Coil/Unstructured: 52.17% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 318 Family Scaffolds |
|---|---|---|
| PF04672 | Methyltransf_19 | 17.61 |
| PF06262 | Zincin_1 | 11.95 |
| PF16884 | ADH_N_2 | 3.77 |
| PF00126 | HTH_1 | 3.14 |
| PF06983 | 3-dmu-9_3-mt | 2.52 |
| PF00857 | Isochorismatase | 2.20 |
| PF11706 | zf-CGNR | 1.89 |
| PF04237 | YjbR | 1.57 |
| PF00196 | GerE | 1.26 |
| PF11937 | DUF3455 | 1.26 |
| PF04024 | PspC | 1.26 |
| PF04542 | Sigma70_r2 | 0.94 |
| PF03466 | LysR_substrate | 0.94 |
| PF03473 | MOSC | 0.63 |
| PF07336 | ABATE | 0.63 |
| PF00437 | T2SSE | 0.63 |
| PF01230 | HIT | 0.63 |
| PF00106 | adh_short | 0.63 |
| PF08279 | HTH_11 | 0.31 |
| PF03631 | Virul_fac_BrkB | 0.31 |
| PF00916 | Sulfate_transp | 0.31 |
| PF00893 | Multi_Drug_Res | 0.31 |
| PF00069 | Pkinase | 0.31 |
| PF07993 | NAD_binding_4 | 0.31 |
| PF08241 | Methyltransf_11 | 0.31 |
| PF13374 | TPR_10 | 0.31 |
| PF03663 | Glyco_hydro_76 | 0.31 |
| PF03972 | MmgE_PrpD | 0.31 |
| PF02146 | SIR2 | 0.31 |
| PF01266 | DAO | 0.31 |
| PF02467 | Whib | 0.31 |
| PF01728 | FtsJ | 0.31 |
| PF04185 | Phosphoesterase | 0.31 |
| PF12867 | DinB_2 | 0.31 |
| PF13411 | MerR_1 | 0.31 |
| PF00561 | Abhydrolase_1 | 0.31 |
| PF13280 | WYL | 0.31 |
| PF13191 | AAA_16 | 0.31 |
| PF00579 | tRNA-synt_1b | 0.31 |
| PF04075 | F420H2_quin_red | 0.31 |
| PF13602 | ADH_zinc_N_2 | 0.31 |
| PF01522 | Polysacc_deac_1 | 0.31 |
| PF08922 | DUF1905 | 0.31 |
| PF13302 | Acetyltransf_3 | 0.31 |
| PF00557 | Peptidase_M24 | 0.31 |
| PF13692 | Glyco_trans_1_4 | 0.31 |
| PF13714 | PEP_mutase | 0.31 |
| PF06974 | WS_DGAT_C | 0.31 |
| PF08450 | SGL | 0.31 |
| PF13377 | Peripla_BP_3 | 0.31 |
| PF13420 | Acetyltransf_4 | 0.31 |
| PF00355 | Rieske | 0.31 |
| PF04203 | Sortase | 0.31 |
| PF01120 | Alpha_L_fucos | 0.31 |
| COG ID | Name | Functional Category | % Frequency in 318 Family Scaffolds |
|---|---|---|---|
| COG3824 | Predicted Zn-dependent protease, minimal metalloprotease (MMP)-like domain | Posttranslational modification, protein turnover, chaperones [O] | 11.95 |
| COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 2.52 |
| COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 2.52 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 2.20 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 2.20 |
| COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 1.57 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 1.26 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.94 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.94 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.94 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.94 |
| COG5516 | Uncharacterized conserved protein containing a Zn-ribbon-like motif, possibly RNA-binding | General function prediction only [R] | 0.63 |
| COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 0.31 |
| COG3669 | Alpha-L-fucosidase | Carbohydrate transport and metabolism [G] | 0.31 |
| COG3764 | Sortase (surface protein transpeptidase) | Cell wall/membrane/envelope biogenesis [M] | 0.31 |
| COG4833 | Predicted alpha-1,6-mannanase, GH76 family | Carbohydrate transport and metabolism [G] | 0.31 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.31 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.31 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.31 |
| COG2252 | Xanthine/guanine/uracil/vitamin C permease GhxP/GhxQ, nucleobase:cation symporter 2 ( NCS2) family | Nucleotide transport and metabolism [F] | 0.31 |
| COG2233 | Xanthine/uracil permease | Nucleotide transport and metabolism [F] | 0.31 |
| COG0162 | Tyrosyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.31 |
| COG2076 | Multidrug transporter EmrE and related cation transporters | Defense mechanisms [V] | 0.31 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.31 |
| COG1189 | Predicted rRNA methylase YqxC, contains S4 and FtsJ domains | Translation, ribosomal structure and biogenesis [J] | 0.31 |
| COG0846 | NAD-dependent protein deacetylase, SIR2 family | Posttranslational modification, protein turnover, chaperones [O] | 0.31 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.31 |
| COG0659 | Sulfate permease or related transporter, MFS superfamily | Inorganic ion transport and metabolism [P] | 0.31 |
| COG0293 | 23S rRNA U2552 (ribose-2'-O)-methylase RlmE/FtsJ | Translation, ribosomal structure and biogenesis [J] | 0.31 |
| COG0180 | Tryptophanyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.31 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 66.67 % |
| Unclassified | root | N/A | 33.33 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459012|GOYVCMS01A1A51 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus opacus → Rhodococcus opacus RKJ300 = JCM 13270 | 514 | Open in IMG/M |
| 2189573001|GZR05M101DGPDO | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 507 | Open in IMG/M |
| 3300003218|JGI26339J46600_10098672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 718 | Open in IMG/M |
| 3300004633|Ga0066395_10205225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1034 | Open in IMG/M |
| 3300004633|Ga0066395_11003322 | Not Available | 509 | Open in IMG/M |
| 3300005345|Ga0070692_11355311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 512 | Open in IMG/M |
| 3300005366|Ga0070659_100117991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2146 | Open in IMG/M |
| 3300005435|Ga0070714_102129552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes | 546 | Open in IMG/M |
| 3300005435|Ga0070714_102416034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 510 | Open in IMG/M |
| 3300005436|Ga0070713_100483571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1166 | Open in IMG/M |
| 3300005439|Ga0070711_100369911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1156 | Open in IMG/M |
| 3300005444|Ga0070694_100938969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes | 716 | Open in IMG/M |
| 3300005467|Ga0070706_100389458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1297 | Open in IMG/M |
| 3300005468|Ga0070707_101687549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 601 | Open in IMG/M |
| 3300005471|Ga0070698_100049491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4289 | Open in IMG/M |
| 3300005471|Ga0070698_100197942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1945 | Open in IMG/M |
| 3300005471|Ga0070698_101797056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 566 | Open in IMG/M |
| 3300005471|Ga0070698_101832543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 559 | Open in IMG/M |
| 3300005538|Ga0070731_10212046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1285 | Open in IMG/M |
| 3300005559|Ga0066700_10468974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 882 | Open in IMG/M |
| 3300005591|Ga0070761_10385918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 853 | Open in IMG/M |
| 3300005602|Ga0070762_10835703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 625 | Open in IMG/M |
| 3300005614|Ga0068856_102060320 | Not Available | 581 | Open in IMG/M |
| 3300005764|Ga0066903_101087422 | Not Available | 1473 | Open in IMG/M |
| 3300005764|Ga0066903_102682402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 966 | Open in IMG/M |
| 3300005764|Ga0066903_104619546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Catelliglobosispora → Catelliglobosispora koreensis | 733 | Open in IMG/M |
| 3300006028|Ga0070717_11430629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 628 | Open in IMG/M |
| 3300006163|Ga0070715_11083680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 504 | Open in IMG/M |
| 3300006173|Ga0070716_100034713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2768 | Open in IMG/M |
| 3300006175|Ga0070712_100077959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2390 | Open in IMG/M |
| 3300006755|Ga0079222_10074786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1683 | Open in IMG/M |
| 3300006800|Ga0066660_11147641 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300006804|Ga0079221_10143048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1240 | Open in IMG/M |
| 3300006804|Ga0079221_10223721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1049 | Open in IMG/M |
| 3300006806|Ga0079220_11100720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 643 | Open in IMG/M |
| 3300006854|Ga0075425_101953841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 657 | Open in IMG/M |
| 3300006903|Ga0075426_10784009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 716 | Open in IMG/M |
| 3300006903|Ga0075426_10907421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 665 | Open in IMG/M |
| 3300006904|Ga0075424_102764149 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300007982|Ga0102924_1157857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1038 | Open in IMG/M |
| 3300009011|Ga0105251_10140111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1094 | Open in IMG/M |
| 3300009012|Ga0066710_104252698 | Not Available | 535 | Open in IMG/M |
| 3300009093|Ga0105240_10671108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1134 | Open in IMG/M |
| 3300009137|Ga0066709_103158669 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300009522|Ga0116218_1497702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 543 | Open in IMG/M |
| 3300009523|Ga0116221_1539362 | Not Available | 512 | Open in IMG/M |
| 3300009700|Ga0116217_10247673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1157 | Open in IMG/M |
| 3300009792|Ga0126374_10100166 | Not Available | 1641 | Open in IMG/M |
| 3300009792|Ga0126374_10729690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 748 | Open in IMG/M |
| 3300009824|Ga0116219_10247156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1013 | Open in IMG/M |
| 3300009839|Ga0116223_10497019 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula | 710 | Open in IMG/M |
| 3300010043|Ga0126380_10527405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 913 | Open in IMG/M |
| 3300010046|Ga0126384_10353379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1226 | Open in IMG/M |
| 3300010303|Ga0134082_10243127 | Not Available | 744 | Open in IMG/M |
| 3300010335|Ga0134063_10743741 | Not Available | 510 | Open in IMG/M |
| 3300010339|Ga0074046_10712235 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 589 | Open in IMG/M |
| 3300010341|Ga0074045_10209558 | Not Available | 1302 | Open in IMG/M |
| 3300010358|Ga0126370_10991159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 766 | Open in IMG/M |
| 3300010359|Ga0126376_11123695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 796 | Open in IMG/M |
| 3300010361|Ga0126378_13140252 | Not Available | 526 | Open in IMG/M |
| 3300010375|Ga0105239_10274350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1897 | Open in IMG/M |
| 3300010376|Ga0126381_102374927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 761 | Open in IMG/M |
| 3300010376|Ga0126381_102964390 | Not Available | 675 | Open in IMG/M |
| 3300010379|Ga0136449_100636603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1807 | Open in IMG/M |
| 3300010398|Ga0126383_12518295 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300010401|Ga0134121_10686581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 969 | Open in IMG/M |
| 3300010869|Ga0126359_1617599 | Not Available | 565 | Open in IMG/M |
| 3300011107|Ga0151490_1454522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 686 | Open in IMG/M |
| 3300012189|Ga0137388_11767168 | Not Available | 551 | Open in IMG/M |
| 3300012199|Ga0137383_11235458 | Not Available | 535 | Open in IMG/M |
| 3300012200|Ga0137382_10670949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 742 | Open in IMG/M |
| 3300012205|Ga0137362_11459588 | Not Available | 570 | Open in IMG/M |
| 3300012206|Ga0137380_10014049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 7300 | Open in IMG/M |
| 3300012209|Ga0137379_10023464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5927 | Open in IMG/M |
| 3300012349|Ga0137387_10457064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 926 | Open in IMG/M |
| 3300012349|Ga0137387_11111381 | Not Available | 562 | Open in IMG/M |
| 3300012351|Ga0137386_10013150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5548 | Open in IMG/M |
| 3300012354|Ga0137366_10011238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces hokutonensis | 7049 | Open in IMG/M |
| 3300012354|Ga0137366_10557645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 824 | Open in IMG/M |
| 3300012354|Ga0137366_10819687 | Not Available | 660 | Open in IMG/M |
| 3300012359|Ga0137385_10325882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1318 | Open in IMG/M |
| 3300012359|Ga0137385_11595515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 516 | Open in IMG/M |
| 3300012359|Ga0137385_11666942 | Not Available | 501 | Open in IMG/M |
| 3300012497|Ga0157319_1024582 | Not Available | 610 | Open in IMG/M |
| 3300012499|Ga0157350_1007427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 849 | Open in IMG/M |
| 3300012510|Ga0157316_1007910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 916 | Open in IMG/M |
| 3300012513|Ga0157326_1099280 | Not Available | 501 | Open in IMG/M |
| 3300012685|Ga0137397_10250894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1318 | Open in IMG/M |
| 3300012915|Ga0157302_10190244 | Not Available | 729 | Open in IMG/M |
| 3300012955|Ga0164298_10928631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 636 | Open in IMG/M |
| 3300012971|Ga0126369_11956091 | Not Available | 674 | Open in IMG/M |
| 3300012984|Ga0164309_11536105 | Not Available | 570 | Open in IMG/M |
| 3300012986|Ga0164304_10547697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 854 | Open in IMG/M |
| 3300013104|Ga0157370_11081072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 725 | Open in IMG/M |
| 3300015242|Ga0137412_11255713 | Not Available | 518 | Open in IMG/M |
| 3300015265|Ga0182005_1194607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 607 | Open in IMG/M |
| 3300015371|Ga0132258_12853349 | Not Available | 1202 | Open in IMG/M |
| 3300016270|Ga0182036_11413208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 583 | Open in IMG/M |
| 3300016319|Ga0182033_10067019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2511 | Open in IMG/M |
| 3300016319|Ga0182033_10899497 | Not Available | 784 | Open in IMG/M |
| 3300016357|Ga0182032_10200193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1519 | Open in IMG/M |
| 3300016371|Ga0182034_10971811 | Not Available | 733 | Open in IMG/M |
| 3300016371|Ga0182034_11378437 | Not Available | 616 | Open in IMG/M |
| 3300016404|Ga0182037_10448032 | Not Available | 1073 | Open in IMG/M |
| 3300016404|Ga0182037_11785146 | Not Available | 549 | Open in IMG/M |
| 3300016404|Ga0182037_12166565 | Not Available | 500 | Open in IMG/M |
| 3300016422|Ga0182039_10494877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1055 | Open in IMG/M |
| 3300016445|Ga0182038_11048831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 723 | Open in IMG/M |
| 3300016445|Ga0182038_11614662 | Not Available | 583 | Open in IMG/M |
| 3300016445|Ga0182038_12154026 | Not Available | 506 | Open in IMG/M |
| 3300017928|Ga0187806_1244656 | Not Available | 619 | Open in IMG/M |
| 3300017937|Ga0187809_10245453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 647 | Open in IMG/M |
| 3300017943|Ga0187819_10016562 | All Organisms → cellular organisms → Bacteria | 4238 | Open in IMG/M |
| 3300017955|Ga0187817_10395116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 882 | Open in IMG/M |
| 3300017955|Ga0187817_10654530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 670 | Open in IMG/M |
| 3300017970|Ga0187783_11373459 | Not Available | 509 | Open in IMG/M |
| 3300017972|Ga0187781_11078459 | Not Available | 589 | Open in IMG/M |
| 3300017974|Ga0187777_10124503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1708 | Open in IMG/M |
| 3300018007|Ga0187805_10365095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus sabuli | 668 | Open in IMG/M |
| 3300018046|Ga0187851_10073848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis | 2162 | Open in IMG/M |
| 3300018058|Ga0187766_11295489 | Not Available | 531 | Open in IMG/M |
| 3300018431|Ga0066655_11211151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Luteimonas → Luteimonas viscosa | 536 | Open in IMG/M |
| 3300018482|Ga0066669_11632085 | Not Available | 590 | Open in IMG/M |
| 3300019875|Ga0193701_1071658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 682 | Open in IMG/M |
| 3300020002|Ga0193730_1157117 | Not Available | 596 | Open in IMG/M |
| 3300020579|Ga0210407_10106734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2132 | Open in IMG/M |
| 3300020581|Ga0210399_10171770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1797 | Open in IMG/M |
| 3300021171|Ga0210405_10096683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2330 | Open in IMG/M |
| 3300021362|Ga0213882_10284082 | Not Available | 689 | Open in IMG/M |
| 3300021363|Ga0193699_10105178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1142 | Open in IMG/M |
| 3300021374|Ga0213881_10057069 | Not Available | 1658 | Open in IMG/M |
| 3300021403|Ga0210397_10088782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2064 | Open in IMG/M |
| 3300021404|Ga0210389_10034145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3908 | Open in IMG/M |
| 3300021406|Ga0210386_11140395 | Not Available | 661 | Open in IMG/M |
| 3300021420|Ga0210394_11136321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 673 | Open in IMG/M |
| 3300021432|Ga0210384_11371667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 612 | Open in IMG/M |
| 3300021477|Ga0210398_10408232 | Not Available | 1107 | Open in IMG/M |
| 3300021477|Ga0210398_10930893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 695 | Open in IMG/M |
| 3300021478|Ga0210402_11381318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 631 | Open in IMG/M |
| 3300021560|Ga0126371_10237800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1932 | Open in IMG/M |
| 3300021560|Ga0126371_11133305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 921 | Open in IMG/M |
| 3300021560|Ga0126371_12892129 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300021560|Ga0126371_13154839 | Not Available | 558 | Open in IMG/M |
| 3300022756|Ga0222622_11050182 | Not Available | 599 | Open in IMG/M |
| 3300024271|Ga0224564_1031078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Actinophytocola → unclassified Actinophytocola → Actinophytocola sp. | 1002 | Open in IMG/M |
| 3300024283|Ga0247670_1032508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 936 | Open in IMG/M |
| 3300025898|Ga0207692_10339779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes | 923 | Open in IMG/M |
| 3300025906|Ga0207699_10002517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8651 | Open in IMG/M |
| 3300025906|Ga0207699_11140731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 577 | Open in IMG/M |
| 3300025907|Ga0207645_11146041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 523 | Open in IMG/M |
| 3300025910|Ga0207684_10173397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1859 | Open in IMG/M |
| 3300025916|Ga0207663_10578957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 880 | Open in IMG/M |
| 3300025918|Ga0207662_10553700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 797 | Open in IMG/M |
| 3300025922|Ga0207646_11252146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes | 649 | Open in IMG/M |
| 3300025924|Ga0207694_10666675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 877 | Open in IMG/M |
| 3300025927|Ga0207687_10452216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1065 | Open in IMG/M |
| 3300025929|Ga0207664_11726017 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300025949|Ga0207667_11271331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 713 | Open in IMG/M |
| 3300026067|Ga0207678_11745841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 546 | Open in IMG/M |
| 3300026552|Ga0209577_10792393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 530 | Open in IMG/M |
| 3300027080|Ga0208237_1031382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 802 | Open in IMG/M |
| 3300027307|Ga0209327_1014082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1025 | Open in IMG/M |
| 3300027568|Ga0208042_1062458 | Not Available | 948 | Open in IMG/M |
| 3300027671|Ga0209588_1156918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 719 | Open in IMG/M |
| 3300027765|Ga0209073_10456405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 532 | Open in IMG/M |
| 3300027825|Ga0209039_10010933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5250 | Open in IMG/M |
| 3300027853|Ga0209274_10705141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 521 | Open in IMG/M |
| 3300027874|Ga0209465_10419471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 670 | Open in IMG/M |
| 3300027875|Ga0209283_10975751 | Not Available | 507 | Open in IMG/M |
| 3300027884|Ga0209275_10909389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 507 | Open in IMG/M |
| 3300027903|Ga0209488_10060545 | All Organisms → cellular organisms → Bacteria | 2797 | Open in IMG/M |
| 3300027986|Ga0209168_10353538 | Not Available | 718 | Open in IMG/M |
| 3300028015|Ga0265353_1016805 | Not Available | 695 | Open in IMG/M |
| 3300028138|Ga0247684_1084671 | Not Available | 526 | Open in IMG/M |
| 3300028536|Ga0137415_10641389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 874 | Open in IMG/M |
| 3300028799|Ga0307284_10213432 | Not Available | 761 | Open in IMG/M |
| 3300028828|Ga0307312_10752760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes | 645 | Open in IMG/M |
| 3300028906|Ga0308309_10029094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3764 | Open in IMG/M |
| 3300030494|Ga0310037_10372621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 596 | Open in IMG/M |
| 3300031525|Ga0302326_10715289 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1461 | Open in IMG/M |
| 3300031543|Ga0318516_10206368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1135 | Open in IMG/M |
| 3300031543|Ga0318516_10890669 | Not Available | 501 | Open in IMG/M |
| 3300031544|Ga0318534_10049830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2341 | Open in IMG/M |
| 3300031544|Ga0318534_10479568 | Not Available | 711 | Open in IMG/M |
| 3300031546|Ga0318538_10331580 | Not Available | 821 | Open in IMG/M |
| 3300031546|Ga0318538_10632341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 581 | Open in IMG/M |
| 3300031564|Ga0318573_10734797 | Not Available | 530 | Open in IMG/M |
| 3300031573|Ga0310915_10287116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1161 | Open in IMG/M |
| 3300031573|Ga0310915_10574865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 799 | Open in IMG/M |
| 3300031640|Ga0318555_10126461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1360 | Open in IMG/M |
| 3300031668|Ga0318542_10084423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1510 | Open in IMG/M |
| 3300031668|Ga0318542_10254282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 894 | Open in IMG/M |
| 3300031681|Ga0318572_10982518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Qaidamihabitans → Qaidamihabitans albus | 501 | Open in IMG/M |
| 3300031682|Ga0318560_10095700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1531 | Open in IMG/M |
| 3300031708|Ga0310686_107113940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora | 1130 | Open in IMG/M |
| 3300031713|Ga0318496_10121406 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1414 | Open in IMG/M |
| 3300031713|Ga0318496_10173648 | Not Available | 1181 | Open in IMG/M |
| 3300031713|Ga0318496_10676769 | Not Available | 569 | Open in IMG/M |
| 3300031719|Ga0306917_10738893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 773 | Open in IMG/M |
| 3300031723|Ga0318493_10769459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 541 | Open in IMG/M |
| 3300031724|Ga0318500_10210513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 934 | Open in IMG/M |
| 3300031724|Ga0318500_10474738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium simiae complex → Mycobacterium stomatepiae | 627 | Open in IMG/M |
| 3300031736|Ga0318501_10352371 | Not Available | 791 | Open in IMG/M |
| 3300031748|Ga0318492_10132242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1248 | Open in IMG/M |
| 3300031748|Ga0318492_10420049 | Not Available | 704 | Open in IMG/M |
| 3300031751|Ga0318494_10074059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1839 | Open in IMG/M |
| 3300031751|Ga0318494_10285334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 950 | Open in IMG/M |
| 3300031751|Ga0318494_10356997 | Not Available | 846 | Open in IMG/M |
| 3300031751|Ga0318494_10593280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 647 | Open in IMG/M |
| 3300031751|Ga0318494_10912398 | Not Available | 515 | Open in IMG/M |
| 3300031764|Ga0318535_10512867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 532 | Open in IMG/M |
| 3300031765|Ga0318554_10156615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1294 | Open in IMG/M |
| 3300031765|Ga0318554_10827458 | Not Available | 517 | Open in IMG/M |
| 3300031769|Ga0318526_10380257 | Not Available | 577 | Open in IMG/M |
| 3300031771|Ga0318546_10026009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3428 | Open in IMG/M |
| 3300031771|Ga0318546_10392613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 968 | Open in IMG/M |
| 3300031771|Ga0318546_10642777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 746 | Open in IMG/M |
| 3300031778|Ga0318498_10107144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1268 | Open in IMG/M |
| 3300031778|Ga0318498_10156777 | Not Available | 1036 | Open in IMG/M |
| 3300031778|Ga0318498_10507917 | Not Available | 530 | Open in IMG/M |
| 3300031781|Ga0318547_10174438 | All Organisms → cellular organisms → Bacteria | 1275 | Open in IMG/M |
| 3300031781|Ga0318547_10232554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1108 | Open in IMG/M |
| 3300031782|Ga0318552_10307405 | Not Available | 806 | Open in IMG/M |
| 3300031782|Ga0318552_10316277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 794 | Open in IMG/M |
| 3300031793|Ga0318548_10153603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1123 | Open in IMG/M |
| 3300031793|Ga0318548_10401808 | Not Available | 672 | Open in IMG/M |
| 3300031795|Ga0318557_10290280 | Not Available | 750 | Open in IMG/M |
| 3300031796|Ga0318576_10525316 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300031796|Ga0318576_10631355 | Not Available | 504 | Open in IMG/M |
| 3300031798|Ga0318523_10045736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2042 | Open in IMG/M |
| 3300031798|Ga0318523_10645721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 520 | Open in IMG/M |
| 3300031799|Ga0318565_10216720 | Not Available | 931 | Open in IMG/M |
| 3300031805|Ga0318497_10848319 | Not Available | 512 | Open in IMG/M |
| 3300031819|Ga0318568_10142428 | All Organisms → cellular organisms → Bacteria | 1461 | Open in IMG/M |
| 3300031819|Ga0318568_10373069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 888 | Open in IMG/M |
| 3300031819|Ga0318568_10515516 | Not Available | 745 | Open in IMG/M |
| 3300031819|Ga0318568_10780361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 593 | Open in IMG/M |
| 3300031819|Ga0318568_10963665 | Not Available | 527 | Open in IMG/M |
| 3300031821|Ga0318567_10346412 | Not Available | 840 | Open in IMG/M |
| 3300031823|Ga0307478_10960207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 715 | Open in IMG/M |
| 3300031831|Ga0318564_10073208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium | 1510 | Open in IMG/M |
| 3300031831|Ga0318564_10336939 | Not Available | 663 | Open in IMG/M |
| 3300031832|Ga0318499_10044164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1650 | Open in IMG/M |
| 3300031835|Ga0318517_10296819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 730 | Open in IMG/M |
| 3300031835|Ga0318517_10343673 | Not Available | 674 | Open in IMG/M |
| 3300031835|Ga0318517_10503894 | Not Available | 545 | Open in IMG/M |
| 3300031845|Ga0318511_10359537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 663 | Open in IMG/M |
| 3300031846|Ga0318512_10031774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2267 | Open in IMG/M |
| 3300031846|Ga0318512_10437175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 660 | Open in IMG/M |
| 3300031859|Ga0318527_10291329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 695 | Open in IMG/M |
| 3300031890|Ga0306925_11062360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 821 | Open in IMG/M |
| 3300031890|Ga0306925_12136215 | Not Available | 523 | Open in IMG/M |
| 3300031893|Ga0318536_10260215 | Not Available | 882 | Open in IMG/M |
| 3300031893|Ga0318536_10546204 | Not Available | 581 | Open in IMG/M |
| 3300031894|Ga0318522_10020573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2138 | Open in IMG/M |
| 3300031894|Ga0318522_10152836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 870 | Open in IMG/M |
| 3300031896|Ga0318551_10169583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1198 | Open in IMG/M |
| 3300031896|Ga0318551_10285164 | Not Available | 927 | Open in IMG/M |
| 3300031897|Ga0318520_10074478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1850 | Open in IMG/M |
| 3300031897|Ga0318520_10279252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1002 | Open in IMG/M |
| 3300031897|Ga0318520_10382686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 858 | Open in IMG/M |
| 3300031897|Ga0318520_10817812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 585 | Open in IMG/M |
| 3300031912|Ga0306921_11037105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 923 | Open in IMG/M |
| 3300031912|Ga0306921_12536187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 531 | Open in IMG/M |
| 3300031942|Ga0310916_10248134 | All Organisms → cellular organisms → Bacteria | 1500 | Open in IMG/M |
| 3300031942|Ga0310916_10642720 | Not Available | 900 | Open in IMG/M |
| 3300031945|Ga0310913_10388313 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
| 3300031945|Ga0310913_10691518 | Not Available | 721 | Open in IMG/M |
| 3300031946|Ga0310910_11045151 | Not Available | 637 | Open in IMG/M |
| 3300031954|Ga0306926_12222990 | Not Available | 610 | Open in IMG/M |
| 3300031959|Ga0318530_10169651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 891 | Open in IMG/M |
| 3300031981|Ga0318531_10356936 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300032001|Ga0306922_11495047 | Not Available | 675 | Open in IMG/M |
| 3300032008|Ga0318562_10389435 | Not Available | 810 | Open in IMG/M |
| 3300032008|Ga0318562_10393455 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300032008|Ga0318562_10721696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 572 | Open in IMG/M |
| 3300032008|Ga0318562_10902478 | Not Available | 504 | Open in IMG/M |
| 3300032009|Ga0318563_10070766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1812 | Open in IMG/M |
| 3300032010|Ga0318569_10274904 | Not Available | 783 | Open in IMG/M |
| 3300032010|Ga0318569_10556043 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300032025|Ga0318507_10066879 | Not Available | 1450 | Open in IMG/M |
| 3300032039|Ga0318559_10186436 | Not Available | 951 | Open in IMG/M |
| 3300032041|Ga0318549_10231510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae → Kineosporia | 831 | Open in IMG/M |
| 3300032041|Ga0318549_10539619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 524 | Open in IMG/M |
| 3300032042|Ga0318545_10244106 | Not Available | 645 | Open in IMG/M |
| 3300032044|Ga0318558_10282395 | Not Available | 820 | Open in IMG/M |
| 3300032052|Ga0318506_10044869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1762 | Open in IMG/M |
| 3300032054|Ga0318570_10159209 | Not Available | 1012 | Open in IMG/M |
| 3300032055|Ga0318575_10043865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2023 | Open in IMG/M |
| 3300032055|Ga0318575_10269251 | Not Available | 861 | Open in IMG/M |
| 3300032059|Ga0318533_10074972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2298 | Open in IMG/M |
| 3300032059|Ga0318533_10351822 | Not Available | 1073 | Open in IMG/M |
| 3300032059|Ga0318533_10918679 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300032060|Ga0318505_10323531 | Not Available | 728 | Open in IMG/M |
| 3300032063|Ga0318504_10325042 | Not Available | 730 | Open in IMG/M |
| 3300032064|Ga0318510_10482867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 535 | Open in IMG/M |
| 3300032066|Ga0318514_10095233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium | 1503 | Open in IMG/M |
| 3300032066|Ga0318514_10383446 | Not Available | 745 | Open in IMG/M |
| 3300032066|Ga0318514_10477574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 663 | Open in IMG/M |
| 3300032067|Ga0318524_10331917 | Not Available | 788 | Open in IMG/M |
| 3300032089|Ga0318525_10170196 | Not Available | 1119 | Open in IMG/M |
| 3300032094|Ga0318540_10426974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 640 | Open in IMG/M |
| 3300032180|Ga0307471_102567657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 645 | Open in IMG/M |
| 3300032261|Ga0306920_101952767 | Not Available | 823 | Open in IMG/M |
| 3300032261|Ga0306920_103701817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 561 | Open in IMG/M |
| 3300032783|Ga0335079_10153248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2584 | Open in IMG/M |
| 3300032828|Ga0335080_12410640 | Not Available | 501 | Open in IMG/M |
| 3300032829|Ga0335070_11631257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 586 | Open in IMG/M |
| 3300032892|Ga0335081_10048297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6692 | Open in IMG/M |
| 3300032895|Ga0335074_10906743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 797 | Open in IMG/M |
| 3300032896|Ga0335075_11250720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 639 | Open in IMG/M |
| 3300033158|Ga0335077_11829958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 569 | Open in IMG/M |
| 3300033289|Ga0310914_10928734 | Not Available | 770 | Open in IMG/M |
| 3300033289|Ga0310914_11057067 | Not Available | 712 | Open in IMG/M |
| 3300033289|Ga0310914_11873395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 504 | Open in IMG/M |
| 3300033290|Ga0318519_10018084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3090 | Open in IMG/M |
| 3300034817|Ga0373948_0096381 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 692 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 40.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.92% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.60% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.29% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.77% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.52% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.20% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.89% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.57% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.57% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.26% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.26% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.94% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.94% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.94% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.94% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.63% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.63% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.63% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.63% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.63% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.63% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.63% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.63% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.31% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.31% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.31% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.31% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.31% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.31% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.31% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.31% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.31% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.31% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.31% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.31% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.31% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.31% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.31% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.31% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.31% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459012 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO1O1 lysis Rhizosphere grass | Environmental | Open in IMG/M |
| 2189573001 | Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 3300003218 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010869 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Host-Associated | Open in IMG/M |
| 3300012499 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.2.yng.030610 | Environmental | Open in IMG/M |
| 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Host-Associated | Open in IMG/M |
| 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Host-Associated | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019875 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
| 3300024283 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027047 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042 (SPAdes) | Environmental | Open in IMG/M |
| 3300027080 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF009 (SPAdes) | Environmental | Open in IMG/M |
| 3300027307 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028015 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE6 | Environmental | Open in IMG/M |
| 3300028138 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25 | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| N56_06702140 | 2170459012 | Grass Soil | MMRSPAYDHTISTARADALFASSLQRSDQPTPAQVHQAIAAALV |
| FD2_06479600 | 2189573001 | Grass Soil | MPSAPYHLSISAARADALFASPLQRSDEPSARQVGQAIATAIAAYGVRAARRGPR |
| JGI26339J46600_100986722 | 3300003218 | Bog Forest Soil | MRSAFYDPSMSAARADALFASTLQRSDEPSAMQVKQAIAAATRAFGD |
| Ga0066395_102052251 | 3300004633 | Tropical Forest Soil | MPSAPYNLSISAARADALFASPLQRSDEPSARQVRQAIATAIAAYGARGAPESCW* |
| Ga0066395_110033222 | 3300004633 | Tropical Forest Soil | MPSAPYHLSSTAVRADALFASPLQRSYEPSARQVRQAIAAAISA |
| Ga0070692_113553111 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MPSAPYVLSISAGRAGALFASPLQRSDEPSARQVQRAIATAI |
| Ga0070659_1001179914 | 3300005366 | Corn Rhizosphere | MWSVHYDLSIDTARADALFASVLQISDAPSAVQVIQAIDA |
| Ga0070714_1021295522 | 3300005435 | Agricultural Soil | MWSVHYDLSIDTARADALFASVLQISDAPSAVQVIQAIDAATSALGDLGCA |
| Ga0070714_1024160342 | 3300005435 | Agricultural Soil | MWSMPYDLSIDTARADALFASALQISDEPSAVQVKQAIDAVTSTLGDLGCA |
| Ga0070713_1004835711 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MWSVHYDLSIDTARADALFASVLQISDAPSAVQVIQAIDAATSALGDLG |
| Ga0070711_1003699111 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MMRSPANDLTISTARADALFASPLQRSDEPTPAQVHQAIA |
| Ga0070694_1009389691 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MWSVHYDLSIDTARADALFASVLQISDAPSAVQVIQAIDAATSALGDLGCAA |
| Ga0070706_1003894581 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | DAVRSYHLISSAARAHALFASPLQRSDEPSARQIRQAIAAQTD* |
| Ga0070707_1016875492 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MPSAPYHRSISAARAGALFASPLQRSDEPSARQVRQAIATALA |
| Ga0070698_1000494911 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MRSPAYDLTISTARADALFASSLQRSDEPTPAQVHQAIAAALAAFGIQGCA |
| Ga0070698_1001979423 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MPSAPYDLGISAARAGALFASPLQRSDEPSARQVRQAIAT |
| Ga0070698_1017970561 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MRSPANDVTISTARADALFASPLQRSDQPTPAQVHQAIAAALAAFGI |
| Ga0070698_1018325432 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MPSAPYPLSISAARADALFASPLQRSDEPSARQVRQAIATAIAAYG |
| Ga0070731_102120462 | 3300005538 | Surface Soil | MPSAPYDLSISAARAAALFASPLQRSDEPSARQVRQAI |
| Ga0066700_104689743 | 3300005559 | Soil | MRSPANDLTISTARADALFASSLQRSDEPTPAQVHQAVAAALAAFGIRG |
| Ga0070761_103859181 | 3300005591 | Soil | MRSGKDHLNISTARADALFASTLQRSDDPSTAQIRQAISTAIRACGTRGCAA |
| Ga0070762_108357033 | 3300005602 | Soil | MSYHPSLSATRADALFASPLQRSGDPSAWQVRQAIAAAV |
| Ga0068856_1020603201 | 3300005614 | Corn Rhizosphere | MPSAPYDLSLSAARAGALFAAPLQRSDEPSARQVRRA |
| Ga0066903_1010874224 | 3300005764 | Tropical Forest Soil | MWSAPYDLSSDAARADALFASALQISDEPSAVQVR |
| Ga0066903_1026824021 | 3300005764 | Tropical Forest Soil | MPSAPTDLSISAARADALFASPLQRSDQPSARQVRQAIVTAIAAYGV |
| Ga0066903_1046195461 | 3300005764 | Tropical Forest Soil | MPSAPYDLRISAARADALFASPLQRSDEPSARQVRQAIATAIAAYGARGAPESCW* |
| Ga0070717_114306292 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MRSATYDLTISSAQADALFASPLQRSDEPSPVQVRQAIAAAV |
| Ga0070715_110836801 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MRSATYDPTISSARADALFASPLQRSDEPSPAQVHQAIAAAVAAFGIRGC |
| Ga0070716_1000347131 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MRSATYDPTISSARADALFASPLQRSDEPSPAQVHQAIAAAVAA |
| Ga0070712_1000779594 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MWSVPNDLSIDSARADALFASALQISDEPSAVQVKRAIDAATSTLGDLGCV |
| Ga0079222_100747863 | 3300006755 | Agricultural Soil | MPSARYDLSIGAARAGTLFASPLQRSDEPSARQVRRAIATAIGVHGVQACATRVAQAYG* |
| Ga0066660_111476412 | 3300006800 | Soil | MRSATYRLSISTARADALFASALQRSDKPSATQVGQAIAAAIREFGA |
| Ga0079221_101430483 | 3300006804 | Agricultural Soil | MWSVPNDLSIDTARADALFASVLQISDEPSAVQVKRAIDAATSALGDLGCAARVA |
| Ga0079221_102237211 | 3300006804 | Agricultural Soil | MPSGPYHLSISAARAGALFASPLQRSDEPSARQVQQAIATAIAAHGARGCAAR |
| Ga0079220_111007201 | 3300006806 | Agricultural Soil | MRSATYDLTISTARADALFASTLQRSDEPTVAQVHGAIAEALAPFGIR |
| Ga0075425_1019538412 | 3300006854 | Populus Rhizosphere | MRSPANDLTISTARADALFASPLQRSDEPSPAQVQQAIAAALAAFGIQ |
| Ga0075426_107840092 | 3300006903 | Populus Rhizosphere | MPSAPYDLSISAARAGALFASLLQRCDEPSARQVRQAIATAIA |
| Ga0075426_109074211 | 3300006903 | Populus Rhizosphere | MRSPANDLTISIARADALFASSLQRSDEPTPAQVHQAVAAALAAFG |
| Ga0075424_1027641492 | 3300006904 | Populus Rhizosphere | MRYAPYDLSLDTDRADALFASSLQRSDRPSATQIRQAIVTA |
| Ga0102924_11578571 | 3300007982 | Iron-Sulfur Acid Spring | MMRSGTNHLSISTARADALFASTLQRCDDPSTAQIRQAISTAIRAFGARGCAAQVAQAY |
| Ga0105251_101401111 | 3300009011 | Switchgrass Rhizosphere | MRSATSDLTISTARADALFASPLQRSEAPSPAQVHQAIAAAVAA |
| Ga0066710_1042526982 | 3300009012 | Grasslands Soil | MWSAPYDLSIDNARADALFASALQISDEPSAVQVKQAIDAATSNLGDLGC |
| Ga0105240_106711084 | 3300009093 | Corn Rhizosphere | MRSATSDLTISTARADALFASPLQRSDEPTPAQVHQAIATAL |
| Ga0066709_1031586692 | 3300009137 | Grasslands Soil | MWSAPYDLSIDTARADALFASALQMSDEPSAVQVKHAIDA |
| Ga0116218_14977021 | 3300009522 | Peatlands Soil | MRSAPYDLSRSAARADALFASTLQRSDDPSPVQVKQAIAA |
| Ga0116221_15393621 | 3300009523 | Peatlands Soil | MRSATYDLNISTARADALFASVLQRSDEPSAAQVDQAIAAAVTT |
| Ga0116217_102476731 | 3300009700 | Peatlands Soil | MRSAPFDLSMSAAWAAALFASTLQRSDEPSAVQVKQAVAAATRA |
| Ga0126374_101001661 | 3300009792 | Tropical Forest Soil | MPSAPYDLGISAARADALFAPPLQRSDEPSARQVRLAIATAIAAYGMQGCATQLAQDYRTSA* |
| Ga0126374_107296902 | 3300009792 | Tropical Forest Soil | MWSVHYDLSIDTARADALFASVLQISDAPSAMQVKQAIDAATSALGDLGCAA |
| Ga0116219_102471561 | 3300009824 | Peatlands Soil | MRSAPCDRSTSAARADALFASTLQRSDEPSAVQVKQAIAAA |
| Ga0116223_104970191 | 3300009839 | Peatlands Soil | MRSATGHLSTGTAQADALFASALQRSDQASAVQVRE |
| Ga0126380_105274051 | 3300010043 | Tropical Forest Soil | MPSAPTDLSISAARADALFASPLQRSDQPSARQVRQAIVTAIAAYGVRGRAARV |
| Ga0126384_103533792 | 3300010046 | Tropical Forest Soil | MWSVHYDLSTDTARADALFASVLQISDAPSAMQVKQAIDAATSALGDLGC |
| Ga0134082_102431272 | 3300010303 | Grasslands Soil | MRSPTYDLTISTARADALFASPLQRSDEPTPAQVHQAIAA |
| Ga0134063_107437411 | 3300010335 | Grasslands Soil | MMRSPATDLTISTARADALFASSLQRSDEPGPAQVHQAIA |
| Ga0074046_107122352 | 3300010339 | Bog Forest Soil | MRSAPYDLSRSAARADALFASTLQRSDEPSAAQVKQAIAAA |
| Ga0074045_102095581 | 3300010341 | Bog Forest Soil | MPSVPHDLSISAARAGALFASPLQRSDEPSARQVRQAIATATGAHGVRG |
| Ga0126370_109911592 | 3300010358 | Tropical Forest Soil | MWSAPYDLSIDTARADALFASALQISDDPSAVQVKQAIDVATSTLGGLGC |
| Ga0126376_111236953 | 3300010359 | Tropical Forest Soil | MRSATYDLTISTTRADALFASPLQRSDEPSPAQVHQAIAAAVAAFGIKG |
| Ga0126378_131402521 | 3300010361 | Tropical Forest Soil | MMRSTTHHLSISTARADALFVSAVQRSEEPGAVQVRAAIAA |
| Ga0105239_102743502 | 3300010375 | Corn Rhizosphere | MRSATNHISISTARADALFASALQRSDEPSAAQVRQAIA |
| Ga0126381_1023749271 | 3300010376 | Tropical Forest Soil | MRSATYDSSISTVRAEALFASALQRSDEPSAEQVGQAIAA |
| Ga0126381_1029643901 | 3300010376 | Tropical Forest Soil | MQSATYHLSIVAARADALFVSTLQRSDEPSTEQVRQAI |
| Ga0136449_1006366033 | 3300010379 | Peatlands Soil | MPSAPYHLSISATQAGALFASPLQRSDEPSASQVRRAIATAIGVHGVRGCAA |
| Ga0126383_125182951 | 3300010398 | Tropical Forest Soil | MRSATYHLSISTARADALFASALQRSGDPGAAQVREAIATT |
| Ga0134121_106865812 | 3300010401 | Terrestrial Soil | MPSAPYVLSISVGRAGALFASPLQRSDEPSPRQVQRAIATAIGVYGVRDCAARVAQ |
| Ga0126359_16175992 | 3300010869 | Boreal Forest Soil | MPSARHDLSIGAARAGTLFASPLQRSDEPAVRSARLKPSGTKS |
| Ga0151490_14545222 | 3300011107 | Soil | MPSVPYDLSISAARAGALFASPLQRSDKPSARQVRQAIAT |
| Ga0137388_117671681 | 3300012189 | Vadose Zone Soil | MWSAPYDLSIDAARADALFASALQCSDEPSAVQVRQAIAAAS |
| Ga0137383_112354581 | 3300012199 | Vadose Zone Soil | MPSAPYDLSISAARADALFASPLQRSDEPSARQVRQAI |
| Ga0137382_106709492 | 3300012200 | Vadose Zone Soil | MWSVHSDLSIDTARADALFASTLQISDAPSAVQVKQAIDAA |
| Ga0137362_114595881 | 3300012205 | Vadose Zone Soil | MMRSPAYDLTISAARADALFASPLQRSDRPGPAQVHQAIAAAV |
| Ga0137380_100140492 | 3300012206 | Vadose Zone Soil | MSSAPYDLSISAARTGALFASPLQHSDEPSARQIRQVIATAIGV* |
| Ga0137379_100234648 | 3300012209 | Vadose Zone Soil | MRSATYDLTISSARADALFASPLQRSDEPSPAQVHQAIAAAVAAFG |
| Ga0137387_104570642 | 3300012349 | Vadose Zone Soil | MWSAPYDLSIDAARADALFASALQSADEPSAVQVR |
| Ga0137387_111113811 | 3300012349 | Vadose Zone Soil | MPSAPYDLSISAARAGALFASPLQRSDEPSARQVRRAIATAIG |
| Ga0137386_100131507 | 3300012351 | Vadose Zone Soil | MSSAPYDLSISASRTSALFASPLQHSDEPSARQIRQVIATAIGV* |
| Ga0137366_100112388 | 3300012354 | Vadose Zone Soil | MWSAPYDLSIDAARADALFASALQSSDEPSAVQVRQAIAAVS |
| Ga0137366_105576451 | 3300012354 | Vadose Zone Soil | MPSAPYDLSISAARAGALFASPLQRSDEPSARQVRRAIATAIGIHGV |
| Ga0137366_108196872 | 3300012354 | Vadose Zone Soil | MNHFSTSAVRTDALFASALQRSDKPSATQVREAIAAAVRQFGGRG |
| Ga0137385_103258822 | 3300012359 | Vadose Zone Soil | MPSAPYDLSISAARADALFASPLQRSDEPSARQVRQAITTAIAAYGVRG |
| Ga0137385_115955151 | 3300012359 | Vadose Zone Soil | MRPAPYDLSISAARASAPFASPLQRPDEPGARQIRRAIAAVIGVCGVRGCAA |
| Ga0137385_116669422 | 3300012359 | Vadose Zone Soil | MPSAPYDLSIGAARAGALFASPLQRSDEPSAGQVRRAIATAIGVHGVRGC |
| Ga0157319_10245821 | 3300012497 | Arabidopsis Rhizosphere | MRSATSDLTISTARADALFASPLQRSDAPSPAQVHQAIAAA |
| Ga0157350_10074271 | 3300012499 | Unplanted Soil | MRSATSDLTISTARADALFASPLQRSDAPSPAQVHQAIAAAA* |
| Ga0157316_10079101 | 3300012510 | Arabidopsis Rhizosphere | MRSATSDLTVSTARADALFASPLQRSDQPSPAQVHQAIAAA |
| Ga0157326_10992802 | 3300012513 | Arabidopsis Rhizosphere | MRSATSDLTISTARADALFASPLQRSDAPSPAQVHQAIAAALATFGIR |
| Ga0137397_102508942 | 3300012685 | Vadose Zone Soil | MMSSAPYDLSISAARAGALFASPLQRSDEPSARQVRQAIATAIGVH |
| Ga0157302_101902441 | 3300012915 | Soil | MRSATSDLTISTARADALFASPLQRSEAPSPAQVHQAIAAAVAAFA |
| Ga0164298_109286312 | 3300012955 | Soil | MWSVHYDLSIDTARADALFASALQISDEPSAVQVKRAIDAATSAL |
| Ga0126369_119560913 | 3300012971 | Tropical Forest Soil | MPSAPTDLSISAARADALFASPLQRSDQPSARQVR |
| Ga0164309_115361052 | 3300012984 | Soil | MPATTSHLSISAARADALFASVLQRSDEPSSEQVRQAIAAAVRAFGTR |
| Ga0164304_105476971 | 3300012986 | Soil | MSSALYDLSISAARAGALFASPLQRSDEPSAEQVQRAI |
| Ga0157370_110810721 | 3300013104 | Corn Rhizosphere | MRSATNHISISTARADALFASALQRSDEPSAAQVRQAIAAAIRAFGAR |
| Ga0137412_112557132 | 3300015242 | Vadose Zone Soil | MRSATYELSIPAVRADALFASALQQSDEPTAAQVEQAVIA |
| Ga0182005_11946071 | 3300015265 | Rhizosphere | MWSVHYDLSTDTARADALFASVLQISDAPSAVQVKQAIDAATSTLGDLGCAA |
| Ga0132258_128533491 | 3300015371 | Arabidopsis Rhizosphere | MWSVHYDLSIDTARADALFASVLQISDAPSAVQVIQAIDAATSALGDLGCAARV |
| Ga0182036_114132081 | 3300016270 | Soil | MWSAPCDLSIDTARADALFASVLQISDEPSAVQVKQAIDAVTSTL |
| Ga0182033_100670191 | 3300016319 | Soil | MPSAPYLSISAVRAGALFASPLQRSDEPSPRQVRQAIATAIGIYG |
| Ga0182033_108994972 | 3300016319 | Soil | MQSATYHLSITTARTDALFVSPLQRTDDPGAEQVRQAIVAAVRAFG |
| Ga0182032_102001933 | 3300016357 | Soil | MPSAPYHLSSSATRADALFASPLQRSGEPSASQVRQ |
| Ga0182034_109718111 | 3300016371 | Soil | MRSAPYDPSISAARAGALFASALQRSDEPSAKQVKQAITASIGAF |
| Ga0182034_113784372 | 3300016371 | Soil | MWSAPYDLSIDTARADALFASALQISDDPSAGQVKQAIDAATSTLG |
| Ga0182037_104480321 | 3300016404 | Soil | MRSAAHHLSISTARAEGLFASALQRSDDPRAAQVQQAIA |
| Ga0182037_117851461 | 3300016404 | Soil | MRSALYDLSQSAARADALFASALQRSDEPSARQVEQAV |
| Ga0182037_121665651 | 3300016404 | Soil | MRSATYDSSISTVRAEALFASALQRSDEPSTEQVEWAIAAAVR |
| Ga0182039_104948772 | 3300016422 | Soil | MWSAPCDLSIDTARADALFASALQISDEPSAVQVKQAIDAAT |
| Ga0182038_110488312 | 3300016445 | Soil | MRSAAHHLSISTARAEALFASALQRSDDPSAAQVQQAIAAAVRAFGT |
| Ga0182038_116146621 | 3300016445 | Soil | MRSTTYDLTISTARADALFASALQRSDQPSAAQVHQA |
| Ga0182038_121540262 | 3300016445 | Soil | MRSATYDLTISTARADALFASPLQRSDQPTVAEVHQAIAAALAAFGI |
| Ga0187806_12446561 | 3300017928 | Freshwater Sediment | MRSTTYHLSISTARADALFISPLQRSEQPSATQVRQA |
| Ga0187809_102454531 | 3300017937 | Freshwater Sediment | MWSVHYDLSIDTARADALFASVLQISDAPSAVQVIQAID |
| Ga0187819_100165621 | 3300017943 | Freshwater Sediment | MRSAPCHLSMSAAQADALFASTLQRSDEPSAVQVKQAIAAATRAYG |
| Ga0187817_103951162 | 3300017955 | Freshwater Sediment | MRSAPCHLSMSAAQADALFASTLQRSDEPSAVQVKQAIAAA |
| Ga0187817_106545302 | 3300017955 | Freshwater Sediment | MLSGPHDLSISAARAGALFASPLQRSDEPTARQVRQAIATTIG |
| Ga0187783_113734592 | 3300017970 | Tropical Peatland | MRSATYDLTISTVRADALFASALQRSDDPTANQVRQAI |
| Ga0187781_110784592 | 3300017972 | Tropical Peatland | MRSTPFDLSISTARADALFASALQRSDEPSALQVRQAIA |
| Ga0187777_101245033 | 3300017974 | Tropical Peatland | MRSAPYDVSVSAIRADALFASALQCSDQPSAVQVKQAIAAATLALGDLGC |
| Ga0187805_103650951 | 3300018007 | Freshwater Sediment | MRSATYHLSITTARADALFASTLQRSDQPSAGQIHQAIAAAVR |
| Ga0187851_100738484 | 3300018046 | Peatland | MRSATYHLSISTARADALFASALQRSDEPSAAQVGQAIAAAIRKF |
| Ga0187766_112954892 | 3300018058 | Tropical Peatland | MRSATYHLSISTARADALFASALQRSDRPSPVQVH |
| Ga0066655_112111511 | 3300018431 | Grasslands Soil | MWSAPYDLSLDTDRADALFASALQRSEQPSAAQIRQAI |
| Ga0066669_116320851 | 3300018482 | Grasslands Soil | MWSVPNDLSIDTARADALFASALQISDEPSAVQVKRAIDAATSTLGDLGCVARV |
| Ga0193701_10716583 | 3300019875 | Soil | MRSATSDLTISTARADALFASPLQRSDEPTPAQVHQAIATALATFG |
| Ga0193730_11571171 | 3300020002 | Soil | MSSAPYDLSISAARTGALFASPLQRSDEPSARQIRQA |
| Ga0210407_101067341 | 3300020579 | Soil | MRSPANDLTISTARADALFASSLQRSDEPTPAQVHQAVAA |
| Ga0210399_101717701 | 3300020581 | Soil | MWSVPNDLSIDTARADALFASALQISDEPSPVQVKRAIDAATSALGD |
| Ga0210405_100966831 | 3300021171 | Soil | MRSTAYHLSISTARADALFVSALQRSDEPSTTQIRQAIAATIREYGARGC |
| Ga0213882_102840822 | 3300021362 | Exposed Rock | MWSAPYDLSIDAARADALFASALQISDHPSPVQVK |
| Ga0193699_101051781 | 3300021363 | Soil | MSSAPYDLSISAARAGALFASPLQRSDEPSVRQVREAIATAIGVH |
| Ga0213881_100570691 | 3300021374 | Exposed Rock | MRSATYDLTISTARADALFASPLQRSDQPTAAQVGQAI |
| Ga0210397_100887824 | 3300021403 | Soil | MWSVPYDLSIDTARADALFASALQISDEPNAVQVKR |
| Ga0210389_100341454 | 3300021404 | Soil | MRSATSDLTISTARADALFASPLQRSDAPSPAQVHQ |
| Ga0210386_111403952 | 3300021406 | Soil | MRSAVLELSISAVQADALFASALQRSDQPDAGQVRQAIAAAISELGDTGCA |
| Ga0210394_111363212 | 3300021420 | Soil | MWSVPNDLSIDTARADALFASALQISDEPSAMQVKR |
| Ga0210384_113716672 | 3300021432 | Soil | MWSVPCDLSIDTARADALFASALQISDEPSPVQVKRAIDAATSALGD |
| Ga0210398_104082321 | 3300021477 | Soil | MSYHPSLSATRADALFASPLQRSGDPSAWQVRQAIAAAVAAYG |
| Ga0210398_109308933 | 3300021477 | Soil | MRSATYDLTTSTARADALFASSLQRSDQPTVAQVHGAIAAALAAFG |
| Ga0210402_113813181 | 3300021478 | Soil | MWSVPCDLSIDTARADALFASALQISDEPSPVQVKRAID |
| Ga0126371_102378002 | 3300021560 | Tropical Forest Soil | PTSQGTRDAVRSYDLRISAARADALFASPLQRSDEPSARQVRQAIATAIAAYGARGAPESCW |
| Ga0126371_111333051 | 3300021560 | Tropical Forest Soil | MWSAPYDLSIDTARADALFASALQISDEPSAGQVRQAIDAATSTLGDLGCAAK |
| Ga0126371_128921291 | 3300021560 | Tropical Forest Soil | MRSATYDLTISTARADALFASPLQRSDQPTVAEVHQAIAAALAA |
| Ga0126371_131548391 | 3300021560 | Tropical Forest Soil | MRSATYHLSVTAARADALFASALQRSDEPSAAQIDQAIAAAVRAFGTRGCA |
| Ga0222622_110501821 | 3300022756 | Groundwater Sediment | MRSATSDLTISTARADALFASPLQRSDEPTPAQVHQAIAT |
| Ga0224564_10310782 | 3300024271 | Soil | MRSAPYDLNMSAARADALFASTLQRSDQPTAIQVKRAITAATCA |
| Ga0247670_10325082 | 3300024283 | Soil | MWSVHYDLSIDTARADALFASVLQISDAPSAVQVIQAIDAATSALGDLGCAARVAQP |
| Ga0207692_103397791 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MWSVPNDLSIDTARADALFASALQISDEPSAVQVKRAIDAATSTLGDLGCVARVA |
| Ga0207699_100025178 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MPSAPHHLSISAARSGALFASPLQRSDEPSARQVQQAIATAMGVHG |
| Ga0207699_111407312 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MWSVHYDLSIDTARADALFASVLQISDAPSAVQVIQAIDAAT |
| Ga0207645_111460412 | 3300025907 | Miscanthus Rhizosphere | MWSVHYDLSIDTARADALFASALQISDAPSAVQVKQAIDAATRTLGDV |
| Ga0207684_101733971 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MPSAPYHLSTSAARAGALFASPLQRSDEPSARQVRQAI |
| Ga0207663_105789572 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MWSVPNDLSIDTARADALFASALQISDEPSAVQVKRA |
| Ga0207662_105537002 | 3300025918 | Switchgrass Rhizosphere | MRSATNHISISTARADALFASALQRSDEPSAAQVRQAIAAAIRAFGARGC |
| Ga0207646_112521461 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MWSVPNDLSIDTARADALFASALQISDEPSAVQVKRAIDAATSTLGDLGC |
| Ga0207694_106666752 | 3300025924 | Corn Rhizosphere | MPSAPYVLSISAGRAGALFASPLQRSDEPSPRQVQRAIATAIGVYGVRDCAAR |
| Ga0207687_104522161 | 3300025927 | Miscanthus Rhizosphere | MWSVHYDLSIDTARADALFASVLQISDAPSAVQVIQAIDAT |
| Ga0207664_117260171 | 3300025929 | Agricultural Soil | MQSATYHLSITAARADALFVSALQRSDEPSAEQVR |
| Ga0207667_112713311 | 3300025949 | Corn Rhizosphere | MWSVHYDLSIDTARADALFASVLQISDAPSAVQVIQAIDAATSALGDLGCAARVA |
| Ga0207678_117458411 | 3300026067 | Corn Rhizosphere | MPSAPYVLSISAGRAGALFASPLQRSDEPSPRQVQ |
| Ga0209577_107923931 | 3300026552 | Soil | MWSAPYDLSIDTARADALFASALQISDEPSAVQVKHAIDATTST |
| Ga0208730_10063171 | 3300027047 | Forest Soil | MRSAPCDLSADAAVTDALFASALQRSDEPSARQVEQAVAAAIRAFGELGCAAR |
| Ga0208237_10313821 | 3300027080 | Forest Soil | MSYHISLSATRVDALFASPLQRSGHPSARQVRQAIAAAVVAYG |
| Ga0209327_10140821 | 3300027307 | Forest Soil | MRSATYDLTISTARADALFASTLQRSDEPTVAQVHGAIAEAL |
| Ga0208042_10624582 | 3300027568 | Peatlands Soil | MRSATGHLSTGTAQADALFASALQRSDQASAVQVREAIATAIR |
| Ga0209588_11569183 | 3300027671 | Vadose Zone Soil | MRSATNHVSISAARADALFASALQRSDEPSAAQVRQA |
| Ga0209073_104564051 | 3300027765 | Agricultural Soil | MRSATSDLTISTARADALFASPLQRSDAPSPAQVHQAIAAAV |
| Ga0209039_100109331 | 3300027825 | Bog Forest Soil | MRSAPYDLSRSAARADALFASTLQRSDEPSAAQVKQAIAAATLAFGDLGCAAR |
| Ga0209274_107051412 | 3300027853 | Soil | MRSGKDHLNISTARADALFASTLQRSDDPSTAQIRQAISTAIRACGTRGCAAQVAQ |
| Ga0209465_104194712 | 3300027874 | Tropical Forest Soil | MPSAPYDLGISAARADALFAPPLQRSDEPSARQVRQAIATAIAAYGARGAPESCW |
| Ga0209283_109757511 | 3300027875 | Vadose Zone Soil | MRSATFNLTPSTARADALFASALQRSDEPSAAEVRQA |
| Ga0209275_109093892 | 3300027884 | Soil | MRSAVLDHSIDDTRADALFASVVQRSDEPSAGQVK |
| Ga0209488_100605451 | 3300027903 | Vadose Zone Soil | MPSAPYDLSISAAQADALFASPLQRSDEPSARQVRQAIATALAAYGVRGC |
| Ga0209168_103535381 | 3300027986 | Surface Soil | MPSEPYEPSITGVRAGALFASPLQRSDEPSARQVQQAIATLRD |
| Ga0265353_10168052 | 3300028015 | Soil | MRSATYDLTISTARADALFASALQRSDQPTVAQIHGAIAAAL |
| Ga0247684_10846712 | 3300028138 | Soil | MRSATSDLTISTARADALFASPLQRSDAPSPAQVHQA |
| Ga0137415_106413892 | 3300028536 | Vadose Zone Soil | MPSAPCDLSICAAQAGALFASPLQRSDEPSARQVRRAIATA |
| Ga0307284_102134323 | 3300028799 | Soil | MRSATSDLTTSTTRADALFASPLQRSDKPSPAQVHRAIAAAL |
| Ga0307312_107527602 | 3300028828 | Soil | MPSAPYDLGISAARADALFASPLQRSDEPSARQVRQAIATAIAVYGVRGCTARPRRTTANTPRPR |
| Ga0308309_100290941 | 3300028906 | Soil | MRSTAYHLSISTARADALFVSALQRSDEPSTTQIRQAIAATI |
| Ga0310037_103726211 | 3300030494 | Peatlands Soil | MPPPPYHLSISAARAGALFASPLQRSDEPSPRQVRQAIATAIDAHGVRGCAA |
| Ga0302326_107152891 | 3300031525 | Palsa | MRSAAVLDLSISAVRADALFASALQRSDQPSAGQVRQAVAAAIGAL |
| Ga0318516_102063681 | 3300031543 | Soil | MRSATYDPSISTVRADALFASALQPSDDPSAAQVGQAITAAVRA |
| Ga0318516_108906691 | 3300031543 | Soil | MPSTPYHLSIGAARADALFASPLQRSCEPSAGQVRQAIATTISAY |
| Ga0318534_100498305 | 3300031544 | Soil | MRSATYDLTISTARADALFASTLQPSDEPTVAQVHGAIAAAL |
| Ga0318534_104795681 | 3300031544 | Soil | MRSATYHLSISAARADALFASALQRSDEPCAAQIHQAIAAAVHA |
| Ga0318538_103315801 | 3300031546 | Soil | MPLAPYDLSISAARADALFASPLQRSDEPSARQVRQAIATAIAAYGVR |
| Ga0318538_106323411 | 3300031546 | Soil | MRSSTYDPSISTVRADALFASALQRSDNPSAAQVGQA |
| Ga0318573_107347972 | 3300031564 | Soil | MRSTTHHLSISTARADALFVSALQRSEEPSATQVREAI |
| Ga0310915_102871161 | 3300031573 | Soil | MRSTTYHLSISTARADALFVSALQRSEEPSAAQVQLAIAAAIRAFGARGCAA |
| Ga0310915_105748651 | 3300031573 | Soil | MRSATYDLTISTARADALFASPLQRSDQPTVAEIHQA |
| Ga0318555_101264614 | 3300031640 | Soil | MRSATYDLTISTARADALFASPLQRSDQPTVAEVHQ |
| Ga0318542_100844232 | 3300031668 | Soil | MPSAPYLSISAVRAGALFASPLQRSDEPSPRQVRQAIATAIGIY |
| Ga0318542_102542821 | 3300031668 | Soil | MWSAPCDLSIDTARADALFASALQISDEPSAVQVKQAIDAVT |
| Ga0318572_109825182 | 3300031681 | Soil | MRSATYDLSISTVRADALFASALQCSDEPGAVQVDQAIAAAVRA |
| Ga0318560_100957001 | 3300031682 | Soil | MRSTTYHLSISTARADALFVSALQRSEEPSAAQVQQAI |
| Ga0310686_1071139401 | 3300031708 | Soil | MRSATSRLSISAARADALFASALQRSGEPGAAQIHQAIAASV |
| Ga0318496_101214061 | 3300031713 | Soil | MQSATYHLSITTARADALFVSPLQRSDDPGAEQVRQAIVAAVRALGARG |
| Ga0318496_101736481 | 3300031713 | Soil | MRSATYHLSISAARADALFASALQRSDEPSAAQIH |
| Ga0318496_106767691 | 3300031713 | Soil | MSSAPYDLSISGVLADALFASALQRSDEPSAGQVRQATGAAIGAFGALG |
| Ga0306917_107388931 | 3300031719 | Soil | MRSAAYDLTISTARAEALFASALQRSDEPGTAQVHQAIAAA |
| Ga0318493_107694591 | 3300031723 | Soil | MRSATYHPSISTVRADALFASALQHSDEPAAAQVNQAIVA |
| Ga0318500_102105131 | 3300031724 | Soil | MWSAPYDLSIDAARADALFASALQISDEPSAVQVRQAIDVATSMLG |
| Ga0318500_104747382 | 3300031724 | Soil | MQSATYHLSITTARADALFVSPLQRSDDPGAEQVRQAIVAAVRALGARGC |
| Ga0318501_103523711 | 3300031736 | Soil | MPSTPYHLSIGAARADALFASPLQRSCEPSAGQVRQAIATTISAYGARG |
| Ga0318492_101322421 | 3300031748 | Soil | MRSGTYHLSIGTARADALFASALQRSDEPSAEQVRQAIAAAIRAEGAD |
| Ga0318492_104200491 | 3300031748 | Soil | MPSAPYHLSSSATRADALFASPLQRSGEPSASQVRQAIAKAIG |
| Ga0318494_100740591 | 3300031751 | Soil | MWSARYDLSIDTARADALFASVLQISDEPSAVQVMRAIEAATSTLG |
| Ga0318494_102853343 | 3300031751 | Soil | MRSATYDLTISTARADALFASPLQRSDQPTVAEVHQAIA |
| Ga0318494_103569972 | 3300031751 | Soil | MRSALYDLSISATRADALFASALQCSDEPSAVQVEQAIAAATLAFGDVGC |
| Ga0318494_105932802 | 3300031751 | Soil | MWSAPCDLSIDTARADALFASALQISDEPSAVQVKQAIDAVTSTLGDLG |
| Ga0318494_109123981 | 3300031751 | Soil | MRSATYDLTISTARADALFASALQRSDEPTVAQVHGA |
| Ga0318535_105128672 | 3300031764 | Soil | MRSATYDLTISTARADALFASTLQPSDEPTVAQVHGAIAAALAAFGIRG |
| Ga0318554_101566151 | 3300031765 | Soil | MRSTSYHLSISTARADALFVSALQRSEEPSAAEVQRAIAAAIREFGTQGCAA |
| Ga0318554_108274582 | 3300031765 | Soil | MRSATYHLSISAARADALFASALQRSDEPSAAQIHQAI |
| Ga0318526_103802571 | 3300031769 | Soil | MSSAPHDLSTSAARVDALFASTLQRSDEPSARQVRQAIALAVAA |
| Ga0318546_100260091 | 3300031771 | Soil | MWSAPYDLSIDAARADALFASALQISDDPSAVQVRQAIDAATSVLGDLGCA |
| Ga0318546_103926133 | 3300031771 | Soil | MMRSTTPHLSISTARADALFVSALQRSEEPSVAQVQ |
| Ga0318546_106427772 | 3300031771 | Soil | MWSAPCDLSIDTARADALFASALQISDEPSAVQVKQ |
| Ga0318498_101071442 | 3300031778 | Soil | MPSAPYHLSTSAARADALFASPLQRCHEPSAGQVRQAIAATIGVYGARGCAARAALVL |
| Ga0318498_101567773 | 3300031778 | Soil | MRSGTYHLSIGTARADALFASALQRSDEPSAEQVRQAIAAAIRAFGAR |
| Ga0318498_105079172 | 3300031778 | Soil | MRSATYDLTISTARADALFASPLQRSDQPTVAEVHQAI |
| Ga0318547_101744383 | 3300031781 | Soil | MRGPRMRSATSHFTIETAQADALFASALQHSDGPTAT |
| Ga0318547_102325543 | 3300031781 | Soil | MWSATYDLSTSTVRADALFASALQRCDEPTAAQVDQA |
| Ga0318552_103074053 | 3300031782 | Soil | MPSAPHHLPISGARANALFASPLQRSDDLSAGQARQAIATAIGAYGKRGCAARVA |
| Ga0318552_103162771 | 3300031782 | Soil | MRSATYDPSISTVRADALFASALQRSDEPGAAQVDQAIAAAVRAYGTC |
| Ga0318548_101536031 | 3300031793 | Soil | MRSGSFHLSISTARADALFASVLQRSDEPSAAQVRRAIAAAIRAFGVRGC |
| Ga0318548_104018081 | 3300031793 | Soil | MWSAQYDLSIDTARADALFASVLQISDEPSAVQVRRAIEAATST |
| Ga0318557_102902801 | 3300031795 | Soil | MSSAPYHLSICGARADALFASPLQRSYDPSAGQVRQAIATAIGAYGARGCAARV |
| Ga0318576_105253161 | 3300031796 | Soil | MRSTSYHLSISTARADALFVSALQRSEEPSGAQVQRAIAAAIREFGTQG |
| Ga0318576_106313551 | 3300031796 | Soil | MRSATYHLSISAARADALFASALQRSDEPSAAQIHQAIAAAVRAFGT |
| Ga0318523_100457361 | 3300031798 | Soil | MWSAQYDLSIDTARADALFASVLQISDEPSAVQVRRAIEAATSTLGDLG |
| Ga0318523_106457212 | 3300031798 | Soil | MRSATYHLSISATRANALFASALQRSEEPSAAQVR |
| Ga0318565_102167201 | 3300031799 | Soil | MRSATYHLSISAARADALFASALQRSDEPSAAQIYQAIAAS |
| Ga0318497_108483192 | 3300031805 | Soil | MRSATYDPSISTVRADALFASALQRSDEPSAAQVSQAIATAVRAFGARGC |
| Ga0318568_101424284 | 3300031819 | Soil | MRSATYDLTISTARADALFASPLQRSDQPTVAEVHQAIAAAL |
| Ga0318568_103730693 | 3300031819 | Soil | MMRSTTPHLSISTARADALFVSALQRSEEPSVAQV |
| Ga0318568_105155163 | 3300031819 | Soil | MRSATHDLAIGTARADALFASALQRSDQPSAVEVQRAIAAALA |
| Ga0318568_107803612 | 3300031819 | Soil | MWSAQYDLSIDAARADALFASALQISDEPSAVQVRQAIDVATSMLGGLG |
| Ga0318568_109636652 | 3300031819 | Soil | MRSGTYHLSISAARADALFASMLQRSEEPSAAQIRQAI |
| Ga0318567_103464123 | 3300031821 | Soil | MPSAPYHLSISGTRANALFASPLQRSYDPSARQVRQAIAVSGCSP |
| Ga0307478_109602071 | 3300031823 | Hardwood Forest Soil | MQSATRHLSISAVRADALFASAMQRSDKPSAAQIRRAITAAVRASG |
| Ga0318564_100732081 | 3300031831 | Soil | MWSARYDLSIDIAQADALFASVLQISDEPSAVQVMRAIEAATSTLGDLGCA |
| Ga0318564_103369391 | 3300031831 | Soil | MRSTTHYLSISTARADALFVSTLQRSEEPSAVQVQQAIAAAVRAV |
| Ga0318499_100441644 | 3300031832 | Soil | MRSATYDLTISTARADALFASSLQRSDEPTVAQVH |
| Ga0318517_102968191 | 3300031835 | Soil | MWSAPCDLSIDTARADALFASALQISDEPSAVQVKQAIDAVTSTL |
| Ga0318517_103436731 | 3300031835 | Soil | MRSTSYHLSISTARADALFVSALQRSEEPSAAQVQR |
| Ga0318517_105038942 | 3300031835 | Soil | MRSATYDLTISTARADALFASTLQRSDEPTAAQVHQAIAAALA |
| Ga0318511_103595372 | 3300031845 | Soil | MPSAPYHLSTSAARADALFASPLQRCHEPSAGQVRQAIAATIGVYGARGCAAR |
| Ga0318512_100317741 | 3300031846 | Soil | MRSTTYHLSISTARADALFVSALQRSEEPSAAQVQLAIAAAI |
| Ga0318512_104371752 | 3300031846 | Soil | MWSAPCDLSIDTARADALFASALQISDEPSAVQVKQAIDAVTST |
| Ga0318527_102913291 | 3300031859 | Soil | MSSAPHDLSTSAARVDALFASTLQRSDEPSARQVRQAIALAVAAYG |
| Ga0306925_110623601 | 3300031890 | Soil | MWSAPYDLSIDVARADALFASALQISDKPSAVQVK |
| Ga0306925_121362152 | 3300031890 | Soil | MRSTTPHLSISTARADALFVSALQRSEEPSAAQVQLAIAAA |
| Ga0318536_102602152 | 3300031893 | Soil | MSSAPYDLSISGVLADALFASALQRSDEPSAGQVRQATGAAIGAFGALGCVARVAQA |
| Ga0318536_105462041 | 3300031893 | Soil | MRSTTHHLSISTARADALFVSALQRSEEPSATQVREAIAAAIREFGARG |
| Ga0318522_100205731 | 3300031894 | Soil | MQSATYHLSITTARTDALFVSPLQRTDDPGAEQVRQ |
| Ga0318522_101528361 | 3300031894 | Soil | MRSATYDLTISTARADALFASPLQRSDQPTVAEVHQAIAAA |
| Ga0318551_101695832 | 3300031896 | Soil | MWSAPYDLSIDTARADALFASVLQISDEPSAVQVMRAIEAATSTLGD |
| Ga0318551_102851641 | 3300031896 | Soil | MSSAPYHLSICGARADALFASPLQRSYDPSAGQVRQAIATAI |
| Ga0318520_100744782 | 3300031897 | Soil | MRSATYDLSISTVRADALFASALQRSDEPSAAQVGQAIAAAVRAFGARGCA |
| Ga0318520_102792521 | 3300031897 | Soil | MPSAPYHLSTSAARADALFASPLQRCHEPSAGQVRQAIAATIGVYGARGCAARV |
| Ga0318520_103826861 | 3300031897 | Soil | MPSAPHLSISAVRAGALFASPLQRSDEPSPRQVRQAIATAIGIY |
| Ga0318520_108178122 | 3300031897 | Soil | MRSAPYDLSISAARADALFASALQRSDQPSTAQVKQAIAAATRAFGDLG |
| Ga0306921_110371051 | 3300031912 | Soil | MWSARYDLSIDTARADALFASVLQISDEPSAVQVMRAIEAATSTLGDLGCAAKVA |
| Ga0306921_125361872 | 3300031912 | Soil | MRPATYHLSIRTARADALFASALQRSDEPSEAQVRR |
| Ga0310916_102481341 | 3300031942 | Soil | MRSAPYDLSISAARADALFASALQRSDQPSTAQVKQAIAAATRAF |
| Ga0310916_106427201 | 3300031942 | Soil | MQSATYHLSITTARTDALFVSPLQRSDDPGAEQVR |
| Ga0310913_103883133 | 3300031945 | Soil | MRSALYDLSMSAARADALFASALQRSDQPSAWQVEQAVTAAIGAFGEV |
| Ga0310913_106915181 | 3300031945 | Soil | MRSGTYHLSIGTARADALFASALQRSDEPSAEQVRQAIA |
| Ga0310910_110451513 | 3300031946 | Soil | MRSATYDLTISTARADALFASPLQRSDQPTVAEIH |
| Ga0306926_122229902 | 3300031954 | Soil | MWSAPYDLSIDTARADALFASVLQISDEPSAVQVMRAIEAATSTLGDVGCAA |
| Ga0318530_101696511 | 3300031959 | Soil | MRSTTHHLSISTARADALFVSALQRSEEPSAAQVQLAIAAAIRAFGA |
| Ga0318531_103569364 | 3300031981 | Soil | MRSATYDPGISTVRADALFASALQCSDDPSAAQVGQAIAAAVRAFGAR |
| Ga0306922_114950471 | 3300032001 | Soil | MPSAPYHLSISAARADALFASPLQRSCEPSAGQVRQAIATTISAY |
| Ga0318562_103894351 | 3300032008 | Soil | MRSTTPHLSISTARADALFVSALQRSEEPSAAQVQLAI |
| Ga0318562_103934551 | 3300032008 | Soil | MRSATYDLTISTARADALFASALQRSDEPSAAQVN |
| Ga0318562_107216961 | 3300032008 | Soil | MRSATYHPSISTVRADALFASALQHSDEPAAAQVNQAIVAAVRA |
| Ga0318562_109024781 | 3300032008 | Soil | MPSAPYHLSISAARADALFASPLQRSYEPSAGQVQQAITTTVGAYGAQGCADRV |
| Ga0318563_100707663 | 3300032009 | Soil | MQSATYHLSITTARTDALFVSPLQRTDDPGAEQVRQAIVAAVRAVVMLR |
| Ga0318569_102749043 | 3300032010 | Soil | MSSAPYHLSICGARADALFASPLQRSYDPSAGQVRQAIATAIGAYGA |
| Ga0318569_105560432 | 3300032010 | Soil | MQSATYHLSITTARADALFVSPLQRSDDPGAEQVRQAIVAAVRAFGAR |
| Ga0318507_100668791 | 3300032025 | Soil | MRSATYDLSISTVRADALFASALQRSDEPSAAQVGQAIA |
| Ga0318559_101864361 | 3300032039 | Soil | MRSATYDLSISTVRADALFASALQCSDEPGAVQVDQ |
| Ga0318549_102315102 | 3300032041 | Soil | MRSATYDPSISTVRADALFASALQPSDDPSAAQVGQAI |
| Ga0318549_105396191 | 3300032041 | Soil | MRSALYDLSMSAARADALFASALQRSDQPSAWQVE |
| Ga0318545_102441061 | 3300032042 | Soil | MSSAPYHLSICGARADALFASPLQRSYDPSAGQVRQAIATAIGAYGARG |
| Ga0318558_102823951 | 3300032044 | Soil | MQSATYHLSITTARADALFVSPLQRSDDPGAEQVRQ |
| Ga0318506_100448694 | 3300032052 | Soil | MRSATYDLTISTARADALFASTLQRSDEPTAAQVH |
| Ga0318570_101592091 | 3300032054 | Soil | MWSAPYDLSIDTARADALFASVLQISDEPSAVQVMRAI |
| Ga0318575_100438651 | 3300032055 | Soil | MWSARYDLSIDTARADALFASVLQISDEPSAVQVRRAIEAATSTLG |
| Ga0318575_102692511 | 3300032055 | Soil | MPSAPYHLSSSATRADALFASPLQRSGEPSASQVRQAIAKAIGAY |
| Ga0318533_100749724 | 3300032059 | Soil | MPSAPYLSISAVRAGALFASPLQRSDEPSPRQVRQAIATAIGIYGARG |
| Ga0318533_103518222 | 3300032059 | Soil | MRGPRMRSATSHFTIETAQADALFASALQHSDGPTATQ |
| Ga0318533_109186792 | 3300032059 | Soil | MRSATYDPSIAAVRADALFASALQRSDEPSAEQVEWAIAAA |
| Ga0318505_103235311 | 3300032060 | Soil | MRSTSYHLSISTARADALFVSALQRSEEPSAAQVQRAIAAAIREFGTQGCAA |
| Ga0318504_103250423 | 3300032063 | Soil | MPSTPYHLSISGARAGALFASPLQRSDDPSAGQVRHAIATAIGAYGARGC |
| Ga0318510_104828671 | 3300032064 | Soil | MRSATYRPSISTVRADALFASALQHSDEPTAAQVNQAI |
| Ga0318514_100952333 | 3300032066 | Soil | MWSARYDLSIDIAQADALFASVLQISDEPSAVQVMRAIEAATSTLGDLGCAAKV |
| Ga0318514_103834462 | 3300032066 | Soil | MQSATYHLSITTARTDALFVSPLQRTDDPGAEQVRQAIVAAVRAVVMLRW |
| Ga0318514_104775741 | 3300032066 | Soil | MRPATYHLSIRTVRADALFASALQRSDEPSEAQVRRAIAG |
| Ga0318524_103319172 | 3300032067 | Soil | MQSATYHLSITTARTDALFVSPLQRTDDPGAEQVRQAIVAAVRAVVM |
| Ga0318525_101701964 | 3300032089 | Soil | MSSAPYHLSICGARADALFASPLQRSYDPSAGQVRQAIATAIGAYG |
| Ga0318540_104269742 | 3300032094 | Soil | MRSSTYDPSISTVRADALFASALQRSDNPSAAQVGQAIAAAVRAF |
| Ga0307471_1025676571 | 3300032180 | Hardwood Forest Soil | MWSALYDLSIDAARADALFASALQISDEPSAVQVKQAIDAA |
| Ga0306920_1019527671 | 3300032261 | Soil | MSSAPYHLSICGARADALFASPLQRSYDPSAGQVRQAIATAIGA |
| Ga0306920_1037018171 | 3300032261 | Soil | MRSVTYDPSISTVRANALFASALQPSDEPSTAQVGQAIAAAVRAFGAPGCAA |
| Ga0335079_101532484 | 3300032783 | Soil | MRSALYDLSISELSISAVRADALFVSALQSSDEPSAVQVKQAIAAATRAFGD |
| Ga0335080_124106401 | 3300032828 | Soil | MTSARYDPSVSSDRADALFASPLQRSDRPGPGQVRQAIAVA |
| Ga0335070_116312572 | 3300032829 | Soil | MWSATYDLSIDTARADALFASALQISDEPSAAAVKQAIDAVTSTL |
| Ga0335081_100482971 | 3300032892 | Soil | MWSAHNDLSIDAARADALFASALQISDEPSAVQVRQ |
| Ga0335074_109067432 | 3300032895 | Soil | MRSATYDPSISTVRADALFASALQRSDEPTAAQVDEAIAVAVRAFGAR |
| Ga0335075_112507201 | 3300032896 | Soil | MRSETSHLSISTARADALFVSALQRSEEPSAAQVRLAIVAA |
| Ga0335077_118299582 | 3300033158 | Soil | MRSAAYDLTISTARADALFASALQRSDEPSAVQVNRAVAA |
| Ga0310914_109287342 | 3300033289 | Soil | MRSATYHLSISAARADALFASALQRSDEPSAAQIHQ |
| Ga0310914_110570672 | 3300033289 | Soil | MRSAAHHLSISTARAEALFASALQRSDDPSAAQVQQAIAA |
| Ga0310914_118733951 | 3300033289 | Soil | MRSATYDLTISTARADALFASPLQRSDQPTVAEIHQAIAAALAAFGIRG |
| Ga0318519_100180841 | 3300033290 | Soil | MRSGTYHLSIGTARADALFASALQRSDEPSAEQVRQAIAA |
| Ga0373948_0096381_2_139 | 3300034817 | Rhizosphere Soil | MWSVHYDLSIDTARADALFASVLQISDAPSAVQVIQAIDAATSALG |
| ⦗Top⦘ |