| Basic Information | |
|---|---|
| Family ID | F009286 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 320 |
| Average Sequence Length | 44 residues |
| Representative Sequence | DAQYKQQIGDKQKALDDAKQKLEDMQEEARKAGVPSSVREP |
| Number of Associated Samples | 260 |
| Number of Associated Scaffolds | 320 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.04 % |
| % of genes near scaffold ends (potentially truncated) | 87.81 % |
| % of genes from short scaffolds (< 2000 bps) | 79.69 % |
| Associated GOLD sequencing projects | 237 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (80.625 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.562 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.500 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.500 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.38% β-sheet: 0.00% Coil/Unstructured: 53.62% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 320 Family Scaffolds |
|---|---|---|
| PF07606 | DUF1569 | 32.81 |
| PF12867 | DinB_2 | 19.38 |
| PF01384 | PHO4 | 2.19 |
| PF00356 | LacI | 1.25 |
| PF00691 | OmpA | 1.25 |
| PF12710 | HAD | 0.62 |
| PF00069 | Pkinase | 0.62 |
| PF00990 | GGDEF | 0.62 |
| PF00158 | Sigma54_activat | 0.62 |
| PF13414 | TPR_11 | 0.62 |
| PF13305 | TetR_C_33 | 0.62 |
| PF01019 | G_glu_transpept | 0.62 |
| PF13432 | TPR_16 | 0.62 |
| PF00081 | Sod_Fe_N | 0.62 |
| PF13620 | CarboxypepD_reg | 0.62 |
| PF14520 | HHH_5 | 0.62 |
| PF00180 | Iso_dh | 0.31 |
| PF02777 | Sod_Fe_C | 0.31 |
| PF01061 | ABC2_membrane | 0.31 |
| PF14312 | FG-GAP_2 | 0.31 |
| PF13520 | AA_permease_2 | 0.31 |
| PF01872 | RibD_C | 0.31 |
| PF02738 | MoCoBD_1 | 0.31 |
| PF02687 | FtsX | 0.31 |
| PF12838 | Fer4_7 | 0.31 |
| PF14361 | RsbRD_N | 0.31 |
| PF03413 | PepSY | 0.31 |
| PF04366 | Ysc84 | 0.31 |
| PF02873 | MurB_C | 0.31 |
| PF04185 | Phosphoesterase | 0.31 |
| PF02954 | HTH_8 | 0.31 |
| PF14559 | TPR_19 | 0.31 |
| PF04191 | PEMT | 0.31 |
| PF02566 | OsmC | 0.31 |
| PF15780 | ASH | 0.31 |
| PF05050 | Methyltransf_21 | 0.31 |
| PF00486 | Trans_reg_C | 0.31 |
| PF01243 | Putative_PNPOx | 0.31 |
| PF00440 | TetR_N | 0.31 |
| PF00149 | Metallophos | 0.31 |
| PF01869 | BcrAD_BadFG | 0.31 |
| PF13426 | PAS_9 | 0.31 |
| PF01436 | NHL | 0.31 |
| PF05690 | ThiG | 0.31 |
| PF00072 | Response_reg | 0.31 |
| COG ID | Name | Functional Category | % Frequency in 320 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.50 |
| COG0306 | Phosphate/sulfate permease | Inorganic ion transport and metabolism [P] | 2.19 |
| COG0605 | Superoxide dismutase | Inorganic ion transport and metabolism [P] | 0.94 |
| COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 0.62 |
| COG0214 | Pyridoxal 5'-phosphate synthase subunit PdxS | Coenzyme transport and metabolism [H] | 0.31 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.31 |
| COG0812 | UDP-N-acetylenolpyruvoylglucosamine reductase | Cell wall/membrane/envelope biogenesis [M] | 0.31 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.31 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.31 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.31 |
| COG2022 | Thiazole synthase ThiGH, ThiG subunit (thiamin biosynthesis) | Coenzyme transport and metabolism [H] | 0.31 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.31 |
| COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 0.31 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.31 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 80.62 % |
| Unclassified | root | N/A | 19.38 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459017|G14TP7Y02H0UNW | Not Available | 540 | Open in IMG/M |
| 2199352024|deeps__Contig_151274 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 946 | Open in IMG/M |
| 2199352024|deeps__Contig_76302 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_105786000 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1967 | Open in IMG/M |
| 3300000955|JGI1027J12803_104745562 | Not Available | 555 | Open in IMG/M |
| 3300001471|JGI12712J15308_10014310 | All Organisms → cellular organisms → Bacteria | 2116 | Open in IMG/M |
| 3300001593|JGI12635J15846_10532424 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 690 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100704158 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 888 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100856546 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 790 | Open in IMG/M |
| 3300002909|JGI25388J43891_1050332 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10290252 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 665 | Open in IMG/M |
| 3300004092|Ga0062389_101371272 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 892 | Open in IMG/M |
| 3300004152|Ga0062386_101141619 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300004479|Ga0062595_100820530 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300005167|Ga0066672_10497931 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300005187|Ga0066675_11288591 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300005332|Ga0066388_100524799 | All Organisms → cellular organisms → Bacteria | 1817 | Open in IMG/M |
| 3300005337|Ga0070682_100535817 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300005353|Ga0070669_101769678 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300005435|Ga0070714_100097180 | All Organisms → cellular organisms → Bacteria | 2588 | Open in IMG/M |
| 3300005435|Ga0070714_101003540 | Not Available | 812 | Open in IMG/M |
| 3300005436|Ga0070713_101109495 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300005445|Ga0070708_100978647 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300005445|Ga0070708_102109925 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300005458|Ga0070681_11076853 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300005459|Ga0068867_101934606 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300005526|Ga0073909_10044978 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1579 | Open in IMG/M |
| 3300005538|Ga0070731_10161892 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1485 | Open in IMG/M |
| 3300005538|Ga0070731_10387241 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300005541|Ga0070733_11003221 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300005542|Ga0070732_10301527 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 962 | Open in IMG/M |
| 3300005547|Ga0070693_100102202 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1748 | Open in IMG/M |
| 3300005559|Ga0066700_10505222 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 844 | Open in IMG/M |
| 3300005561|Ga0066699_10128323 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1708 | Open in IMG/M |
| 3300005566|Ga0066693_10121283 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300005569|Ga0066705_10446553 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 810 | Open in IMG/M |
| 3300005577|Ga0068857_100948542 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300005591|Ga0070761_10820406 | Not Available | 586 | Open in IMG/M |
| 3300005602|Ga0070762_11209319 | Not Available | 523 | Open in IMG/M |
| 3300005712|Ga0070764_10010077 | All Organisms → cellular organisms → Bacteria | 4585 | Open in IMG/M |
| 3300005712|Ga0070764_10441142 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300005764|Ga0066903_102603466 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| 3300005921|Ga0070766_10301420 | Not Available | 1029 | Open in IMG/M |
| 3300005921|Ga0070766_10328313 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300005921|Ga0070766_10468808 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300005921|Ga0070766_10787841 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300005950|Ga0066787_10120983 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
| 3300005950|Ga0066787_10137265 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300006028|Ga0070717_10061381 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3115 | Open in IMG/M |
| 3300006028|Ga0070717_10535488 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300006046|Ga0066652_100980972 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300006046|Ga0066652_101524474 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300006047|Ga0075024_100260881 | Not Available | 835 | Open in IMG/M |
| 3300006052|Ga0075029_100364947 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300006059|Ga0075017_101178569 | Not Available | 600 | Open in IMG/M |
| 3300006162|Ga0075030_100101168 | All Organisms → cellular organisms → Bacteria | 2350 | Open in IMG/M |
| 3300006172|Ga0075018_10104675 | All Organisms → cellular organisms → Bacteria | 1259 | Open in IMG/M |
| 3300006172|Ga0075018_10131874 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
| 3300006176|Ga0070765_101535943 | Not Available | 626 | Open in IMG/M |
| 3300006237|Ga0097621_100067717 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2943 | Open in IMG/M |
| 3300006237|Ga0097621_101701427 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300006354|Ga0075021_10546955 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300006358|Ga0068871_100462756 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
| 3300006800|Ga0066660_11071829 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300006854|Ga0075425_100956178 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300006854|Ga0075425_101751834 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 698 | Open in IMG/M |
| 3300006871|Ga0075434_101688648 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300006893|Ga0073928_10573692 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300007258|Ga0099793_10558701 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300009012|Ga0066710_103559153 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300009038|Ga0099829_10003651 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 9059 | Open in IMG/M |
| 3300009162|Ga0075423_11560876 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300009523|Ga0116221_1424980 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300009524|Ga0116225_1079310 | All Organisms → cellular organisms → Bacteria | 1539 | Open in IMG/M |
| 3300009525|Ga0116220_10244399 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 783 | Open in IMG/M |
| 3300009548|Ga0116107_1183577 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300009624|Ga0116105_1190208 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
| 3300009633|Ga0116129_1030614 | All Organisms → cellular organisms → Bacteria | 1787 | Open in IMG/M |
| 3300009640|Ga0116126_1012023 | All Organisms → cellular organisms → Bacteria | 4075 | Open in IMG/M |
| 3300009672|Ga0116215_1075566 | All Organisms → cellular organisms → Bacteria | 1517 | Open in IMG/M |
| 3300009700|Ga0116217_10191130 | Not Available | 1349 | Open in IMG/M |
| 3300009700|Ga0116217_10534383 | Not Available | 734 | Open in IMG/M |
| 3300009762|Ga0116130_1084438 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300009839|Ga0116223_10284540 | Not Available | 990 | Open in IMG/M |
| 3300010043|Ga0126380_11497986 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300010159|Ga0099796_10116019 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
| 3300010341|Ga0074045_10247060 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
| 3300010358|Ga0126370_10826863 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300010358|Ga0126370_11497602 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300010361|Ga0126378_10017302 | All Organisms → cellular organisms → Bacteria | 6118 | Open in IMG/M |
| 3300010361|Ga0126378_11959996 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300010362|Ga0126377_11547057 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300010371|Ga0134125_10760391 | All Organisms → cellular organisms → Bacteria | 1067 | Open in IMG/M |
| 3300010373|Ga0134128_11998477 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300010379|Ga0136449_100394093 | All Organisms → cellular organisms → Bacteria | 2461 | Open in IMG/M |
| 3300010379|Ga0136449_103122750 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300010379|Ga0136449_104305971 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300010396|Ga0134126_11189791 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300010401|Ga0134121_10272045 | All Organisms → cellular organisms → Bacteria | 1490 | Open in IMG/M |
| 3300010401|Ga0134121_11231425 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 750 | Open in IMG/M |
| 3300010403|Ga0134123_10646053 | Not Available | 1025 | Open in IMG/M |
| 3300010403|Ga0134123_13417722 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300010876|Ga0126361_10317523 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 719 | Open in IMG/M |
| 3300011269|Ga0137392_10433345 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
| 3300011271|Ga0137393_10155479 | All Organisms → cellular organisms → Bacteria | 1912 | Open in IMG/M |
| 3300011271|Ga0137393_11738725 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300012189|Ga0137388_10669310 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300012189|Ga0137388_11380328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 644 | Open in IMG/M |
| 3300012203|Ga0137399_10123180 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2039 | Open in IMG/M |
| 3300012203|Ga0137399_11106502 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300012357|Ga0137384_11371643 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300012363|Ga0137390_10959011 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300012925|Ga0137419_11908101 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300012927|Ga0137416_11432250 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300012971|Ga0126369_12455929 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300012971|Ga0126369_13582409 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300012984|Ga0164309_10147343 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1560 | Open in IMG/M |
| 3300012989|Ga0164305_10722465 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300012989|Ga0164305_11440354 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300014200|Ga0181526_10919027 | Not Available | 550 | Open in IMG/M |
| 3300014489|Ga0182018_10404913 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300014493|Ga0182016_10519967 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300014838|Ga0182030_11361791 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300016387|Ga0182040_11647046 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
| 3300016404|Ga0182037_10658020 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
| 3300017927|Ga0187824_10080793 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
| 3300017933|Ga0187801_10051333 | All Organisms → cellular organisms → Bacteria | 1499 | Open in IMG/M |
| 3300017937|Ga0187809_10040441 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1497 | Open in IMG/M |
| 3300017943|Ga0187819_10683595 | Not Available | 579 | Open in IMG/M |
| 3300017946|Ga0187879_10083123 | All Organisms → cellular organisms → Bacteria | 1847 | Open in IMG/M |
| 3300017955|Ga0187817_11054044 | Not Available | 521 | Open in IMG/M |
| 3300017961|Ga0187778_11061733 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
| 3300017995|Ga0187816_10434515 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300018004|Ga0187865_1228461 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300018017|Ga0187872_10074148 | All Organisms → cellular organisms → Bacteria | 1756 | Open in IMG/M |
| 3300018020|Ga0187861_10377647 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
| 3300018034|Ga0187863_10158533 | All Organisms → cellular organisms → Bacteria | 1263 | Open in IMG/M |
| 3300018034|Ga0187863_10754477 | Not Available | 551 | Open in IMG/M |
| 3300018037|Ga0187883_10661872 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300018038|Ga0187855_10828169 | Not Available | 540 | Open in IMG/M |
| 3300018062|Ga0187784_10003455 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 12767 | Open in IMG/M |
| 3300018062|Ga0187784_11296252 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300018086|Ga0187769_11156374 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
| 3300018090|Ga0187770_10631848 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300018482|Ga0066669_10968602 | Not Available | 766 | Open in IMG/M |
| 3300019786|Ga0182025_1316489 | All Organisms → cellular organisms → Bacteria | 2078 | Open in IMG/M |
| 3300019888|Ga0193751_1246268 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
| 3300020006|Ga0193735_1020889 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2030 | Open in IMG/M |
| 3300020021|Ga0193726_1251735 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300020579|Ga0210407_10133871 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1902 | Open in IMG/M |
| 3300020579|Ga0210407_10269631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1327 | Open in IMG/M |
| 3300020579|Ga0210407_10926397 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 667 | Open in IMG/M |
| 3300020580|Ga0210403_11044484 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300020580|Ga0210403_11208377 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300020581|Ga0210399_11034015 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 660 | Open in IMG/M |
| 3300020582|Ga0210395_11324449 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300020583|Ga0210401_10018065 | All Organisms → cellular organisms → Bacteria | 6803 | Open in IMG/M |
| 3300020583|Ga0210401_10177749 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1984 | Open in IMG/M |
| 3300021046|Ga0215015_10735578 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1162 | Open in IMG/M |
| 3300021088|Ga0210404_10366021 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300021168|Ga0210406_10397331 | All Organisms → cellular organisms → Bacteria | 1105 | Open in IMG/M |
| 3300021171|Ga0210405_10505002 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300021171|Ga0210405_10922921 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300021178|Ga0210408_10492021 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300021178|Ga0210408_10710367 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300021180|Ga0210396_10009811 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 9029 | Open in IMG/M |
| 3300021180|Ga0210396_10221396 | Not Available | 1687 | Open in IMG/M |
| 3300021180|Ga0210396_10316467 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1380 | Open in IMG/M |
| 3300021181|Ga0210388_11059533 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300021402|Ga0210385_10628274 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300021402|Ga0210385_11382410 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300021407|Ga0210383_10487814 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1064 | Open in IMG/M |
| 3300021407|Ga0210383_10704959 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 867 | Open in IMG/M |
| 3300021420|Ga0210394_10158835 | All Organisms → cellular organisms → Bacteria | 1965 | Open in IMG/M |
| 3300021420|Ga0210394_11216476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 646 | Open in IMG/M |
| 3300021474|Ga0210390_10561274 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300021477|Ga0210398_10603005 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300021479|Ga0210410_10220767 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1699 | Open in IMG/M |
| 3300021861|Ga0213853_10087631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 690 | Open in IMG/M |
| 3300022509|Ga0242649_1024057 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300022532|Ga0242655_10238537 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300022557|Ga0212123_10758435 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
| 3300022722|Ga0242657_1090679 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300022733|Ga0224562_1016357 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
| 3300022881|Ga0224545_1000529 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 8127 | Open in IMG/M |
| 3300023259|Ga0224551_1101095 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300025320|Ga0209171_10373297 | Not Available | 738 | Open in IMG/M |
| 3300025404|Ga0208936_1001392 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2900 | Open in IMG/M |
| 3300025463|Ga0208193_1070884 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300025496|Ga0208191_1106674 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300025898|Ga0207692_10378839 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300025898|Ga0207692_10620628 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300025906|Ga0207699_11412781 | Not Available | 515 | Open in IMG/M |
| 3300025915|Ga0207693_11392687 | Not Available | 521 | Open in IMG/M |
| 3300025916|Ga0207663_10097219 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1969 | Open in IMG/M |
| 3300025918|Ga0207662_10016000 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4228 | Open in IMG/M |
| 3300025939|Ga0207665_10270949 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1261 | Open in IMG/M |
| 3300026313|Ga0209761_1278006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 603 | Open in IMG/M |
| 3300026322|Ga0209687_1125108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 827 | Open in IMG/M |
| 3300026548|Ga0209161_10043527 | All Organisms → cellular organisms → Bacteria | 2992 | Open in IMG/M |
| 3300026557|Ga0179587_10511318 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300026928|Ga0207779_1035844 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
| 3300027064|Ga0208724_1016806 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300027066|Ga0208236_1013901 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300027439|Ga0209332_1105109 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300027535|Ga0209734_1056164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 745 | Open in IMG/M |
| 3300027570|Ga0208043_1200991 | Not Available | 504 | Open in IMG/M |
| 3300027605|Ga0209329_1098854 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300027609|Ga0209221_1115346 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300027641|Ga0208827_1005431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5007 | Open in IMG/M |
| 3300027767|Ga0209655_10298994 | Not Available | 519 | Open in IMG/M |
| 3300027795|Ga0209139_10330804 | Not Available | 534 | Open in IMG/M |
| 3300027812|Ga0209656_10302699 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300027842|Ga0209580_10110791 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1333 | Open in IMG/M |
| 3300027846|Ga0209180_10047286 | All Organisms → cellular organisms → Bacteria | 2366 | Open in IMG/M |
| 3300027846|Ga0209180_10554005 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
| 3300027853|Ga0209274_10531510 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 609 | Open in IMG/M |
| 3300027869|Ga0209579_10026287 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3213 | Open in IMG/M |
| 3300027874|Ga0209465_10164517 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
| 3300027879|Ga0209169_10172015 | All Organisms → cellular organisms → Bacteria | 1130 | Open in IMG/M |
| 3300027884|Ga0209275_10267142 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300027889|Ga0209380_10869334 | Not Available | 507 | Open in IMG/M |
| 3300027895|Ga0209624_10000768 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 27559 | Open in IMG/M |
| 3300027905|Ga0209415_10015330 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 12426 | Open in IMG/M |
| 3300027905|Ga0209415_10057643 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4846 | Open in IMG/M |
| 3300027908|Ga0209006_10154681 | All Organisms → cellular organisms → Bacteria | 2011 | Open in IMG/M |
| 3300027910|Ga0209583_10139782 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300027911|Ga0209698_10123187 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2147 | Open in IMG/M |
| 3300027986|Ga0209168_10181737 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300028016|Ga0265354_1016993 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300028047|Ga0209526_10620294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 690 | Open in IMG/M |
| 3300028649|Ga0302162_10111310 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300028747|Ga0302219_10004041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5728 | Open in IMG/M |
| 3300028748|Ga0302156_10480714 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300028748|Ga0302156_10503253 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300028795|Ga0302227_10177630 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300028800|Ga0265338_10292968 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1185 | Open in IMG/M |
| 3300028807|Ga0307305_10435292 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300028808|Ga0302228_10381222 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300028906|Ga0308309_10797629 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300028906|Ga0308309_11538570 | Not Available | 567 | Open in IMG/M |
| 3300028906|Ga0308309_11682984 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300029882|Ga0311368_10782191 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300029883|Ga0311327_10532539 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300029907|Ga0311329_10268020 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1259 | Open in IMG/M |
| 3300029908|Ga0311341_10743738 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300029910|Ga0311369_10547497 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300029944|Ga0311352_10201222 | All Organisms → cellular organisms → Bacteria | 1697 | Open in IMG/M |
| 3300029951|Ga0311371_11777448 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300029953|Ga0311343_10972662 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300029955|Ga0311342_10262556 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1602 | Open in IMG/M |
| 3300029986|Ga0302188_10333579 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300029999|Ga0311339_11162776 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300030013|Ga0302178_10273024 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300030013|Ga0302178_10501175 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300030041|Ga0302274_10383556 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300030056|Ga0302181_10425199 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300030399|Ga0311353_10039950 | All Organisms → cellular organisms → Bacteria | 4861 | Open in IMG/M |
| 3300030399|Ga0311353_10700584 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300030490|Ga0302184_10393818 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300030503|Ga0311370_10756721 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
| 3300030580|Ga0311355_10059703 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4429 | Open in IMG/M |
| 3300030618|Ga0311354_10910780 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300030706|Ga0310039_10303200 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 604 | Open in IMG/M |
| 3300031233|Ga0302307_10164166 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
| 3300031708|Ga0310686_109110770 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300031708|Ga0310686_115689803 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 752 | Open in IMG/M |
| 3300031715|Ga0307476_10612943 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300031716|Ga0310813_11491113 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
| 3300031718|Ga0307474_10590118 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300031726|Ga0302321_103566063 | Not Available | 506 | Open in IMG/M |
| 3300031754|Ga0307475_10232047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina → Desulfosarcina alkanivorans | 1478 | Open in IMG/M |
| 3300031754|Ga0307475_10296725 | All Organisms → cellular organisms → Bacteria | 1297 | Open in IMG/M |
| 3300031754|Ga0307475_10469398 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
| 3300031823|Ga0307478_10088468 | All Organisms → cellular organisms → Bacteria | 2378 | Open in IMG/M |
| 3300031962|Ga0307479_10791161 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 924 | Open in IMG/M |
| 3300031962|Ga0307479_12181105 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300032072|Ga0326631_109093 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300032076|Ga0306924_11176129 | Not Available | 831 | Open in IMG/M |
| 3300032160|Ga0311301_10555167 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1677 | Open in IMG/M |
| 3300032180|Ga0307471_103055517 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300032421|Ga0310812_10019580 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2370 | Open in IMG/M |
| 3300032783|Ga0335079_10182266 | All Organisms → cellular organisms → Bacteria | 2339 | Open in IMG/M |
| 3300032805|Ga0335078_11151984 | Not Available | 901 | Open in IMG/M |
| 3300032828|Ga0335080_10959112 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300032829|Ga0335070_11150436 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300032895|Ga0335074_10419047 | All Organisms → cellular organisms → Bacteria | 1440 | Open in IMG/M |
| 3300032954|Ga0335083_10497856 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
| 3300033547|Ga0316212_1050219 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.31% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.62% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.62% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.38% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.38% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.44% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.75% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.81% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.81% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.19% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.19% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.50% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.50% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.50% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.56% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.56% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.88% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.25% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.25% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.25% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.94% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.31% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.31% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.31% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.31% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.31% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.31% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.31% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.31% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.31% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.31% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.31% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.31% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.31% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.62% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.62% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.62% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.62% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.62% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.62% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459017 | Litter degradation ZMR4 | Engineered | Open in IMG/M |
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005950 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009548 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009633 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 | Environmental | Open in IMG/M |
| 3300009640 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018004 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022509 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022733 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU3 | Environmental | Open in IMG/M |
| 3300022881 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 20-24 | Environmental | Open in IMG/M |
| 3300023259 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24 | Environmental | Open in IMG/M |
| 3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025404 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025463 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025496 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026928 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 44 (SPAdes) | Environmental | Open in IMG/M |
| 3300027064 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF003 (SPAdes) | Environmental | Open in IMG/M |
| 3300027066 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF005 (SPAdes) | Environmental | Open in IMG/M |
| 3300027439 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027535 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027609 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Host-Associated | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028649 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_2 | Environmental | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028748 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028795 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029883 | I_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029907 | I_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300029908 | II_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029953 | II_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029955 | II_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029986 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_1 | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300030041 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032072 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSI2 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 4ZMR_04610400 | 2170459017 | Switchgrass, Maize And Mischanthus Litter | GEWDKQDVQYKQQIADKQKSVDDAKQKLDDLREEARKAGAPTSIQEQ |
| deeps_02778030 | 2199352024 | Soil | KYQKDIADKQKALDDAKAKLADLQEQARKDGASAKARE |
| deeps_01250680 | 2199352024 | Soil | GDWDKQDAQYKQQIADKQKAVDDAKVRLEELKDQARRAGVPDSVQE |
| INPhiseqgaiiFebDRAFT_1057860001 | 3300000364 | Soil | RLRNQGAWDKEDADYKKQLAEKQQALDNAKQSLDEMQEQARKAGVPAGDRK* |
| JGI1027J12803_1004441001 | 3300000955 | Soil | EQMAAKQKQLEDAKKQLDDLQEQARKAGVPSSMRE* |
| JGI1027J12803_1047455621 | 3300000955 | Soil | DVGSRLRNSAEWDKQDAQYKQQIADKQKALDDAKQKLEEMREEARKAGVPGSIREP* |
| JGI12712J15308_100143101 | 3300001471 | Forest Soil | AWDKQDADYKQQIADKQKTLDDAKQKLDDMDEQARKAGVPNSMREP* |
| JGI12635J15846_105324241 | 3300001593 | Forest Soil | DTQYKQQIADKQKGLDDAKQKLEDMQEEARKAGMPASVSEP* |
| JGIcombinedJ26739_1007041581 | 3300002245 | Forest Soil | KEDAQYKQQIAQKQKAVDDAKKALDDLKEQARKAGVPAKLRE* |
| JGIcombinedJ26739_1008565461 | 3300002245 | Forest Soil | QDADYKQQIADKQKTLDDAKQKLDDMDEQARKAGVPNSMREP* |
| JGI25388J43891_10503321 | 3300002909 | Grasslands Soil | LRNAGSWDKEDAQYKQQLAEKQKTLDTAKEELQDSRERARKAGVPSSMIP* |
| JGIcombinedJ51221_102902522 | 3300003505 | Forest Soil | MYGDVGNRLRNSSDWDKQDAQYKQQIADKQKLLDDARQKLEDTQEDARKAGVPDSDHQQ* |
| Ga0062384_1010051122 | 3300004082 | Bog Forest Soil | QAHTKEEIEQKQKALDEAKQKLDEIQENARKAGLPSGDRE* |
| Ga0062389_1013712722 | 3300004092 | Bog Forest Soil | WDKEDADYKKKIAEKKKALDDAKQQLEDMQEDARKAGVPSSVRE* |
| Ga0062386_1011416191 | 3300004152 | Bog Forest Soil | DWDKQDAQYKQQIADKQKALDDAKQKLEDIQEEARKAGTPSSVREP* |
| Ga0062595_1008205302 | 3300004479 | Soil | GSWDKEDAQYKQQIAQKQKAVDDAKKALEDLKEQGRKAGVPARDRE* |
| Ga0066672_104979312 | 3300005167 | Soil | DAQYKQQLAEKQKTLDTAKEELQDSRERARKAGVPSSMIP* |
| Ga0066675_112885911 | 3300005187 | Soil | AQYKQQIEDKKKALDDARQELDDTKEKARKAGMPAGSLD* |
| Ga0066388_1005247991 | 3300005332 | Tropical Forest Soil | WDKEDAQYKQQIEDKKKNLDDAKQELDDMREKARKAGVPANSVD* |
| Ga0070682_1005358172 | 3300005337 | Corn Rhizosphere | QGSWDKEDAQYKQDLAKKQKALDDAKKAVDDLKEKARKAGVPSK* |
| Ga0070669_1017696781 | 3300005353 | Switchgrass Rhizosphere | NRLRNQGAWDKEDAQYKQDLAKKQKALDDAKKAVDDLKEKARKAGMPAK* |
| Ga0070714_1000971801 | 3300005435 | Agricultural Soil | SSWDKEDAQFKEQIADKQKKLDDAKKQLEDLQEQARKANVPSSMRE* |
| Ga0070714_1010035402 | 3300005435 | Agricultural Soil | DAQYKQQIGDKQKALDDAKQKLEDLREEARKAGVPSSVREP* |
| Ga0070713_1011094951 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | DWDKQDAQYKQQIADKQKALDDAKQKLEEMQEEARKAGVPASIREP* |
| Ga0070708_1009786472 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | RLRNQGSWDKEDAQYKQQIAQKQKALDDAKKALDDMKEQGRKAGVPARDRQ* |
| Ga0070708_1021099251 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | WDKQDAQYKEQIADKLKALEEAKQKLEDLEEEARKAGVPASMREP* |
| Ga0070681_110768531 | 3300005458 | Corn Rhizosphere | NQGSWDKEDAQYKQDLAKKQKALDDAKKAVDDLKEKARKAGVPSK* |
| Ga0068867_1019346061 | 3300005459 | Miscanthus Rhizosphere | AWDKEDAQYKQDLAKKQKALDDAKKAVDDLKEKARKAGMPAK* |
| Ga0073909_100449783 | 3300005526 | Surface Soil | QQIADKQKALDDAKQKLDDLQEQARKAGTPSSIREP* |
| Ga0070731_101618921 | 3300005538 | Surface Soil | ADKQKAVDDAKQKLDDMQEEARKAGMPASVSEQQ* |
| Ga0070731_103872411 | 3300005538 | Surface Soil | IADKQKAVEDAKQKLIDMEEDARKAGVPAAMRETQSTE* |
| Ga0070733_110032212 | 3300005541 | Surface Soil | KEETQYKQSITDKQKAVDDAKQKLSDMQEQARKEGVPASMME* |
| Ga0070732_103015273 | 3300005542 | Surface Soil | TDYKQKIADKQKALDDAKQKLEDMKEEARKAGAPASVRE* |
| Ga0070693_1001022024 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | DAQYKQQIAQKQKALDDAKQKLDAMQEEARHAGVPASARQ* |
| Ga0066700_105052222 | 3300005559 | Soil | QDAQYKEQIADKQKALDDAKQKLEDLEEEARKAGVPAAMREP* |
| Ga0066699_101283231 | 3300005561 | Soil | NAGSWDKEDAQYKQQLAEKQKSVNTAKEELQDMKERARKAGVPSSMIP* |
| Ga0066693_101212833 | 3300005566 | Soil | NRLRNQADWDKQDTQYKQQIADKQKAVDEAKQKLEELHENARKAGAPTSVQEQ* |
| Ga0066705_104465531 | 3300005569 | Soil | RLRNAGAWDKEDAQYKDQIVDKQKKLEDAKKQLEDMQEQARRAGVPSSMRE* |
| Ga0068857_1009485423 | 3300005577 | Corn Rhizosphere | KEDAQYKQDLAKKQKALDDAKKAVDDLKEKARKAGVPSK* |
| Ga0070761_108204061 | 3300005591 | Soil | TDYKQKIADKLKAVDDAKQKLDDLQEEARKAGVPSNMREP* |
| Ga0066706_101981161 | 3300005598 | Soil | YKQQIADKQKVLDEAKGKLTEFQEQARKSGVPNSTRE* |
| Ga0070762_112093192 | 3300005602 | Soil | TSWDKEDAQYKEQIESKQKALEDAKKALDDLQEQARKAGVPSSQRE* |
| Ga0068856_1018996411 | 3300005614 | Corn Rhizosphere | FKQQIADKQKALDQAKQTLDDLQEQARKAGVSTKDRE* |
| Ga0070764_100100771 | 3300005712 | Soil | AGNRMRNSAEWDKQDADYKQKIADKQKAVEDAKSKLADMQEEARKDGVPSAMVD* |
| Ga0070764_104411422 | 3300005712 | Soil | EGEFKQKIGDKQKAVDDGKQKLDDMQEEARRAGVPAAMREP* |
| Ga0066903_1026034663 | 3300005764 | Tropical Forest Soil | QYKQQIADKQKAVDDAKQKMEDMREEARKAGVPSSVREP* |
| Ga0070766_103014201 | 3300005921 | Soil | NSAEWDKEDADYKKKIADKKKAVDDAKQQMDDMQEEARKAGVPSSVRESTANQQ* |
| Ga0070766_103283131 | 3300005921 | Soil | SAQWDKEEGEFKQKIGDKQKAVDDGKQKLDDMQEEARRAGVPAAMREP* |
| Ga0070766_104688081 | 3300005921 | Soil | QWDKQDADYKQKIAEKQKSVEEAKQKLEDLKEEARKAGVPSAIID* |
| Ga0070766_107878412 | 3300005921 | Soil | RMRNATQWDKEEADYKQKITDKQKALDEAKQKLDDMKEDARKAGVPSAMID* |
| Ga0066787_101209832 | 3300005950 | Soil | TQYKQDIADKQKAVDEAKQKLEDLQEEARKAGAPTTSRE* |
| Ga0066787_101372652 | 3300005950 | Soil | SADWDKQDAQYKQQIADKLKALDDAKQKLEDIQEEARKAGTPSSIREP* |
| Ga0070717_100613811 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | QQIADKQRAVDEATAKLADLQDGARKAGVPNSVAEQ* |
| Ga0070717_105354881 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | AKEDADYKQKIVDKQKALDDAKTKLRDLQEQARRAGAPSSVADQN* |
| Ga0066652_1009809721 | 3300006046 | Soil | KYKQQIADKQKTLDDAKSQLNDMQEEARRSGAPSSVTE* |
| Ga0066652_1015244741 | 3300006046 | Soil | QYKQQIADKQKAVDEAKQKLEELQENARKAGAPTSVQEQ* |
| Ga0075024_1002608814 | 3300006047 | Watersheds | WDKEDSQFKDQMADKQKRLDDAKKSLEDLQEQARRAGVPSSLRE* |
| Ga0075029_1003649472 | 3300006052 | Watersheds | ADWDKQDAQYKQQIADKQKAVDEAKQKLDDLREEARKAGVPSSVREP* |
| Ga0075017_1011785691 | 3300006059 | Watersheds | AQYKQQIADKQKALDDAKQKLEDLREEARKAGVPSSVREP* |
| Ga0075030_1000888331 | 3300006162 | Watersheds | DREDASYREKIDKKQKEVDSAKAKLEDMQEQARRAGVPAAFRE* |
| Ga0075030_1001011681 | 3300006162 | Watersheds | WDKQDADYKQQIADKEKALEDAKQKLDDMQEDARKAGVPASSREP* |
| Ga0075018_101046751 | 3300006172 | Watersheds | WDKEDADYKQKIDEKKKALDDAKKELEGMQEDARKAGVPSSVRE* |
| Ga0075018_101318741 | 3300006172 | Watersheds | GNRMRNSGAWDKEDSDYKQKIDAKKKALDDAKKDLDDMQEDARKAGVPSSVRE* |
| Ga0070765_1015359431 | 3300006176 | Soil | EKKKAVDEAKQQMDDMQEEARKAGVPASVRESTGDQP* |
| Ga0097621_1000677175 | 3300006237 | Miscanthus Rhizosphere | SKYKEKIADKQKALDDAKAKLSEMQEGARKAGVPSSQRGE* |
| Ga0097621_1017014271 | 3300006237 | Miscanthus Rhizosphere | SWDKEDAQYKQDLAKKQKALDDAKKAVDDLKEKARKAGVPSK* |
| Ga0075021_105469551 | 3300006354 | Watersheds | WDKEDAGYKQQIAQKQKAVDDAKKALDDLKEQARKAGVPAKLRE* |
| Ga0068871_1004627561 | 3300006358 | Miscanthus Rhizosphere | SATWDKEDAQYKQQITQKQKAVDDAKKTLDDLKEQARKAGVPAKLRE* |
| Ga0066659_111137641 | 3300006797 | Soil | QVAQKQKAVDDAKKALDDLKEQARKAGVPPRVRE* |
| Ga0066660_110718291 | 3300006800 | Soil | AGNRIRNSADWDKQDAEYKQKIADKQKAIEDAKQKLSDMQEEARKAGVPSSMMN* |
| Ga0075425_1009561783 | 3300006854 | Populus Rhizosphere | GSWDKEDAQYKQQLAEKQKSVNTAKEELQDMKERARKAGVPSSMIP* |
| Ga0075425_1017518341 | 3300006854 | Populus Rhizosphere | AEWDKQDTQYKQQIADKQKALDEAKQRLEDLQEEARKAGVPSSIREP* |
| Ga0075434_1016886482 | 3300006871 | Populus Rhizosphere | RNQGSWDKEDAQYKQQIAQKQKAVDDAKKALDNLKEQGRKAGVPVHDRE* |
| Ga0073928_105736922 | 3300006893 | Iron-Sulfur Acid Spring | DAQYKQQIADKQKALDDAKQKLDDLQEDARKAGAPTSVSEPQQQ* |
| Ga0099793_105587011 | 3300007258 | Vadose Zone Soil | QDADYKQQIALKQKALEEAKQKLDDMEEEARKSGVPASVREP* |
| Ga0066710_1035591532 | 3300009012 | Grasslands Soil | DWDKQDAQYKQQIADKQKALDDAKQKLEDTQERARKAGVPSAQRE |
| Ga0066710_1043552751 | 3300009012 | Grasslands Soil | QYKQRIADKQKTVEDAKQKVEDFQEQARKSGVPANMRE |
| Ga0099829_1000365110 | 3300009038 | Vadose Zone Soil | DKEDAQYKQQIAQKQKALDDAKKALDDMKEQGRKAGVPARDRQ* |
| Ga0075423_115608762 | 3300009162 | Populus Rhizosphere | SWDKEDAQYKQQLAEKQKSVNTANEELQDMKERARKAGVPSSMIP* |
| Ga0116221_14249801 | 3300009523 | Peatlands Soil | KQKIADKQKAVEDAKQKLGEMQEEARKDGVPSAMVD* |
| Ga0116225_10793101 | 3300009524 | Peatlands Soil | NEADWDKQDAQYKQQIADKQKALDDAKQKLDDMQEDARKAGVPNSVSQP* |
| Ga0116220_102443992 | 3300009525 | Peatlands Soil | VGNRLRNSSAWDEEDADYKQKVTEKQKAFDAAKQELDDMQEEARKAGVPSSVRE* |
| Ga0116107_11835772 | 3300009548 | Peatland | RNSTQWDKEEADYKQKIADKQKAVDDAKQKLDDLEEEARKAGVPAAMREP* |
| Ga0116105_11902081 | 3300009624 | Peatland | QIADKQKALDDAKQKLEDMDEQARKAGVPNSIREP* |
| Ga0116129_10306144 | 3300009633 | Peatland | ADWDKQDADYKQKIADKQKAVDDAKQQLDDLEEQARKAGVPAAMREP* |
| Ga0116126_10120231 | 3300009640 | Peatland | RLRNSTQWDKEEADYKQKIADKQKAVDDAKQKLDDLEEEARKAGVPAAMREP* |
| Ga0116215_10755661 | 3300009672 | Peatlands Soil | LRNELPWDKQDADYKQKIADKQKALEDAKQKLDDLQEEARKAGVPANMREP* |
| Ga0116217_101911301 | 3300009700 | Peatlands Soil | KEDADYKKKIDEKKKAADAAKQDLDDLQEDARKAGIPSSVRE* |
| Ga0116217_105343831 | 3300009700 | Peatlands Soil | DAQYKQKIAEKKKAADDAKQALDDMQEDARKAGVPASVREATAAPE* |
| Ga0116130_10844383 | 3300009762 | Peatland | YADVGNRLRNSGQWDKEDADYKQKIADKQKAFDDAKQRLDDMQEEARKAGVPAAMRE* |
| Ga0116223_102845402 | 3300009839 | Peatlands Soil | WDKEDADYKKKIDEKKKAADAAKQELDDLQEDARKAGIPSSVRE* |
| Ga0126380_114979861 | 3300010043 | Tropical Forest Soil | IADKQKAVDDAKQKLEDMQEEARKAGVPSSVREP* |
| Ga0099796_101160193 | 3300010159 | Vadose Zone Soil | YKQQIADKLQAIEDAKQKLDDMQEEARKSGVPANVREP* |
| Ga0134084_104537381 | 3300010322 | Grasslands Soil | QIADKQKVLDEAKGKLTEFQEQARKSGVPNSTRE* |
| Ga0074045_102470601 | 3300010341 | Bog Forest Soil | QIADKQKAVDEAKQKLEDLQEDARKAGVPASVREP* |
| Ga0126370_108268631 | 3300010358 | Tropical Forest Soil | IADKQKAVDDAKQKLEGLQEEARKAGVPSSVREP* |
| Ga0126370_114976022 | 3300010358 | Tropical Forest Soil | DWDKQDAQYKQTIADKQKALDDAKQKLDDLQEEARKAGVPTSVREQAQ* |
| Ga0126372_122223072 | 3300010360 | Tropical Forest Soil | DQITEKQKKLDEAKKQLEDLQEQARRAGVPSSMRE* |
| Ga0126378_1001730210 | 3300010361 | Tropical Forest Soil | NRLRNSAEWDKQDAQYKQQIADKQKMLEDAKQKLEELQEHARKAGVPSSIREP* |
| Ga0126378_119599962 | 3300010361 | Tropical Forest Soil | QYKQQIADKQKALDDAKQKLDDLEEEARKANVPASVREP* |
| Ga0126377_115470572 | 3300010362 | Tropical Forest Soil | NSTDWDKQDAQYKQQIADKQKALDDAKQKMEDMQEEARKAGVPSSVREP* |
| Ga0134125_107603911 | 3300010371 | Terrestrial Soil | QGAWDKEDAQYKHDLAKKQKALDDAKKAVDDLKEKARKAGMPAK* |
| Ga0134128_119984772 | 3300010373 | Terrestrial Soil | LRNQGSWDKEDAQYKQQIAQKQKAVDDAKKALDNLKEQGRKSGVPARDRE* |
| Ga0136449_1003940931 | 3300010379 | Peatlands Soil | QQIADKQKALDDAKQKLDDMQEDARKAGVPASVREP* |
| Ga0136449_1031227502 | 3300010379 | Peatlands Soil | DYKQKIADKQKALDDAKQKLSDMQEDAHKAGVPSSMIE* |
| Ga0136449_1043059711 | 3300010379 | Peatlands Soil | KKDADYKQQLAEKQKALTEAQQDLENMQEDARKAGVPSSVTDKPQN* |
| Ga0134126_111897911 | 3300010396 | Terrestrial Soil | DKEDAQYKQDLAKKQKALDDAKKAVDDLKEKARKAGVPSK* |
| Ga0134121_102720453 | 3300010401 | Terrestrial Soil | RNQGSWDKEDAQYKQDLAKKQKALDDAKKAVDDLKEKARKAGVPSK* |
| Ga0134121_112314251 | 3300010401 | Terrestrial Soil | VSWDKEDREYKQQIAEKEKAVADAKQKLDDMQESARKAGVPSSVRE* |
| Ga0134123_106460531 | 3300010403 | Terrestrial Soil | AQYKQQLAQKQKALDDAKQKLDAMQEEARHAGVPASARQ* |
| Ga0134123_134177222 | 3300010403 | Terrestrial Soil | WDKEDAQYKQQITQKQKAVDDAKKTLDDLKEQARKAGVPAKLRE* |
| Ga0126361_103175231 | 3300010876 | Boreal Forest Soil | KQQIADKQKALDDAKQKLDDLQEDARKAGAPTSVSEPQQQ* |
| Ga0137392_104333451 | 3300011269 | Vadose Zone Soil | RQDSQYKQQIADKQKALDDAKQKLEGMQEEARKAGIPAAMREQ* |
| Ga0137391_103043431 | 3300011270 | Vadose Zone Soil | KQQIAQKQKAVDDAKKALDDLKEQARKAGVPAKLRE* |
| Ga0137393_101554794 | 3300011271 | Vadose Zone Soil | NSAEWDKQDADYKQKIADKQKEVDDAKQKLDDMKEEARKAGVPSSMIN* |
| Ga0137393_117387252 | 3300011271 | Vadose Zone Soil | QGDWDKEDANYKQKLAEKQKAVDAAKQHLDDVQEQARKAGVPAAMRE* |
| Ga0137388_106693103 | 3300012189 | Vadose Zone Soil | SAPWDKEETNYKQQIAEKQKALDDAKQKLEDMKEEAHKADVPSSITE* |
| Ga0137388_113803281 | 3300012189 | Vadose Zone Soil | EDAAYKQKIAEKQKAVDAAKQHLDDLQEQARKAGVPAAMRE* |
| Ga0137399_101231801 | 3300012203 | Vadose Zone Soil | YKQQLAEKQKSVNTAKEELQDMKERARKAGVPSSMIP* |
| Ga0137399_111065021 | 3300012203 | Vadose Zone Soil | RLRNSTQWDKEETNYKQQIAEKQKAVDEAKQKLEDMREEAHKAGVPSSMIE* |
| Ga0137384_113716431 | 3300012357 | Vadose Zone Soil | MRNSADWDKQDAQYKQQIADKQKALDEAKQKLEDIEEQARKAGAPTSVREQ* |
| Ga0137390_109590112 | 3300012363 | Vadose Zone Soil | RNSGSWDKQDAQYKQQIADKLQTIEDAKQKLDDMQEEARKSGVPASVREP* |
| Ga0137419_119081011 | 3300012925 | Vadose Zone Soil | QIADKQKALEDAKQKLEGMQEDARKAGIPAAMREQ* |
| Ga0137416_114322502 | 3300012927 | Vadose Zone Soil | WDKQDADYKQQIALKQKALEEAKQKLDDMEEEARKSGVPASVREP* |
| Ga0126369_124559291 | 3300012971 | Tropical Forest Soil | AAWDKEDAQYKDQIAAKQKALDDAKQSLEDMQEQARKAGVPSSMRD* |
| Ga0126369_135824091 | 3300012971 | Tropical Forest Soil | AEAAVPEAKKALDDAKKDMDDMQEGARKAGVPSSVRE* |
| Ga0164309_101473434 | 3300012984 | Soil | NRLRNQGAWDKEDAQYKQDLAKKQKALDDAKKAVDDLKEKARKAGVPSK* |
| Ga0164305_107224652 | 3300012989 | Soil | AQYKQQIADKQKSLEDAKQKIDDLREEARKAGVPSSVREP* |
| Ga0164305_114403541 | 3300012989 | Soil | NRLRNQGSWDKEDAQYKQDLAEKQKALDDAKKAVDDLKEKARKAGVPSK* |
| Ga0157373_101118464 | 3300013100 | Corn Rhizosphere | DYKQKIADKQKELGDAKTKLGDMQEEARRAGAPAAATEQN* |
| Ga0157369_105252431 | 3300013105 | Corn Rhizosphere | KQKIADKQKELDAAKGQLSDMQDQARKAGAPAGASESN* |
| Ga0181526_109190272 | 3300014200 | Bog | KKKIADKKKAVDEAKQQMDDMQEEARKAGVPSSVREATADQQ* |
| Ga0182018_104049131 | 3300014489 | Palsa | ERLRNSAAWDKEDAQYKQQIADKQKDLDAGKQHLDDMQEDARKAGVPSSLRE* |
| Ga0182016_105199672 | 3300014493 | Bog | FYGDAGERLRNAAAWDKEDAQYKQQIADKQKALDDAKQHLDDLQEDARKAGVPPAMRE* |
| Ga0182030_113617911 | 3300014838 | Bog | TQWDKEDADYKQKIAEKQKTVEDAKQRLDDMQEEARKAGVPAAMRE* |
| Ga0157376_100927012 | 3300014969 | Miscanthus Rhizosphere | QLAQKQKALDDAKKALDDMKEQARKAGVPAKMRQ* |
| Ga0182040_116470461 | 3300016387 | Soil | KQYQEQIATKQKALDDARQKLADLQEEARKAGVPASKRD |
| Ga0182037_106580201 | 3300016404 | Soil | RNSGAWDKEDSQYKDQIAAKQKTLDDAKKALEDMQEDARKAGVPSGMRD |
| Ga0182039_118815731 | 3300016422 | Soil | QIADKQKAPEDAKQKLEELQEQARKAGVPSSIREP |
| Ga0187824_100807931 | 3300017927 | Freshwater Sediment | GSWDKEDAQYKQQIAQKQKALDDAKKALDNMKEQGRKAGIPPRDRE |
| Ga0187801_100513331 | 3300017933 | Freshwater Sediment | DAQYKQQIGDKQKALDDAKQKLEDMQEEARKAGVPSSVREP |
| Ga0187809_100404411 | 3300017937 | Freshwater Sediment | RLRNQTGWDKDDAQYKQDLAEKQKAVDEAKKQLEDLQEQARKAGAPNSARE |
| Ga0187819_106835951 | 3300017943 | Freshwater Sediment | LRNESTWDKEDADYKKKIEEKKKAADAAKQELDDLQEDARKAGIPSSVRE |
| Ga0187879_100831231 | 3300017946 | Peatland | RMRNAAQWDKEDADYKQKIADKQKAVDDAKQKLDDMQEEARKAGVPAAMREP |
| Ga0187817_110540441 | 3300017955 | Freshwater Sediment | KEDADYKKKIEEKKKAADAAKQELDDLQEDARKAGIPSSVRE |
| Ga0187778_110617331 | 3300017961 | Tropical Peatland | EYKQQIADKQKALDDAKAALDSIEEDARKSGVPASMREPQ |
| Ga0187816_104345151 | 3300017995 | Freshwater Sediment | KKKAADAAKQELDDMQEDARKAGVPSSVRESSTGQQ |
| Ga0187865_12284611 | 3300018004 | Peatland | DYKQKIADKEKVVDDAKQKLDDMQEEARKAGVPAAMREP |
| Ga0187872_100741481 | 3300018017 | Peatland | RLRNSTQWDKEEADYKQKIADKQKAVDDAKQKLDDLEEEARKAGVPAAMREP |
| Ga0187861_103776472 | 3300018020 | Peatland | AQYKQQIADKQKALDDAKQKLEDIQEEARKAGTPASVREP |
| Ga0187863_101585331 | 3300018034 | Peatland | EDADYKKKIADKKKAVDEAKQQMDDMQEEARKAGVPSSVREATADQQ |
| Ga0187863_107544771 | 3300018034 | Peatland | EDADYKKKIADKKKAVDEAKQQMDDMQEEARKAGVPSSVRETTADQQ |
| Ga0187883_106618722 | 3300018037 | Peatland | DKQKAVEDAKQKLDDMQEEARKAGVPAAMREPQSTE |
| Ga0187855_108281692 | 3300018038 | Peatland | IADKKKAVDEAKQQMDDMQEEARKAGVPSSVRETTADQQ |
| Ga0187784_100034551 | 3300018062 | Tropical Peatland | KIAEKQKALDDAKQKLDDVQEDARKAGVPTSVREGDQQPQQ |
| Ga0187784_112962522 | 3300018062 | Tropical Peatland | NSADWDKQDAQFKQQIADKQKALDDAKQKMDDLKDQAHKAGMPESVQEPAQAQ |
| Ga0187769_111563741 | 3300018086 | Tropical Peatland | DKKDAQYKQQIADKQKAVEEAKQKLDDMQEDARKAGVPSSTIEP |
| Ga0187770_106318482 | 3300018090 | Tropical Peatland | AGERLRNQANWDKEDADYKKKIGDAQKALDDAKQKMSDMEEDARKAGVPTSVREGDQQPQ |
| Ga0066669_109686021 | 3300018482 | Grasslands Soil | KQQIADKQKALDDAKQKLEDLREEARKAGVPSSVREP |
| Ga0182025_13164894 | 3300019786 | Permafrost | MRNEAAWDKEDADYKQKIADKQKALDDSKEKMQDLQEQARKAGVPLR |
| Ga0193751_12462682 | 3300019888 | Soil | QYKQQIADKQKSLDDAKQKLDDLQEDARKAGAPASVSAQ |
| Ga0193735_10208894 | 3300020006 | Soil | FSGARLRNQGSWDKQDAQYKQQIAQKQKALDEAKKALDDMKEQGRKAGVPARDRQ |
| Ga0193726_12517352 | 3300020021 | Soil | EYKDHIAEKQKAVDEAKQKLDQLQEDARKAGVPTSARE |
| Ga0210407_101338713 | 3300020579 | Soil | MYGDVGNRLRNSADWDKQDAQYKQQIGDKQKALDDAKQKLEDLREEARKAGVPSSVREP |
| Ga0210407_102696313 | 3300020579 | Soil | NSADWDKQDAQYKQQIADKQKALDDAKQKLEDAQEEARKAGVPDSVREP |
| Ga0210407_109263972 | 3300020579 | Soil | ADYKQKIEQKKKALDDAKKELEDMQEDARKAGIPSSTRE |
| Ga0210403_110444842 | 3300020580 | Soil | KQDADYKQKIADKQKAVEDAKSKLADMQEEARKDGVPSAMVD |
| Ga0210403_112083772 | 3300020580 | Soil | AEKKKAADAAKQQLDDMQEDARKAGVPSSVRESSTGQQ |
| Ga0210399_110340151 | 3300020581 | Soil | RMRNSADWDKQDAQFKQQIADKQKALDDAKQKLEDAQEEARKAGVPSSVREP |
| Ga0210395_113244491 | 3300020582 | Soil | LRNSAQWDKQEADYKQKIADKQKALDEAKQKLEDMQEEARKDGVPAAMRE |
| Ga0210401_100180651 | 3300020583 | Soil | EFKQKIADKQKAVDDGKQKLDDMQEEARRAGVPAAMREP |
| Ga0210401_101777491 | 3300020583 | Soil | NWDKEDADYKQKIAEKKKAADEAKQRLDDMQEDARKAGVPSSVRESSTGQQ |
| Ga0215015_107355781 | 3300021046 | Soil | YKQQIADKLQAIEDAKQKLDDMQEEARKAGVPASEREP |
| Ga0210404_103660211 | 3300021088 | Soil | SAEWDKQDADYKQKIADKQKAVEDAKSKLADMQEEARKDGVPSAMVD |
| Ga0210406_103973313 | 3300021168 | Soil | EWDKENAQYQQQIADKQKEVEAAKQKIDDLQEQARKAGVPSSVRE |
| Ga0210405_105050021 | 3300021171 | Soil | DAGNRMRNEAQWDKQDADYKQKIADKQKAVEDAKQKLGDMQEEARKDGVPSAMVD |
| Ga0210405_109229212 | 3300021171 | Soil | LRGSGTWDKEDAQYKQQIAQKQKAVDDAKKALDDMKEKARKAGVPAKLRE |
| Ga0210408_104920212 | 3300021178 | Soil | NRLRGSGTWDKEDAQYKQQIVQKQKAVDDAKKALDDMKEKARKAGVPAKLRE |
| Ga0210408_107103672 | 3300021178 | Soil | KQKIAEKKKAADAAKQQLDDMQEDARKAGVPSSVRESSTGQQ |
| Ga0210396_1000981111 | 3300021180 | Soil | EYKQKIADKQKAVDDAKQKLEDMQEEARKAGVPAAMREP |
| Ga0210396_102213963 | 3300021180 | Soil | KIAEKKKAVDEAKQQMDDMQEEARKAGVPSSVRETTADQQ |
| Ga0210396_103164671 | 3300021180 | Soil | EYKQKIADKQKAVDDAKQRLTDMQEEARKAGVPSSMLD |
| Ga0210388_110595331 | 3300021181 | Soil | QQIADKQKALDDAKQKLDDMQEDARKAGVPSSVREP |
| Ga0210385_106282741 | 3300021402 | Soil | KIAEKKKAADAAKQQLDDMQEDARKAGVPSSVRESSTGQQ |
| Ga0210385_113824102 | 3300021402 | Soil | DKQDADYKQKIADKQKAVEDAKQKLGDMQEEARKDGVPSAMVD |
| Ga0210383_104878143 | 3300021407 | Soil | LPWDKQDAEYKQRIADKQKALDDAKQKLTDMQEEARKAGVPPGMIPD |
| Ga0210383_107049591 | 3300021407 | Soil | YKQQIADKQKALDDAKQKLDDMQEEARKAGVPASVREQ |
| Ga0210394_101588354 | 3300021420 | Soil | GDWDKQDAQYKQQIADKQKSLDDAKQKLDDLREEARKSGVPSSVREP |
| Ga0210394_112164761 | 3300021420 | Soil | DYKQKIAEKKKAADAAKQELDDMQENARKAGVPSSVRESSTAQQ |
| Ga0182009_103047801 | 3300021445 | Soil | YKEKIADKQKALDDAKAKLSEIQENARKAGVPSSQRGE |
| Ga0210390_105612743 | 3300021474 | Soil | KQQIADKQKALDDAKQKLDDIQEDARKAGTPSSVREP |
| Ga0210398_106030052 | 3300021477 | Soil | SQYKQQIADKQKALDDAKQKLEDIQEEARKAGTPSSVREP |
| Ga0210410_102207671 | 3300021479 | Soil | ADYKQKISDKQKAVEDAKQKLGDMQEEARKDGVPSAMVD |
| Ga0210410_114888791 | 3300021479 | Soil | DAEYKQQMVDRQKKLEDAKKQLEDMQEQARKAGVPSSMRE |
| Ga0213853_100876311 | 3300021861 | Watersheds | KQQIADKQKAIDEAKQKLDDMQEDARKAGVPASAREP |
| Ga0242649_10240571 | 3300022509 | Soil | KKAVDDAKQQMDDMQEEARKAGVPSSVRETTANQQ |
| Ga0242655_102385372 | 3300022532 | Soil | AMYGDVGNRLRNSADWDKQDAQYKQQIGDKQKALDDAKQKLEDLREEARKAGVPSSVREP |
| Ga0212123_107584351 | 3300022557 | Iron-Sulfur Acid Spring | DKQDAQYKQQIADKQKALDDAKQKLDDLQEDARKAGAPTSVSEPQQQ |
| Ga0242657_10906791 | 3300022722 | Soil | QQLADKQKALDEAKQKLEDMKEEAVKAGIPSSMIE |
| Ga0224562_10163572 | 3300022733 | Soil | KEDGDYKQKIADKQKAVEDAKQKLDDLEEEARKAGVPAAMREP |
| Ga0224545_10005299 | 3300022881 | Soil | LRNQAQWDKEDADYKQKIADKQKAVEDAKQKLIDLEEEARKAGVPSAMREP |
| Ga0224551_11010952 | 3300023259 | Soil | QWDKEEGEFKQKIADKQKAVDDGKQKLDDMQEEARRAGVPAAMREP |
| Ga0209171_103732971 | 3300025320 | Iron-Sulfur Acid Spring | GEFKLKIADKQKAVDDAKQKLDDMQEEARRAGVPAAMREP |
| Ga0208936_10013921 | 3300025404 | Peatland | KEEADYKQKIADKQKALDDAKQKLEDMKEDARKAGVPSAMID |
| Ga0208193_10708842 | 3300025463 | Peatland | ADWDKQDADYKQKIADKQKAVDDAKQQLDDLEEQARKAGVPAAMREP |
| Ga0208191_11066741 | 3300025496 | Peatland | KQKIADKQKAVDDAKQKLDDLEEEARKAGVPAAMREP |
| Ga0207692_103788392 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | NRMRNAAQWDKEEANYKQQIADKQKAVDEAKQKLEDMKEEAHKAGVPSSMSE |
| Ga0207692_106206282 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | PTGFAKDDANYKQQIADKQKALDDAKAKLTDLQEEARKAGAPTSVADQN |
| Ga0207692_107310511 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | QQIAEKQKALDKAKETLDDLQEQARKAGVPSGMRE |
| Ga0207699_100931771 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | DAQYKDQLAEKQKKLEEAKKQLEDLQEQARKAGVPSSMRE |
| Ga0207699_114127811 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | NQGDWDKQDVQYKQQIADKQKSVDDAKQKLDDLREEARKAGAPTSVQEQ |
| Ga0207693_113926871 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | RNAVAWDKEDAQFKDQMSDKQKKLDDAKKQLEELQEQARRAGVPSSMRE |
| Ga0207663_100972191 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | AWDKEDAQFKDQMSDKQKKLDDAKKQLEELQEQARRAGVPSSMRE |
| Ga0207662_100160001 | 3300025918 | Switchgrass Rhizosphere | SWDKEDREYKQQIAEKEKAVADAKQKLDDMQESARKAGVPSSVRE |
| Ga0207646_107892272 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | KQKIAEKQKAVDAAKQHLDDLQEQARKAGVPSALRE |
| Ga0207665_102709491 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | KQKIADKQKALDDAKQKLEDMKEEARKAGAPASVRE |
| Ga0207702_121075412 | 3300026078 | Corn Rhizosphere | FKQQIADKQKALDQAKQTLDDLQEQARKAGVSTKDRE |
| Ga0209761_12780062 | 3300026313 | Grasslands Soil | QKIAEKQKAVDAAKQHLDDLQEQARKTGVPAAMRE |
| Ga0209471_11037491 | 3300026318 | Soil | ADDVRKNQDDVAAKQKALDDAKQKLDDMQEEARKAGTPASSRE |
| Ga0209687_11251081 | 3300026322 | Soil | NRLRNQGAWDKEDAQYKQQIEDKKKALDDARQELDDTKEKARKAGMPAGSLD |
| Ga0209161_100435271 | 3300026548 | Soil | QQIADKQKALDDAKQKLEEMQEDARKAGIPAAMREQ |
| Ga0179587_105113181 | 3300026557 | Vadose Zone Soil | KQQIADKQKALDDAKQKLEAMQEEARKAGIPAAMRE |
| Ga0207779_10358442 | 3300026928 | Tropical Forest Soil | SGDWDKQDTQYKQQIADKQKNLDDAKQKLEDMQDEARKAGVPASVREP |
| Ga0208724_10168062 | 3300027064 | Forest Soil | MRNSAEWDKQDADYKQKIADKQKAVEDAKSKLTDMQEEARKDGVPSAMVE |
| Ga0208236_10139012 | 3300027066 | Forest Soil | YGDVGNRLRNSSDWDKQDAQYKQQIADKQKLLDDARQKLEDTQEDARKAGVPDSDHQQ |
| Ga0209332_11051091 | 3300027439 | Forest Soil | DVGNRLRNSTQWDKEEATYKTQIADKQKALDDAKQKLEDMKEEAHKAGVPSSVTD |
| Ga0209734_10561641 | 3300027535 | Forest Soil | DWDKQDAQYKQQIADKQKALDDAKQKLEDLQEEARKAGAPASVSEQ |
| Ga0208043_12009911 | 3300027570 | Peatlands Soil | QYKQKIAEKKKAADDAKQALDDMQEDARKAGVPASVREATAAPE |
| Ga0209329_10988542 | 3300027605 | Forest Soil | ADVGNRLRNSTQWDKEEGEFKQKIADKQKAVEDAKQKLADMQEEARKAGVPSSVSE |
| Ga0209221_11153462 | 3300027609 | Forest Soil | AEWDKEDADYKQKIADKQKTLDTAKQKLSDMQEEARKDGVPSAMVD |
| Ga0208827_10054318 | 3300027641 | Peatlands Soil | QYKQQIADKQKALDDAKQKLDDMQEDARKAGVPNSVSQP |
| Ga0209655_102989941 | 3300027767 | Bog Forest Soil | MRNSADWDKQDADYKQKIADKQKAVEEAKSKLTDMQEEARKDGVPSAMVD |
| Ga0209139_103308042 | 3300027795 | Bog Forest Soil | LRNSGNWDKEDADYKQKIEQKKKALDDAKKDLDDMQEDARKAGVPSSVRE |
| Ga0209656_103026992 | 3300027812 | Bog Forest Soil | QWDKEEAEYKQKIADRHKAVDDAKQKLEDMKEEARKAGVPSAMID |
| Ga0209580_101107911 | 3300027842 | Surface Soil | YKQQIADKQKSLDDAKEKLADMQEQARKAGMPESTQQQ |
| Ga0209180_100472862 | 3300027846 | Vadose Zone Soil | AGSRLRNQGSWDKEDAQYKQQIAQKQKAVDDAQKALDDMKEQGRKAGVPAGDRQ |
| Ga0209180_105540052 | 3300027846 | Vadose Zone Soil | AGPWDKQDAQYKQDIDAKQKALDAAKQKLDDLQEQARKAEVPSSVRE |
| Ga0209274_105315101 | 3300027853 | Soil | TDYKQKIADKLKAVDDAKQKLDDLQEEARKAGVPSNMREP |
| Ga0209579_100262876 | 3300027869 | Surface Soil | QYKQQIADKQKAVDDAKQKLDDMQEEARKAGMPASVSEQQ |
| Ga0209465_101645171 | 3300027874 | Tropical Forest Soil | KQQIADKQKALEDAKQKLEELQEQARKAGVPSSIREP |
| Ga0209169_101720153 | 3300027879 | Soil | EGEFKQKIGDKQKAVDDGKQKLDDMQEEARRAGVPAAMREP |
| Ga0209275_102671421 | 3300027884 | Soil | GNRLRNSSDWDKQDAQYKQQIADKQKLLDDARQKLEDTQEDARKAGVPDSDHQQ |
| Ga0209380_108693342 | 3300027889 | Soil | EAQWDKQDAEYKQKIADKQKAVDDAKQRLTDMQEEARKAGVPSSMLD |
| Ga0209068_101252461 | 3300027894 | Watersheds | EDTQYKDQIAAKQKQLEDAKKQLEDMQEEARKAGVPSSMRE |
| Ga0209624_1000076827 | 3300027895 | Forest Soil | QIADKQKALDDAKQKLDDQQEEARKAGVRASTPEPSEPVQTNPPSQQ |
| Ga0209415_1001533014 | 3300027905 | Peatlands Soil | KQDAQYKQQIADKQKALDDAKQKLDDMIEDARKAGVPSSVAEP |
| Ga0209415_100576431 | 3300027905 | Peatlands Soil | KQDAQYKQQIADKQKALDDAKQKLDDMQEDARKAGVPAAVRETAQPAQQ |
| Ga0209006_101546811 | 3300027908 | Forest Soil | NRMRNSADWDKQDADYKQKIADKQKAVEDAKQKLDDMQEDARKAGVPASMREPGQ |
| Ga0209583_101397822 | 3300027910 | Watersheds | LRNSGTWDKEDATYKQQIDQKQKALDDAKKALSDTQEQARKAGVPARARE |
| Ga0209698_100913111 | 3300027911 | Watersheds | DREDASYREKIDKKQKEVDSAKAKLEDMQEQARRAGVPAAFRE |
| Ga0209698_101231873 | 3300027911 | Watersheds | NSGDWDKQDADYKQQIADKEKALEDAKQKLDDMQEDARKAGVPASSREP |
| Ga0209168_101817371 | 3300027986 | Surface Soil | NSWDKEDADYKKKIDDKKKAADAAKQEFEDMQEDARKAGVPSSVRE |
| Ga0265354_10169931 | 3300028016 | Rhizosphere | IEEKKKAADDAKQELDDMQEDARKAGVPSSVRESSTGQQ |
| Ga0209526_106202941 | 3300028047 | Forest Soil | DKQDAEYKQKIADKQKAVDEGKQKLDDMKEEARKAGVPSAMIE |
| Ga0302162_101113101 | 3300028649 | Fen | NSGNWDKEDEGYKKQIADKQKAVDDAKQQLDDMQEQARKAGVPAKVRE |
| Ga0302219_100040411 | 3300028747 | Palsa | MRNATQWDKEEADYKQKIADKQKALDDAKQKLEDMKEDARKAGVPSAMID |
| Ga0302156_104807142 | 3300028748 | Bog | QLPWDKEDADYKQKIADKQKALEDAKQKLTDMQEEARKAGVPSNMIPD |
| Ga0302156_105032531 | 3300028748 | Bog | DYKQKIADKQKALDDAKQKLEDMKEDARKAGVPSAMID |
| Ga0302227_101776301 | 3300028795 | Palsa | RNATQWDKEEADYKQKIADKQKALDDAKQKLEDMKEDARKAGVPSAMID |
| Ga0265338_102929683 | 3300028800 | Rhizosphere | ADVGNRMRNSADWDKQDAQYKQQIADKQKALDDAKQKLEDLQEEARKAGAPASVRE |
| Ga0307305_104352922 | 3300028807 | Soil | GNRLRNAGSWDKEDAQYKQQLAEKQKTLDTAKEELQDSRERARKAGVPSSMIP |
| Ga0302228_103812222 | 3300028808 | Palsa | AAAMYADVGNRMRNAAQWDKEDADYKQKIADKQKALEDAKQQLDNMQEEARKAGVPAAMR |
| Ga0308309_107976291 | 3300028906 | Soil | RNSGSWDTQDAQYKQQIADKQKALEDAKQKIDDLQEQARKAGAPVSTPEP |
| Ga0308309_115385701 | 3300028906 | Soil | KKIEEKKKAVDEAKQQMDDMQEEARKAGVPASVRESTGDQP |
| Ga0308309_116829842 | 3300028906 | Soil | GNRLRGSGTWDKEDAQYKQQIAQKQKAVDDAKKALDDMKEKARKAGVPAKLRE |
| Ga0311368_107821911 | 3300029882 | Palsa | KEEADYKQKTADKQKAVEDAKQKLEDMKEEARKAGVPAAMID |
| Ga0311327_105325391 | 3300029883 | Bog | ENTQYKSDIDQKQKALEDAKQKLDDMQEEARKAGASSSARE |
| Ga0311329_102680203 | 3300029907 | Bog | ADYKQKIADKQKALEDAKQKLTDMQEEARKAGVPSNMIPD |
| Ga0311341_107437381 | 3300029908 | Bog | QKIADKQKAVDDAKQRLDDMQEEARKAGVPAAMRE |
| Ga0311369_105474973 | 3300029910 | Palsa | NAAQWDKEDADYKQKIADKQKALEDAKQQLDNMQEEARKAGVPAAMRE |
| Ga0311352_102012224 | 3300029944 | Palsa | MRNAAQWDKEDADYKQKIADKQKALEDAKQQLDNMQEEARKAGVPAAMRE |
| Ga0311371_117774482 | 3300029951 | Palsa | AQWDKEDADYKQKIADKQKALEDAKQQLDNMQEEARKAGVPAAMRE |
| Ga0311343_109726621 | 3300029953 | Bog | VGNRMRNSTQWDKEDADYKQKIADKQKTVEDAKQRLDDMQEEARKAGVPAAMRE |
| Ga0311342_102625563 | 3300029955 | Bog | ATQWDKEEADYKQKIADKQKALDDAKQKLEDMKEDARKAGVPSAMID |
| Ga0302188_103335792 | 3300029986 | Bog | QKIADKQKAVDDAKQKLDDMEEEARRAGVPAAMREP |
| Ga0311339_111627761 | 3300029999 | Palsa | STAWDKQDADYKQQIADKQKALDDAKQKLDDMDEEARKAGVPNSIREP |
| Ga0302178_102730241 | 3300030013 | Palsa | KEDADFKQKIADKQKSVDDAKQKLDEMQEEARKAGVPAAMREP |
| Ga0302178_105011752 | 3300030013 | Palsa | NRLRNSGDWDKQDADYKQKIADKQKALDDAKQKLEDIQEDARKAGTPSSIREP |
| Ga0302274_103835562 | 3300030041 | Bog | KQKIADKQKAVDDAKQRLDDMQEEARKAGVPAAMRE |
| Ga0302181_104251991 | 3300030056 | Palsa | ADVGNRMRNAAQWDKEDADYKQKIADKQKALEDAKQQLDNMQEEARKAGVPAAMRE |
| Ga0311353_100399507 | 3300030399 | Palsa | VGNRMRNAAQWDKEDADYKQKIADKQKALEDAKQQLDNMQEEARKAGVPAAMRE |
| Ga0311353_107005843 | 3300030399 | Palsa | DWDKQDAQYKQQIADKQQALDDAKQKLDDLQEDARKAGVPSSVREP |
| Ga0302184_103938181 | 3300030490 | Palsa | WDKEEADYKQKIADKQKALDDAKQKLEDMKEDARKAGVPSAMID |
| Ga0311370_107567211 | 3300030503 | Palsa | QEADYKQKIADKQKAVTDAKQKLEDMEEEARKDGVPAAMREP |
| Ga0311355_100597037 | 3300030580 | Palsa | KIADKQKAVDDAKQKLDDMEEEARKAGVPAAMREP |
| Ga0311354_109107803 | 3300030618 | Palsa | AQYKQQIADKQKSIDDAKQKLDDTQEEARKAGVPSGMLD |
| Ga0310039_103032002 | 3300030706 | Peatlands Soil | NRMRNEADWDKQDAQYKQQIADKQKALDDAKQKLDDMQEDARKAGVPNSVSQP |
| Ga0302307_101641663 | 3300031233 | Palsa | KQQIADKQQALDDAKQKLDDLQEDARKAGVPSSVREP |
| Ga0318516_106184341 | 3300031543 | Soil | DKEDAQFKQQLADKQKKLDDAKQALEDLREQARKAGVPSSVRE |
| Ga0310686_1091107701 | 3300031708 | Soil | KQKIAEKKKAADAAKQQLDDMQEDARKAGVPSSVRESSTAQQ |
| Ga0310686_1156898032 | 3300031708 | Soil | LRNEANWDKQEADYKQQLEEKQKALADAKQNMEDMQEDARKSGVPSAVIENAQKPAPTNTPN |
| Ga0307476_106129432 | 3300031715 | Hardwood Forest Soil | VQWDKEEATYKQQLADKQKALDEAKQKLEDMKEEAVKAGIPSSMIE |
| Ga0310813_114911132 | 3300031716 | Soil | NRLRNSAEWDKEDRDYKAQIAQKEKSVEDAKSKLESLKEDARKDGVPNSIRE |
| Ga0307474_105901181 | 3300031718 | Hardwood Forest Soil | RLRNSGTWDKEDADYKKKIEEKKKAADAAKQELDDMQEDARKAGVPSSVRE |
| Ga0302321_1035660632 | 3300031726 | Fen | QFKQQIAQKQKDLDAAKKGLDDVQEKARKSGVPASARE |
| Ga0307477_109315581 | 3300031753 | Hardwood Forest Soil | YKQQIADKQKALDDAKQQLDDLQEQARKAGAPPSVSEQ |
| Ga0307475_102320471 | 3300031754 | Hardwood Forest Soil | KEDADYKKKIDEKKKAADAAKQALDDMQEDARKAGVPSSVRE |
| Ga0307475_102967253 | 3300031754 | Hardwood Forest Soil | QWDKQETEYKQKIADKQKAVDDAKQKLDDMEEEARKAGVPAAMREP |
| Ga0307475_104693982 | 3300031754 | Hardwood Forest Soil | STDWDKQDTQYKQQIADKQKALDEAKQKLEDTQEEARKAGVPAAVREP |
| Ga0318546_108866001 | 3300031771 | Soil | FKQQLADKQKKLDDAKQALEDLREQARKAGVPSSVRE |
| Ga0318566_102852302 | 3300031779 | Soil | QFKQQLADKQKKLDDAKQALEDLREQARKAGVPSSVRE |
| Ga0307478_100884681 | 3300031823 | Hardwood Forest Soil | TYKQQIAEKQKALDDAKQKLEDMKDEAHRAGVPSSMTE |
| Ga0310917_100134597 | 3300031833 | Soil | KEDAQFKQQLADKQKKLDDAKQALEDLREQARKAGVPSSVRE |
| Ga0307479_107911611 | 3300031962 | Hardwood Forest Soil | LRNSGSWDKEDADYKKKIDEKKKAADAAKQALDDMQEDARKAGVPSSVRE |
| Ga0307479_121811052 | 3300031962 | Hardwood Forest Soil | SAAWDKEDADYKQKIEQKKKALDDAKKELDDMQEDARKAGVPSSARE |
| Ga0318504_105112131 | 3300032063 | Soil | DAQFKQQLADKQKKLDDAKQALEDLREQARKAGVPSSVRE |
| Ga0326631_1090932 | 3300032072 | Soil | MYADVGNRMRNAAQWDKEDADFKQKIADKQKAVEDAKQKLEDMQEEARKAGVPAAMR |
| Ga0306924_111761291 | 3300032076 | Soil | NSGAWDKEDSQYKDQIAAKQKTLDDAKKALEDMQEDARKAGVPSGMRD |
| Ga0311301_105551671 | 3300032160 | Peatlands Soil | TQYKQQIADKQKALDDAKQKLDDMQEDARKAGVPASVREP |
| Ga0307471_1002111781 | 3300032180 | Hardwood Forest Soil | QYKDQLADKQKKLDEAKQALDDMQEQARKAGVPASGRE |
| Ga0307471_1030555172 | 3300032180 | Hardwood Forest Soil | KEDAQYKQQITQKQKAVDDAKKTLDDLKEQARKAGVPAKLRE |
| Ga0310812_100195801 | 3300032421 | Soil | RNQGSWDKEDAQYKQDLAKKQKALDDAKKAVDDLKEKARKAGVPSK |
| Ga0335079_101822664 | 3300032783 | Soil | AEYKKKLADAQKALDDAKQKMSDMQEDARKAGVPDSVREGDQPPQQ |
| Ga0335078_111519841 | 3300032805 | Soil | WDKDDAQYKDQIGKKQQDLDDAKKNLDDLQEQARKAGVPSSMRE |
| Ga0335080_109591121 | 3300032828 | Soil | AWDREDAQYKQNIADKQKALDAAKKSLEDMQEAARKAGVPSGMRE |
| Ga0335070_111504361 | 3300032829 | Soil | YKQQIADKQKAVEDAKQKLDDIQEEARKAGVPASMRE |
| Ga0335074_104190473 | 3300032895 | Soil | GDVGNRLRNSTDWDKQDAEYKQKIADKQKALDDAKQALESMQEDARKAGVPSAMREP |
| Ga0335083_104978563 | 3300032954 | Soil | NSADWDKQDANYKQQIADKQKAVDDAKQKLDDLQEEARKAGVPSSVREP |
| Ga0335084_110691772 | 3300033004 | Soil | EDTQFKEQIAAKQKQFEEAKKQLDDLQEQARKAGVPSSMRE |
| Ga0316212_10502192 | 3300033547 | Roots | KQQIADKQKALDDAKQKLEDVQEDARKAGAPSSVREP |
| ⦗Top⦘ |