| Basic Information | |
|---|---|
| Family ID | F009173 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 322 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MSDIALKAQEEMLFLDVSDEVLEVAAGAAKVHASFTLGSCTGLSECPG |
| Number of Associated Samples | 182 |
| Number of Associated Scaffolds | 321 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 77.95 % |
| % of genes near scaffold ends (potentially truncated) | 37.89 % |
| % of genes from short scaffolds (< 2000 bps) | 82.92 % |
| Associated GOLD sequencing projects | 169 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.21 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (51.553 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (15.528 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.025 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.068 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.37% β-sheet: 0.00% Coil/Unstructured: 52.63% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.21 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 321 Family Scaffolds |
|---|---|---|
| PF04392 | ABC_sub_bind | 4.98 |
| PF03713 | DUF305 | 4.67 |
| PF12697 | Abhydrolase_6 | 4.05 |
| PF09933 | DUF2165 | 3.43 |
| PF00211 | Guanylate_cyc | 1.87 |
| PF00027 | cNMP_binding | 1.56 |
| PF01494 | FAD_binding_3 | 1.56 |
| PF12849 | PBP_like_2 | 1.56 |
| PF13414 | TPR_11 | 1.25 |
| PF01042 | Ribonuc_L-PSP | 0.93 |
| PF13714 | PEP_mutase | 0.93 |
| PF09361 | Phasin_2 | 0.93 |
| PF12576 | DUF3754 | 0.93 |
| PF13531 | SBP_bac_11 | 0.93 |
| PF07813 | LTXXQ | 0.93 |
| PF00890 | FAD_binding_2 | 0.62 |
| PF08734 | GYD | 0.62 |
| PF00873 | ACR_tran | 0.62 |
| PF01925 | TauE | 0.62 |
| PF04828 | GFA | 0.31 |
| PF00561 | Abhydrolase_1 | 0.31 |
| PF12681 | Glyoxalase_2 | 0.31 |
| PF09594 | GT87 | 0.31 |
| PF03972 | MmgE_PrpD | 0.31 |
| PF01988 | VIT1 | 0.31 |
| PF00510 | COX3 | 0.31 |
| PF07690 | MFS_1 | 0.31 |
| PF14026 | DUF4242 | 0.31 |
| PF00083 | Sugar_tr | 0.31 |
| PF01068 | DNA_ligase_A_M | 0.31 |
| PF10604 | Polyketide_cyc2 | 0.31 |
| PF06803 | DUF1232 | 0.31 |
| PF07366 | SnoaL | 0.31 |
| PF06240 | COXG | 0.31 |
| PF12833 | HTH_18 | 0.31 |
| PF00296 | Bac_luciferase | 0.31 |
| PF01717 | Meth_synt_2 | 0.31 |
| PF09335 | SNARE_assoc | 0.31 |
| PF01842 | ACT | 0.31 |
| PF05050 | Methyltransf_21 | 0.31 |
| PF13545 | HTH_Crp_2 | 0.31 |
| PF13472 | Lipase_GDSL_2 | 0.31 |
| PF07859 | Abhydrolase_3 | 0.31 |
| PF12695 | Abhydrolase_5 | 0.31 |
| PF01734 | Patatin | 0.31 |
| PF01979 | Amidohydro_1 | 0.31 |
| PF13432 | TPR_16 | 0.31 |
| PF00497 | SBP_bac_3 | 0.31 |
| PF00033 | Cytochrome_B | 0.31 |
| PF00106 | adh_short | 0.31 |
| PF00072 | Response_reg | 0.31 |
| COG ID | Name | Functional Category | % Frequency in 321 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 4.98 |
| COG3544 | Uncharacterized conserved protein, DUF305 family | Function unknown [S] | 4.67 |
| COG3678 | Periplasmic chaperone Spy, Spy/CpxP family | Posttranslational modification, protein turnover, chaperones [O] | 3.74 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 3.12 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 1.87 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 1.56 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 1.56 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 1.56 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.93 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.62 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.62 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.31 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.31 |
| COG3427 | Carbon monoxide dehydrogenase subunit CoxG | Energy production and conversion [C] | 0.31 |
| COG3339 | Uncharacterized membrane protein YkvA, DUF1232 family | Function unknown [S] | 0.31 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.31 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.31 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.31 |
| COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 0.31 |
| COG1845 | Heme/copper-type cytochrome/quinol oxidase, subunit 3 | Energy production and conversion [C] | 0.31 |
| COG1814 | Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 family | Inorganic ion transport and metabolism [P] | 0.31 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.31 |
| COG1633 | Rubrerythrin, includes spore coat protein YhjR | Inorganic ion transport and metabolism [P] | 0.31 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.31 |
| COG1290 | Cytochrome b subunit of the bc complex | Energy production and conversion [C] | 0.31 |
| COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 0.31 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.31 |
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 0.31 |
| COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 0.31 |
| COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 0.31 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 51.55 % |
| Unclassified | root | N/A | 48.45 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2162886013|SwBSRL2_contig_11631413 | Not Available | 1668 | Open in IMG/M |
| 2162886013|SwBSRL2_contig_7585339 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 2189573004|GZGWRS401AN03W | Not Available | 506 | Open in IMG/M |
| 3300000156|NODE_c0691688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3483 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100762320 | All Organisms → cellular organisms → Bacteria | 2693 | Open in IMG/M |
| 3300000579|AP72_2010_repI_A01DRAFT_1039118 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300000580|AF_2010_repII_A01DRAFT_1000239 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7744 | Open in IMG/M |
| 3300000580|AF_2010_repII_A01DRAFT_1034183 | Not Available | 793 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10000569 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8666 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10013200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2275 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10020047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1836 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10025212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1620 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10156469 | Not Available | 546 | Open in IMG/M |
| 3300000655|AF_2010_repII_A100DRAFT_1016446 | All Organisms → cellular organisms → Bacteria | 1406 | Open in IMG/M |
| 3300000655|AF_2010_repII_A100DRAFT_1063805 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300000816|AF_2010_repII_A10DRAFT_1002605 | Not Available | 1825 | Open in IMG/M |
| 3300000816|AF_2010_repII_A10DRAFT_1008029 | Not Available | 1104 | Open in IMG/M |
| 3300000816|AF_2010_repII_A10DRAFT_1014205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. 28-YEA-48 | 838 | Open in IMG/M |
| 3300000816|AF_2010_repII_A10DRAFT_1021500 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300000955|JGI1027J12803_100825287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens | 1101 | Open in IMG/M |
| 3300000955|JGI1027J12803_102135786 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300004479|Ga0062595_100049564 | All Organisms → cellular organisms → Bacteria | 1910 | Open in IMG/M |
| 3300004479|Ga0062595_100107678 | Not Available | 1503 | Open in IMG/M |
| 3300004479|Ga0062595_100135373 | Not Available | 1399 | Open in IMG/M |
| 3300004479|Ga0062595_100938096 | Not Available | 735 | Open in IMG/M |
| 3300004633|Ga0066395_10045511 | All Organisms → cellular organisms → Bacteria | 1916 | Open in IMG/M |
| 3300004633|Ga0066395_10062771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1685 | Open in IMG/M |
| 3300005093|Ga0062594_100252009 | All Organisms → cellular organisms → Bacteria | 1292 | Open in IMG/M |
| 3300005163|Ga0066823_10007013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1510 | Open in IMG/M |
| 3300005165|Ga0066869_10006535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1484 | Open in IMG/M |
| 3300005294|Ga0065705_10013939 | All Organisms → cellular organisms → Bacteria | 2221 | Open in IMG/M |
| 3300005294|Ga0065705_10129636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2512 | Open in IMG/M |
| 3300005294|Ga0065705_10164321 | Not Available | 1752 | Open in IMG/M |
| 3300005329|Ga0070683_100218207 | Not Available | 1812 | Open in IMG/M |
| 3300005329|Ga0070683_100729761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 949 | Open in IMG/M |
| 3300005329|Ga0070683_100826247 | Not Available | 888 | Open in IMG/M |
| 3300005330|Ga0070690_100622687 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300005330|Ga0070690_101164595 | Not Available | 614 | Open in IMG/M |
| 3300005331|Ga0070670_100294271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1419 | Open in IMG/M |
| 3300005332|Ga0066388_100013153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6678 | Open in IMG/M |
| 3300005332|Ga0066388_100371743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2076 | Open in IMG/M |
| 3300005332|Ga0066388_100462626 | Not Available | 1909 | Open in IMG/M |
| 3300005332|Ga0066388_100520139 | Not Available | 1823 | Open in IMG/M |
| 3300005332|Ga0066388_100761784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1566 | Open in IMG/M |
| 3300005332|Ga0066388_101197561 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1298 | Open in IMG/M |
| 3300005332|Ga0066388_101212255 | Not Available | 1291 | Open in IMG/M |
| 3300005332|Ga0066388_101227610 | All Organisms → cellular organisms → Bacteria | 1285 | Open in IMG/M |
| 3300005332|Ga0066388_101262718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium icense | 1269 | Open in IMG/M |
| 3300005332|Ga0066388_101358809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1230 | Open in IMG/M |
| 3300005332|Ga0066388_101466251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1191 | Open in IMG/M |
| 3300005332|Ga0066388_101971869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1045 | Open in IMG/M |
| 3300005332|Ga0066388_102218371 | Not Available | 991 | Open in IMG/M |
| 3300005332|Ga0066388_102472788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aurantimonadaceae → Aureimonas | 943 | Open in IMG/M |
| 3300005332|Ga0066388_102596881 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300005332|Ga0066388_102986555 | Not Available | 864 | Open in IMG/M |
| 3300005332|Ga0066388_103873423 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300005332|Ga0066388_104140579 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 739 | Open in IMG/M |
| 3300005332|Ga0066388_104175679 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300005332|Ga0066388_104531585 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300005332|Ga0066388_105053383 | Not Available | 670 | Open in IMG/M |
| 3300005332|Ga0066388_105134612 | Not Available | 665 | Open in IMG/M |
| 3300005332|Ga0066388_105169177 | Not Available | 662 | Open in IMG/M |
| 3300005332|Ga0066388_107520582 | Not Available | 546 | Open in IMG/M |
| 3300005332|Ga0066388_108838415 | Not Available | 500 | Open in IMG/M |
| 3300005334|Ga0068869_101024542 | Not Available | 720 | Open in IMG/M |
| 3300005335|Ga0070666_10024497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3931 | Open in IMG/M |
| 3300005335|Ga0070666_10125748 | Not Available | 1780 | Open in IMG/M |
| 3300005337|Ga0070682_100044235 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2756 | Open in IMG/M |
| 3300005337|Ga0070682_100338182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 1118 | Open in IMG/M |
| 3300005340|Ga0070689_101400925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ec3.3 | 631 | Open in IMG/M |
| 3300005354|Ga0070675_100145093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2031 | Open in IMG/M |
| 3300005366|Ga0070659_102074095 | Not Available | 511 | Open in IMG/M |
| 3300005434|Ga0070709_10872289 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 710 | Open in IMG/M |
| 3300005436|Ga0070713_101311405 | Not Available | 702 | Open in IMG/M |
| 3300005438|Ga0070701_10960184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ec3.3 | 594 | Open in IMG/M |
| 3300005439|Ga0070711_100994311 | Not Available | 719 | Open in IMG/M |
| 3300005457|Ga0070662_101581279 | Not Available | 566 | Open in IMG/M |
| 3300005617|Ga0068859_100959494 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300005618|Ga0068864_102237960 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300005713|Ga0066905_101851568 | Not Available | 557 | Open in IMG/M |
| 3300005719|Ga0068861_102641568 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300005764|Ga0066903_100072332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4424 | Open in IMG/M |
| 3300005764|Ga0066903_100807408 | All Organisms → cellular organisms → Bacteria | 1679 | Open in IMG/M |
| 3300005764|Ga0066903_101066811 | All Organisms → cellular organisms → Bacteria | 1485 | Open in IMG/M |
| 3300005764|Ga0066903_101899593 | Not Available | 1140 | Open in IMG/M |
| 3300005764|Ga0066903_102285473 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
| 3300005764|Ga0066903_102447831 | Not Available | 1010 | Open in IMG/M |
| 3300005764|Ga0066903_104389449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 753 | Open in IMG/M |
| 3300005764|Ga0066903_104480387 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300005764|Ga0066903_105260172 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300005764|Ga0066903_107461747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 564 | Open in IMG/M |
| 3300005764|Ga0066903_107950539 | Not Available | 544 | Open in IMG/M |
| 3300005843|Ga0068860_100680535 | Not Available | 1038 | Open in IMG/M |
| 3300005843|Ga0068860_101731132 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300006047|Ga0075024_100772393 | Not Available | 535 | Open in IMG/M |
| 3300006172|Ga0075018_10042090 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1870 | Open in IMG/M |
| 3300006175|Ga0070712_101148077 | Not Available | 675 | Open in IMG/M |
| 3300006237|Ga0097621_100090421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2561 | Open in IMG/M |
| 3300006755|Ga0079222_10162758 | Not Available | 1287 | Open in IMG/M |
| 3300006852|Ga0075433_11947070 | Not Available | 504 | Open in IMG/M |
| 3300006854|Ga0075425_100116983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3041 | Open in IMG/M |
| 3300006854|Ga0075425_100140053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2768 | Open in IMG/M |
| 3300006854|Ga0075425_100463866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1458 | Open in IMG/M |
| 3300006871|Ga0075434_101031556 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300006903|Ga0075426_11154565 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300007076|Ga0075435_100099742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2405 | Open in IMG/M |
| 3300007076|Ga0075435_101203686 | Not Available | 663 | Open in IMG/M |
| 3300009094|Ga0111539_12661458 | Not Available | 580 | Open in IMG/M |
| 3300009098|Ga0105245_11737755 | Not Available | 676 | Open in IMG/M |
| 3300009101|Ga0105247_10225503 | Not Available | 1270 | Open in IMG/M |
| 3300009101|Ga0105247_11640330 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300009148|Ga0105243_10115688 | Not Available | 2252 | Open in IMG/M |
| 3300009148|Ga0105243_10122704 | All Organisms → cellular organisms → Bacteria | 2193 | Open in IMG/M |
| 3300009156|Ga0111538_10305550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2013 | Open in IMG/M |
| 3300009156|Ga0111538_11959905 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300009156|Ga0111538_13661637 | Not Available | 532 | Open in IMG/M |
| 3300009162|Ga0075423_10814148 | Not Available | 988 | Open in IMG/M |
| 3300009162|Ga0075423_12487030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 565 | Open in IMG/M |
| 3300009177|Ga0105248_11058095 | Not Available | 917 | Open in IMG/M |
| 3300009545|Ga0105237_10317966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1560 | Open in IMG/M |
| 3300009553|Ga0105249_10513364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1245 | Open in IMG/M |
| 3300009553|Ga0105249_13062895 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300009792|Ga0126374_11202565 | Not Available | 607 | Open in IMG/M |
| 3300009792|Ga0126374_11447139 | Not Available | 562 | Open in IMG/M |
| 3300010043|Ga0126380_10099665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1739 | Open in IMG/M |
| 3300010043|Ga0126380_10772868 | Not Available | 782 | Open in IMG/M |
| 3300010046|Ga0126384_10024451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 3937 | Open in IMG/M |
| 3300010046|Ga0126384_11453932 | Not Available | 641 | Open in IMG/M |
| 3300010046|Ga0126384_11950484 | Not Available | 561 | Open in IMG/M |
| 3300010047|Ga0126382_10003699 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6660 | Open in IMG/M |
| 3300010047|Ga0126382_10577892 | Not Available | 920 | Open in IMG/M |
| 3300010047|Ga0126382_11487375 | Not Available | 622 | Open in IMG/M |
| 3300010048|Ga0126373_12046546 | Not Available | 635 | Open in IMG/M |
| 3300010154|Ga0127503_10867188 | Not Available | 649 | Open in IMG/M |
| 3300010358|Ga0126370_10076986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2227 | Open in IMG/M |
| 3300010358|Ga0126370_10583109 | Not Available | 962 | Open in IMG/M |
| 3300010359|Ga0126376_10032510 | All Organisms → cellular organisms → Bacteria | 3544 | Open in IMG/M |
| 3300010359|Ga0126376_11024031 | Not Available | 828 | Open in IMG/M |
| 3300010359|Ga0126376_13028399 | Not Available | 519 | Open in IMG/M |
| 3300010360|Ga0126372_10794119 | Not Available | 937 | Open in IMG/M |
| 3300010360|Ga0126372_12163520 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 605 | Open in IMG/M |
| 3300010360|Ga0126372_12736082 | Not Available | 545 | Open in IMG/M |
| 3300010361|Ga0126378_10059726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3600 | Open in IMG/M |
| 3300010362|Ga0126377_10089084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2789 | Open in IMG/M |
| 3300010362|Ga0126377_10619624 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
| 3300010362|Ga0126377_11077170 | Not Available | 872 | Open in IMG/M |
| 3300010366|Ga0126379_10124461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 2349 | Open in IMG/M |
| 3300010366|Ga0126379_10267966 | All Organisms → cellular organisms → Bacteria | 1694 | Open in IMG/M |
| 3300010366|Ga0126379_10579824 | Not Available | 1205 | Open in IMG/M |
| 3300010366|Ga0126379_11555342 | Not Available | 767 | Open in IMG/M |
| 3300010371|Ga0134125_10330948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 1691 | Open in IMG/M |
| 3300010375|Ga0105239_10791780 | Not Available | 1086 | Open in IMG/M |
| 3300010376|Ga0126381_100045233 | All Organisms → cellular organisms → Bacteria | 5356 | Open in IMG/M |
| 3300010376|Ga0126381_102591790 | Not Available | 726 | Open in IMG/M |
| 3300010396|Ga0134126_13062206 | Not Available | 504 | Open in IMG/M |
| 3300010397|Ga0134124_11021050 | Not Available | 840 | Open in IMG/M |
| 3300010397|Ga0134124_11065441 | Not Available | 823 | Open in IMG/M |
| 3300010398|Ga0126383_10288244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1633 | Open in IMG/M |
| 3300010398|Ga0126383_11482181 | Not Available | 768 | Open in IMG/M |
| 3300010398|Ga0126383_12261987 | Not Available | 630 | Open in IMG/M |
| 3300010398|Ga0126383_12336484 | Not Available | 620 | Open in IMG/M |
| 3300010398|Ga0126383_12350570 | Not Available | 618 | Open in IMG/M |
| 3300010400|Ga0134122_10601690 | Not Available | 1016 | Open in IMG/M |
| 3300010400|Ga0134122_11235254 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300010403|Ga0134123_11465758 | Not Available | 725 | Open in IMG/M |
| 3300010403|Ga0134123_12206908 | Not Available | 613 | Open in IMG/M |
| 3300011119|Ga0105246_10412092 | Not Available | 1125 | Open in IMG/M |
| 3300011119|Ga0105246_10658727 | Not Available | 912 | Open in IMG/M |
| 3300012487|Ga0157321_1022360 | Not Available | 589 | Open in IMG/M |
| 3300012491|Ga0157329_1016472 | Not Available | 650 | Open in IMG/M |
| 3300012492|Ga0157335_1017783 | Not Available | 647 | Open in IMG/M |
| 3300012494|Ga0157341_1014720 | Not Available | 713 | Open in IMG/M |
| 3300012498|Ga0157345_1034342 | Not Available | 583 | Open in IMG/M |
| 3300012501|Ga0157351_1044656 | Not Available | 565 | Open in IMG/M |
| 3300012514|Ga0157330_1016319 | Not Available | 798 | Open in IMG/M |
| 3300012515|Ga0157338_1011391 | Not Available | 914 | Open in IMG/M |
| 3300012937|Ga0162653_100093421 | Not Available | 501 | Open in IMG/M |
| 3300012948|Ga0126375_10023269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2935 | Open in IMG/M |
| 3300012948|Ga0126375_11169911 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300012951|Ga0164300_10360447 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300012955|Ga0164298_10262777 | Not Available | 1048 | Open in IMG/M |
| 3300012957|Ga0164303_10230758 | Not Available | 1047 | Open in IMG/M |
| 3300012958|Ga0164299_10159929 | All Organisms → cellular organisms → Bacteria | 1257 | Open in IMG/M |
| 3300012958|Ga0164299_11165077 | Not Available | 581 | Open in IMG/M |
| 3300012960|Ga0164301_10555314 | Not Available | 839 | Open in IMG/M |
| 3300012960|Ga0164301_10778872 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300012960|Ga0164301_11072170 | Not Available | 638 | Open in IMG/M |
| 3300012960|Ga0164301_11357352 | Not Available | 579 | Open in IMG/M |
| 3300012961|Ga0164302_10004766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4830 | Open in IMG/M |
| 3300012961|Ga0164302_10731798 | Not Available | 737 | Open in IMG/M |
| 3300012961|Ga0164302_11548019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → unclassified Paraburkholderia → Paraburkholderia sp. CI2 | 549 | Open in IMG/M |
| 3300012971|Ga0126369_10232856 | Not Available | 1800 | Open in IMG/M |
| 3300012971|Ga0126369_10247065 | All Organisms → cellular organisms → Bacteria | 1753 | Open in IMG/M |
| 3300012971|Ga0126369_11850898 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300012985|Ga0164308_10997094 | Not Available | 744 | Open in IMG/M |
| 3300012985|Ga0164308_11659184 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300012986|Ga0164304_10613618 | Not Available | 814 | Open in IMG/M |
| 3300012986|Ga0164304_11380279 | Not Available | 578 | Open in IMG/M |
| 3300012987|Ga0164307_10368535 | Not Available | 1048 | Open in IMG/M |
| 3300012987|Ga0164307_10841187 | Not Available | 733 | Open in IMG/M |
| 3300012987|Ga0164307_11199498 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300012987|Ga0164307_11590679 | Not Available | 553 | Open in IMG/M |
| 3300012989|Ga0164305_10077065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2060 | Open in IMG/M |
| 3300013296|Ga0157374_10102435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2746 | Open in IMG/M |
| 3300013296|Ga0157374_11583157 | Not Available | 679 | Open in IMG/M |
| 3300013297|Ga0157378_11370904 | Not Available | 749 | Open in IMG/M |
| 3300013297|Ga0157378_12477319 | Not Available | 571 | Open in IMG/M |
| 3300013306|Ga0163162_10211847 | Not Available | 2068 | Open in IMG/M |
| 3300013306|Ga0163162_10907111 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
| 3300013308|Ga0157375_11848551 | Not Available | 716 | Open in IMG/M |
| 3300014745|Ga0157377_10874013 | Not Available | 670 | Open in IMG/M |
| 3300014968|Ga0157379_11625267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 631 | Open in IMG/M |
| 3300014969|Ga0157376_10120441 | All Organisms → cellular organisms → Bacteria | 2325 | Open in IMG/M |
| 3300015371|Ga0132258_10569197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2841 | Open in IMG/M |
| 3300015371|Ga0132258_10648974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2654 | Open in IMG/M |
| 3300015371|Ga0132258_11123806 | All Organisms → cellular organisms → Bacteria | 1986 | Open in IMG/M |
| 3300015371|Ga0132258_11740448 | All Organisms → cellular organisms → Bacteria | 1572 | Open in IMG/M |
| 3300015371|Ga0132258_12063989 | Not Available | 1433 | Open in IMG/M |
| 3300015372|Ga0132256_102921374 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300015373|Ga0132257_103828243 | Not Available | 547 | Open in IMG/M |
| 3300015373|Ga0132257_104209991 | Not Available | 523 | Open in IMG/M |
| 3300015374|Ga0132255_102127571 | Not Available | 855 | Open in IMG/M |
| 3300015374|Ga0132255_104094926 | Not Available | 619 | Open in IMG/M |
| 3300017947|Ga0187785_10067004 | Not Available | 1378 | Open in IMG/M |
| 3300017974|Ga0187777_10090363 | Not Available | 2002 | Open in IMG/M |
| 3300017974|Ga0187777_10116010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1769 | Open in IMG/M |
| 3300018028|Ga0184608_10285845 | Not Available | 725 | Open in IMG/M |
| 3300018058|Ga0187766_10873377 | Not Available | 633 | Open in IMG/M |
| 3300018060|Ga0187765_10009990 | All Organisms → cellular organisms → Bacteria | 4247 | Open in IMG/M |
| 3300018081|Ga0184625_10198914 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
| 3300021344|Ga0193719_10115608 | Not Available | 1167 | Open in IMG/M |
| 3300021560|Ga0126371_10002400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 16131 | Open in IMG/M |
| 3300021560|Ga0126371_10064293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3549 | Open in IMG/M |
| 3300021560|Ga0126371_10198056 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2102 | Open in IMG/M |
| 3300021560|Ga0126371_10444256 | Not Available | 1442 | Open in IMG/M |
| 3300021560|Ga0126371_11123696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 924 | Open in IMG/M |
| 3300021560|Ga0126371_11296279 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300021560|Ga0126371_11314033 | Not Available | 856 | Open in IMG/M |
| 3300021560|Ga0126371_11314033 | Not Available | 856 | Open in IMG/M |
| 3300021560|Ga0126371_12093044 | Not Available | 682 | Open in IMG/M |
| 3300021560|Ga0126371_12856225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 586 | Open in IMG/M |
| 3300021560|Ga0126371_12889400 | Not Available | 582 | Open in IMG/M |
| 3300021951|Ga0222624_1198301 | Not Available | 565 | Open in IMG/M |
| 3300022756|Ga0222622_10611685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 787 | Open in IMG/M |
| 3300025899|Ga0207642_10337543 | Not Available | 885 | Open in IMG/M |
| 3300025900|Ga0207710_10048091 | Not Available | 1908 | Open in IMG/M |
| 3300025905|Ga0207685_10655632 | Not Available | 568 | Open in IMG/M |
| 3300025906|Ga0207699_10284028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ec3.3 | 1151 | Open in IMG/M |
| 3300025915|Ga0207693_10039291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3726 | Open in IMG/M |
| 3300025919|Ga0207657_10506733 | Not Available | 945 | Open in IMG/M |
| 3300025920|Ga0207649_11368279 | Not Available | 560 | Open in IMG/M |
| 3300025933|Ga0207706_11124685 | Not Available | 655 | Open in IMG/M |
| 3300025935|Ga0207709_11115834 | Not Available | 648 | Open in IMG/M |
| 3300025936|Ga0207670_11115031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ec3.3 | 666 | Open in IMG/M |
| 3300025942|Ga0207689_10155214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1887 | Open in IMG/M |
| 3300025945|Ga0207679_11739114 | Not Available | 570 | Open in IMG/M |
| 3300025945|Ga0207679_12021407 | Not Available | 524 | Open in IMG/M |
| 3300025972|Ga0207668_11228645 | Not Available | 674 | Open in IMG/M |
| 3300026088|Ga0207641_10626430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ec3.3 | 1055 | Open in IMG/M |
| 3300026095|Ga0207676_10136373 | All Organisms → cellular organisms → Bacteria | 2094 | Open in IMG/M |
| 3300026095|Ga0207676_10729834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 962 | Open in IMG/M |
| 3300026142|Ga0207698_12455110 | Not Available | 532 | Open in IMG/M |
| 3300027874|Ga0209465_10005877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5360 | Open in IMG/M |
| 3300027874|Ga0209465_10005966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 5325 | Open in IMG/M |
| 3300027874|Ga0209465_10074652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1646 | Open in IMG/M |
| 3300027874|Ga0209465_10092247 | Not Available | 1481 | Open in IMG/M |
| 3300027874|Ga0209465_10230251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. 28-YEA-48 | 926 | Open in IMG/M |
| 3300027915|Ga0209069_10602901 | Not Available | 633 | Open in IMG/M |
| 3300031170|Ga0307498_10000496 | All Organisms → cellular organisms → Bacteria | 5138 | Open in IMG/M |
| 3300031199|Ga0307495_10037271 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 931 | Open in IMG/M |
| 3300031226|Ga0307497_10045231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas taxi | 1517 | Open in IMG/M |
| 3300031231|Ga0170824_108061240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1175 | Open in IMG/M |
| 3300031538|Ga0310888_10333811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ec3.3 | 875 | Open in IMG/M |
| 3300031545|Ga0318541_10076250 | Not Available | 1767 | Open in IMG/M |
| 3300031546|Ga0318538_10006402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4576 | Open in IMG/M |
| 3300031546|Ga0318538_10284076 | Not Available | 891 | Open in IMG/M |
| 3300031547|Ga0310887_10375704 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300031564|Ga0318573_10135710 | All Organisms → cellular organisms → Bacteria | 1284 | Open in IMG/M |
| 3300031573|Ga0310915_10362209 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
| 3300031719|Ga0306917_10000703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 14649 | Open in IMG/M |
| 3300031720|Ga0307469_11133881 | Not Available | 736 | Open in IMG/M |
| 3300031740|Ga0307468_100269079 | Not Available | 1213 | Open in IMG/M |
| 3300031740|Ga0307468_100555655 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300031740|Ga0307468_101153209 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300031744|Ga0306918_10064862 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2484 | Open in IMG/M |
| 3300031748|Ga0318492_10553969 | Not Available | 612 | Open in IMG/M |
| 3300031793|Ga0318548_10040287 | Not Available | 2094 | Open in IMG/M |
| 3300031793|Ga0318548_10586456 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300031798|Ga0318523_10692373 | Not Available | 500 | Open in IMG/M |
| 3300031854|Ga0310904_10294479 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300031879|Ga0306919_10061780 | All Organisms → cellular organisms → Bacteria | 2521 | Open in IMG/M |
| 3300031892|Ga0310893_10366794 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300031893|Ga0318536_10395289 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300031896|Ga0318551_10248557 | Not Available | 993 | Open in IMG/M |
| 3300031897|Ga0318520_10251413 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
| 3300031908|Ga0310900_10030548 | All Organisms → cellular organisms → Bacteria | 2977 | Open in IMG/M |
| 3300031908|Ga0310900_10508762 | Not Available | 937 | Open in IMG/M |
| 3300031913|Ga0310891_10194396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 679 | Open in IMG/M |
| 3300031940|Ga0310901_10255194 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300031943|Ga0310885_10460972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium | 687 | Open in IMG/M |
| 3300031944|Ga0310884_10042003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2004 | Open in IMG/M |
| 3300031959|Ga0318530_10454576 | Not Available | 532 | Open in IMG/M |
| 3300032003|Ga0310897_10048834 | Not Available | 1518 | Open in IMG/M |
| 3300032012|Ga0310902_11088504 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300032013|Ga0310906_10483163 | Not Available | 835 | Open in IMG/M |
| 3300032013|Ga0310906_10754047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 684 | Open in IMG/M |
| 3300032039|Ga0318559_10362731 | Not Available | 675 | Open in IMG/M |
| 3300032041|Ga0318549_10351690 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300032042|Ga0318545_10378270 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300032042|Ga0318545_10393715 | Not Available | 500 | Open in IMG/M |
| 3300032044|Ga0318558_10299397 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300032044|Ga0318558_10682369 | Not Available | 513 | Open in IMG/M |
| 3300032051|Ga0318532_10283665 | Not Available | 588 | Open in IMG/M |
| 3300032066|Ga0318514_10104596 | All Organisms → cellular organisms → Bacteria | 1439 | Open in IMG/M |
| 3300032067|Ga0318524_10059194 | All Organisms → cellular organisms → Bacteria | 1841 | Open in IMG/M |
| 3300032090|Ga0318518_10102635 | All Organisms → cellular organisms → Bacteria | 1428 | Open in IMG/M |
| 3300032122|Ga0310895_10022068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2072 | Open in IMG/M |
| 3300032174|Ga0307470_10329721 | Not Available | 1049 | Open in IMG/M |
| 3300032174|Ga0307470_11416289 | Not Available | 574 | Open in IMG/M |
| 3300032179|Ga0310889_10333105 | Not Available | 740 | Open in IMG/M |
| 3300032180|Ga0307471_102419918 | Not Available | 664 | Open in IMG/M |
| 3300032205|Ga0307472_100061114 | Not Available | 2407 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 15.53% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 13.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.07% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.97% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 4.66% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.35% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.48% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.48% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.48% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.48% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.17% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.17% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.79% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.86% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.55% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.55% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.55% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.24% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.24% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.62% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.62% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.31% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.31% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.31% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.31% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.31% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.31% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.31% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.31% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.31% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.31% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.31% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.31% |
| Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.31% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2162886013 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 2189573004 | Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen) | Environmental | Open in IMG/M |
| 3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000579 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01 | Environmental | Open in IMG/M |
| 3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
| 3300000816 | Forest soil microbial communities from Amazon forest - 2010 replicate II A10 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
| 3300005165 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012487 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 | Host-Associated | Open in IMG/M |
| 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Host-Associated | Open in IMG/M |
| 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Host-Associated | Open in IMG/M |
| 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Host-Associated | Open in IMG/M |
| 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Host-Associated | Open in IMG/M |
| 3300012501 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.170610 | Environmental | Open in IMG/M |
| 3300012514 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.old.130510 | Environmental | Open in IMG/M |
| 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012937 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021951 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
| 3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| SwBSRL2_0983.00003110 | 2162886013 | Switchgrass Rhizosphere | MTDIVMKAQEGAFSFDVSDETLEAAAGAAKIGASFTLGSCTGLSECPARPT |
| SwBSRL2_0139.00006130 | 2162886013 | Switchgrass Rhizosphere | MTDIVLKAQEEILFLYVSDEALEVAAGAAKVHASFTLGS |
| FG2_08268860 | 2189573004 | Grass Soil | MTDIALKAQEDLLCFDVSDEALEVAAGAARIGASFTLGSCTGLSECPG |
| NODE_06916884 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | MTDIVLKAQDETLSFDVSDETLEVAAGAAKIGASFTLGACTGLSECPARPN* |
| INPhiseqgaiiFebDRAFT_1007623207 | 3300000364 | Soil | MTDIAQSAQEEILFLNISDEVLEIAAGALKVHAIFTLGSCTGLSECPG* |
| AP72_2010_repI_A01DRAFT_10391182 | 3300000579 | Forest Soil | MTDIALKAEKEMFFLDVSDEALEIAAGAANGQNNFTLGACTGLSECPG |
| AF_2010_repII_A01DRAFT_100023918 | 3300000580 | Forest Soil | MMTDITLKAQEEITFFDVADETLEIAGGATNTHASFTLGSCTGLSECPGLPA* |
| AF_2010_repII_A01DRAFT_10341832 | 3300000580 | Forest Soil | MTDIVIKAQEETLSFDVSDETLEAAAGAAKIGASFTLGSCTGLSECPARPA* |
| AF_2010_repII_A1DRAFT_100005699 | 3300000597 | Forest Soil | MTDITLKAQEEITFFDVADETLEIAGGATNTHASFTLGSCTGLSECPGLPA* |
| AF_2010_repII_A1DRAFT_100132002 | 3300000597 | Forest Soil | MTDMILKAQEEILFLHVSDEALEVAAGAAKVHSSFTLGSCTGLSECPGRPA* |
| AF_2010_repII_A1DRAFT_100200473 | 3300000597 | Forest Soil | MTEIAPKEQEEILFSDVFDEVLEVAGGAAKVHASFTLGSCTGLSECPG* |
| AF_2010_repII_A1DRAFT_100252121 | 3300000597 | Forest Soil | MTGIAQKAREEILLDVSDEALEGAAKVYASFTLGSCTGLSECPGSPA* |
| AF_2010_repII_A1DRAFT_101564691 | 3300000597 | Forest Soil | GRGANKRINVMTDIAQKAQEEIIFDVSDEALEVAADAAKVHASFTLGSCTGLSECPGSPA |
| AF_2010_repII_A100DRAFT_10164463 | 3300000655 | Forest Soil | MNVMSDNALKAQDEMLFLEVSDEVLELAAGAAKVHASFTLGSCTGLSECPG* |
| AF_2010_repII_A100DRAFT_10638052 | 3300000655 | Forest Soil | IGKGANKRTNVMTDMILKAQEEILFLHVSDEALEVAAGAAKVHSSFTLGSCTGLSECPGRPA* |
| AF_2010_repII_A10DRAFT_10026054 | 3300000816 | Forest Soil | MLDRGVTKRTNAMTEIAPKEQEELLFSEVFDEVLEVAGGAAKVHASFTLGSCTGLSECPG |
| AF_2010_repII_A10DRAFT_10080293 | 3300000816 | Forest Soil | MTDIAQSAQEEILFLNISDEVLEIAAGALKIHASFTLGACTGLSECPG* |
| AF_2010_repII_A10DRAFT_10142052 | 3300000816 | Forest Soil | AQKAQEEIIFDVSDEALEVAADAAKVHASFTLGSCTGLSECPGSPA* |
| AF_2010_repII_A10DRAFT_10215001 | 3300000816 | Forest Soil | MSDIALKAHEEMLFLDVPVSDEVLEVAAGAEKVQVSFTLGSCTGLSECPG* |
| JGI1027J12803_1008252872 | 3300000955 | Soil | MKDIAIEVQEKLLFLDVSDEALEVAAGAAKIHASFTLGSCTGLSECPGRPA* |
| JGI1027J12803_1021357861 | 3300000955 | Soil | MTDIAQKAQEVALLDVSDEALEVAAGAAKVHASFTLGSCTGLSECPGSPA* |
| Ga0062595_1000495642 | 3300004479 | Soil | MSDIALKAQEEMLFSDVSDEVLEVVAGAAKVHASFTLGSCTGLSECPG* |
| Ga0062595_1001076782 | 3300004479 | Soil | MTDIALKAQDEILSFDVSDEALEVAAGATRIGASFTLGSCTGLSECPG* |
| Ga0062595_1001353732 | 3300004479 | Soil | MTDIAQIAKEEILFLDISDEVLEIAAGALKVHASFTLGSCTGLSECPG* |
| Ga0062595_1009380962 | 3300004479 | Soil | MTQEELLFVDVPDETLEVAAGAAKIHASFTLGSCTGLSECPGLPV* |
| Ga0066395_100455111 | 3300004633 | Tropical Forest Soil | MMNIMSDITLKAQEEMLFLDVSDEVLELAAGAAKIHASFTLGSCTGLSECPG* |
| Ga0066395_100627712 | 3300004633 | Tropical Forest Soil | MTDIVLKAQEEILFLHVSDEALEVAAGAAKVHSSFTLGSCTGLSECPGRPA* |
| Ga0062594_1002520092 | 3300005093 | Soil | MTDIVQKGQEEILLDISDEALEVAAGAAKVHASFTLGSCTGLSECPGSPA* |
| Ga0066823_100070134 | 3300005163 | Soil | LKAQEETLCFDISDETLEVAAGVTKLGASFTLGSCTGLSECPA* |
| Ga0066869_100065354 | 3300005165 | Soil | MTDIALKAQEETLCFDISDETLEVAAGVTKLGASFTLGSCTGLSECPA* |
| Ga0065705_100139396 | 3300005294 | Switchgrass Rhizosphere | MTDLVQKGQEEILLDVSDEALEVAAGAAKVHASFTLGSCTGLSECPSSPD* |
| Ga0065705_101296364 | 3300005294 | Switchgrass Rhizosphere | MKDIAIEVQEKLLFLDVSDEALEVAAGAARVQASFTLGSCTGLSECPGLPA* |
| Ga0065705_101643213 | 3300005294 | Switchgrass Rhizosphere | MTDIARKAQEDLLFFDVSDDALEVAAGAARIGASFTLGSCTGLSECPG* |
| Ga0070683_1002182073 | 3300005329 | Corn Rhizosphere | MTDIALKAQEETLSFDISDETLEVAAGVTKLGASFTLGSCTGLSECPA* |
| Ga0070683_1007297613 | 3300005329 | Corn Rhizosphere | MTTDIAVKVQEEILFFDVSDEVLEIAAGAASINASFTLGSCTGLSECPG* |
| Ga0070683_1008262471 | 3300005329 | Corn Rhizosphere | SGESGSNRTSTTNKRINGMTDIALKTQEDLLCFDVSDDALEVAAGVARIGASFTLGSCTGLSECPG* |
| Ga0070690_1006226872 | 3300005330 | Switchgrass Rhizosphere | MSDIALKAQEEMLFSDVSDEVLEVVAGAAKVHASFTLGSCTGLSE |
| Ga0070690_1011645952 | 3300005330 | Switchgrass Rhizosphere | KAQEETLCFDISDETLEVAAGVTKLGASFTLGSCTGLSECPA* |
| Ga0070670_1002942712 | 3300005331 | Switchgrass Rhizosphere | MTTDIAVKVQEEILSFDVSDEVLEIAAGAASINASFTLGSCTGLSECPG* |
| Ga0066388_1000131536 | 3300005332 | Tropical Forest Soil | MTDIAQSAQEEILFLNISDEVLEIAAGALKIHASFTLGSCTGLSECPG* |
| Ga0066388_1003717434 | 3300005332 | Tropical Forest Soil | MTDIVIKAQEETLSFDVSDETLEAAAGAAKIGASFTLGSCTGLAECPARPA* |
| Ga0066388_1004626262 | 3300005332 | Tropical Forest Soil | MTDITLKTQEDVLIFDISDEVLEIAGGAARAQTNFTLGACTGLSECPGSPA* |
| Ga0066388_1005201391 | 3300005332 | Tropical Forest Soil | MTDIVMKAQEEAFSFDVSDETLEAAAGAAKLGASFTLGSCTGLSECPARPL* |
| Ga0066388_1007617841 | 3300005332 | Tropical Forest Soil | MTDITQKEQEEILLDVSDEALEVAAGAAKVHASFTLGSCTGLSECPGSPA* |
| Ga0066388_1011975612 | 3300005332 | Tropical Forest Soil | MTDIMLKTQEETLSFDVSDDVLELAGGATKEQTNFTLGSCTGLSECPG* |
| Ga0066388_1012122551 | 3300005332 | Tropical Forest Soil | RIKVMKNIAIEVQEKLLFLDVSDEALEVAAGAAKVHASFTLGSCTGLSECPGLPA* |
| Ga0066388_1012276104 | 3300005332 | Tropical Forest Soil | MTDIAMKAQEETLFFNVSDETLEAAAGATKIGASFTLGSCTGLSECPARPA* |
| Ga0066388_1012627181 | 3300005332 | Tropical Forest Soil | MTDIAQKAQEEIIFDVSDEALEVAADAAKVHASFTLGSCTGLSECPGSPA* |
| Ga0066388_1013588092 | 3300005332 | Tropical Forest Soil | MMDIAQKGQKEILSDVSDEALEIAAGAAIHASFTLGSCTGLSECPGSPA* |
| Ga0066388_1014662512 | 3300005332 | Tropical Forest Soil | MTDIALKAQEEMLSLNVSDEALEVAARAAKAHASFTLGSCTGLSECPG* |
| Ga0066388_1019718692 | 3300005332 | Tropical Forest Soil | MTEIAPKAHEEILFSEVFDEALEVAAGAAKVHASFTLGSCTGLSECPG* |
| Ga0066388_1022183711 | 3300005332 | Tropical Forest Soil | MTGIAQKAREEILLDVSDEALEVAAGAAKVYASFTLGSCTGLSECPGSPA* |
| Ga0066388_1024727882 | 3300005332 | Tropical Forest Soil | MTDIVQKAQEEIIFDVSDEALEVAADAAKIHASFTLGSCTGLSECPGSPA* |
| Ga0066388_1025968812 | 3300005332 | Tropical Forest Soil | MSDIALKAQEEMLFLDVSDEVLEVAADAAKVHASFTLGSCTGLSECPG* |
| Ga0066388_1029865551 | 3300005332 | Tropical Forest Soil | MSDKALKAQEEMLFLEVSDEVLEVAAGAVKVHASFTLGSCTGLSECPG* |
| Ga0066388_1038734231 | 3300005332 | Tropical Forest Soil | MSDIALKAQEEMLFLDVSDEELEVAAGAAKVHASFTLGSCTGLSECPG* |
| Ga0066388_1041405792 | 3300005332 | Tropical Forest Soil | MTDIVLKAQEEILFLYTSDEALEAAAGAGKVHASFTLGSCTGLSECPGRPA* |
| Ga0066388_1041756792 | 3300005332 | Tropical Forest Soil | MSDIAVKAQEETHFLDVSISDEVLEVAAGAAKVHASFTLGSCTGLSECPG* |
| Ga0066388_1045315851 | 3300005332 | Tropical Forest Soil | MTQEELLFVDVSDETLEVAAGAAKVHASFTLGSCTGLSECPGLPA* |
| Ga0066388_1050533831 | 3300005332 | Tropical Forest Soil | AQEETLCFDVSDVTLEVAAGATKLGAGFTLGSCTGLSECPA* |
| Ga0066388_1051346121 | 3300005332 | Tropical Forest Soil | MMDNTIKNEEETLAFSVSDEALEAAASATKIGASFTLGSCTGLSECPG* |
| Ga0066388_1051691771 | 3300005332 | Tropical Forest Soil | EEMLFSDVPISDEVLEVAAGAAKVRASFTLGSCTGLSECPG* |
| Ga0066388_1075205822 | 3300005332 | Tropical Forest Soil | MTDIAMSAQEETLSFIVSDETLEASAGATKIGASFTLGSCTGLSECPAQPA* |
| Ga0066388_1088384151 | 3300005332 | Tropical Forest Soil | MTNIELEAHEEILIWDASDEALEVAAGAVTVQASFTLGSCTGLSECPG* |
| Ga0068869_1010245421 | 3300005334 | Miscanthus Rhizosphere | MTDIALKAQEDLLSSDISDDALELAAGATRIGASFTLGSCTGLSECPG* |
| Ga0070666_100244971 | 3300005335 | Switchgrass Rhizosphere | MTDIALNAQEETLSFDVSDETLEVAAGAAKLGASFTLGSCTGLSECPA* |
| Ga0070666_101257484 | 3300005335 | Switchgrass Rhizosphere | MTDIAPKAQEETLCFDISDETLEVAAGVTKLGASFTLGSCTGLSECPA* |
| Ga0070682_1000442355 | 3300005337 | Corn Rhizosphere | MTDIALKAQEETLSFDVSDETLEVAAGAAKLGASFTLGSCTGLSECPA* |
| Ga0070682_1003381821 | 3300005337 | Corn Rhizosphere | NVMSDIALKAQEEMLFSDVSDEVLEVVAGAAKVHASFTLGSCTGLSECPG* |
| Ga0070689_1014009252 | 3300005340 | Switchgrass Rhizosphere | LKAQEEMLFSDVSDEVLEVVAGAAKVHASFTLGSCTGLSECPG* |
| Ga0070675_1001450932 | 3300005354 | Miscanthus Rhizosphere | MTDLVQKGQEEILLDVSDEALEVAAGAAKVHASFTLGSCTGLSECPGSPD* |
| Ga0070659_1020740951 | 3300005366 | Corn Rhizosphere | MTDIVQKGQEEILLDISDEALEVAAGAAKVHASFTLGSCTGLSECPSSPD* |
| Ga0070709_108722891 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MTDIVLKAQEEILFLYVSDEALEVAAGAAKVHASFTLGSCTGLSECPG* |
| Ga0070713_1013114051 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MTDIALKTQEDLLCFDVSDDALEVAAGVARIGASFTLGSCTGLSECPG* |
| Ga0070701_109601842 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | IALKAQEEMLFSDVSDEVLEVVAGAAKVHASFTLGSCTGLSECPG* |
| Ga0070711_1009943112 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MTDIVMKAQEGAFSFDVSDETLEAAAGAAKIGASFTLGSCTGLSECPARPT* |
| Ga0070662_1015812792 | 3300005457 | Corn Rhizosphere | MTDIAPKAQEETLCFDISDETLEVAAGVTKLGASFTLGSCTGLSERPA* |
| Ga0068859_1009594941 | 3300005617 | Switchgrass Rhizosphere | MSDIALKAQEEMLFSDVSDEVLEVVAGAAKVHASFT |
| Ga0068864_1022379602 | 3300005618 | Switchgrass Rhizosphere | MSDIALKAQEEMLFLDVSDEVLEVAAGAAKVHASFTLGSCTGLSECPG* |
| Ga0066905_1018515681 | 3300005713 | Tropical Forest Soil | KRKRMNVMSDIALKVQEEMLFLDVYVSDEVLEVAAGAAKVHFTLGSCTGLSECPG* |
| Ga0068861_1026415681 | 3300005719 | Switchgrass Rhizosphere | VMTDIVQKGQEEILLDISDEALEVAAGAAKVHASFTLGSCTGLSECPGSPA* |
| Ga0066903_1000723325 | 3300005764 | Tropical Forest Soil | MMDIAQKGQKEILSDVSDEALEIAAGAAIHASFTLGSCTGLSECPGLPA* |
| Ga0066903_1008074082 | 3300005764 | Tropical Forest Soil | MTDIALKAQEEMLFLNVSDEALEVAARAAKAHASFTLGSCTGLSECPG* |
| Ga0066903_1010668112 | 3300005764 | Tropical Forest Soil | MSDIVLKTQEEMLFLDVSDEVLEVAAGAAKVHASFTLGSCTGLSECPG* |
| Ga0066903_1018995932 | 3300005764 | Tropical Forest Soil | MTDIAQKGQEEILLDVSDEVLEVAAGATKVHASFTLGSCTGLSECPGSPA* |
| Ga0066903_1022854732 | 3300005764 | Tropical Forest Soil | MSDTALKAQEEMPFLDVSDEVLEAAAGAAKVYASFTLGSCTGLSECPG* |
| Ga0066903_1024478311 | 3300005764 | Tropical Forest Soil | MTDITQKEQEEILLDVSDEALEVAAGAAKVHASFTLGSCTGLSECPGSPT* |
| Ga0066903_1043894492 | 3300005764 | Tropical Forest Soil | MTEIVPKEQEEILFSEVFDEVLEVAAGAAKVHASFTLGSCTGLSECPG* |
| Ga0066903_1044803872 | 3300005764 | Tropical Forest Soil | MTDIAQKAQDEVLLDVSDEALEVAAGAAKVHASFTLGSCTGLSECPGSPA* |
| Ga0066903_1052601721 | 3300005764 | Tropical Forest Soil | LKAQEEMLFLDVSDEELEVAAGAAKVHASFTLGSCTGLSECPG* |
| Ga0066903_1074617472 | 3300005764 | Tropical Forest Soil | MKNIVIEVQEKLLFLDVSDEALEVAAGAAKVHASFTLGSCTGLS |
| Ga0066903_1079505392 | 3300005764 | Tropical Forest Soil | MSDIALKAQEEMPFLDVSDEVLEAAAGAAKVYASFTLGSCTGLSECPG* |
| Ga0068860_1006805351 | 3300005843 | Switchgrass Rhizosphere | KRINVMTDIALKAQEDLLSFDVSDDALEVAASAARIGASFTLGSCTGLSECPG* |
| Ga0068860_1017311322 | 3300005843 | Switchgrass Rhizosphere | KGQEEILLDISDEALEVAAGAAKVHASFTLGSCTGLSECPGSPA* |
| Ga0075024_1007723931 | 3300006047 | Watersheds | MTDIALKAQEEILSFDVSDEALEVAAGAARIGASFTLGSCTGLSECPG* |
| Ga0075018_100420902 | 3300006172 | Watersheds | MTDLALKAQEEIFSFDVSDEILEVAAGAAKLHASFTLGSCTGLSECPG* |
| Ga0070712_1011480772 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MTDIVQKGQEEILLDISDEALEVAAGAAKVHASFTLGS |
| Ga0097621_1000904212 | 3300006237 | Miscanthus Rhizosphere | MNVMSDIALKAQEEMLFSDVSDEVLEVVAGAAKVHASFTLGSCTGLSECPG* |
| Ga0079222_101627582 | 3300006755 | Agricultural Soil | MTDIALKAREETLSFDISDETLEVAAGVTKLGASFTLGSCTGLSECPA* |
| Ga0075433_119470701 | 3300006852 | Populus Rhizosphere | MKDIAIEVQEKLLFLDVSDEALEVAAGATKVHASFTLGSCTGLSEC |
| Ga0075425_1001169834 | 3300006854 | Populus Rhizosphere | MKDIAIEVQEKLLFLDVSDEALEVAAGATKVHASFTLGSCTGLSECPGLPA* |
| Ga0075425_1001400533 | 3300006854 | Populus Rhizosphere | MTEIAPKAQEEILFSEVFDEVLEVAAGAAKVHASFTLGSCTGLSECPG* |
| Ga0075425_1004638663 | 3300006854 | Populus Rhizosphere | MTDLVQKGQEEILLDVSDEALEVAAGAAKVHASFTLASCTGLSECPGSPD* |
| Ga0075434_1010315562 | 3300006871 | Populus Rhizosphere | MTDIVLKAQEEILFLYVSDEALEVAAGAAKLHASFTLGSCTG |
| Ga0075426_111545651 | 3300006903 | Populus Rhizosphere | MTDIVLKAQEEILFLYVSDEALEVAAGAAKVHASFTLGSCTG |
| Ga0075435_1000997423 | 3300007076 | Populus Rhizosphere | MTDIALNAQEETLSFDVSDETLEVAAGAAKLGASFTLGSSTGLSECPA* |
| Ga0075435_1012036862 | 3300007076 | Populus Rhizosphere | MTDIVLKAQEEILFLYVSDEALEVAAGAAKLHASFTLGSCTGLSECPG* |
| Ga0111539_126614582 | 3300009094 | Populus Rhizosphere | MTQEELLFVDVPDETLEVAAGAAKIHASFTLGSCTGLSECPGLP |
| Ga0105245_117377551 | 3300009098 | Miscanthus Rhizosphere | MTDIALKAQEDLLSFDVSDDALEVAASAARIGASFTLGSCTGLSECTG* |
| Ga0105247_102255032 | 3300009101 | Switchgrass Rhizosphere | MTDIALKAQEDLLSFDVSDDALEVAASAARIGASFTLGSCTGLSECPG* |
| Ga0105247_116403302 | 3300009101 | Switchgrass Rhizosphere | MSDIVLKAQEEMLFLDVSDEVLEVAAGAAKVHASFTLGSCTGLSECPG* |
| Ga0105243_101156882 | 3300009148 | Miscanthus Rhizosphere | MTDITLKAQEDLLSSDISDDALELAAGATRIGASFTLGSCTGLSECPG* |
| Ga0105243_101227041 | 3300009148 | Miscanthus Rhizosphere | MTDIALKAQDEILSFDVSDEALEVAAGATRIGASFTLGSCTGLSARPG* |
| Ga0111538_103055502 | 3300009156 | Populus Rhizosphere | MTDIAQSAQEEILFLDISDEVLEIAAGALKVHASFTLGSCTGLSECPG* |
| Ga0111538_119599052 | 3300009156 | Populus Rhizosphere | MTDIVQKGQEEILLDISDEALEVAAGAAKIHASFTLGSCTGLS |
| Ga0111538_136616372 | 3300009156 | Populus Rhizosphere | RKAQEDLLFFDVSDDALEVAAGAARIGASFTLGSCTGLSECPG* |
| Ga0075423_108141481 | 3300009162 | Populus Rhizosphere | MTDIALKAQEETLSFDISDETLEVAAGVTKLGTSFTLGSC |
| Ga0075423_124870301 | 3300009162 | Populus Rhizosphere | RKRIKVMKDIAIEVQEKLLFLDVSDEALEVAAGATKVHASFTLGSCTGLSECPGLPA* |
| Ga0105248_110580951 | 3300009177 | Switchgrass Rhizosphere | TKRIRVMTDIALNAQEETLSFDVSDETLEVAAGAAKLGASFTLGSCTGLSECPS* |
| Ga0105237_103179661 | 3300009545 | Corn Rhizosphere | YRGITDKRINVMTDIALKAQDEILSFDVSDEALEVAAGATRIGASFTLGSCTGLSECPG* |
| Ga0105249_105133641 | 3300009553 | Switchgrass Rhizosphere | TDKRINVMTDIALKAQDEILSFDVSDEALEVAAGATRIGASFTLGSCTGLSECPG* |
| Ga0105249_130628951 | 3300009553 | Switchgrass Rhizosphere | MSDIVLKAQEEMLFLDVSDEVLEVAAGAAKVHASFTL |
| Ga0126374_112025652 | 3300009792 | Tropical Forest Soil | MNMMTDITLKAQEEITFFDVADETLEIAGGATNTHASFTLGSCTGLSECPG* |
| Ga0126374_114471393 | 3300009792 | Tropical Forest Soil | MTDIVIKAQEETLSFDVSDETLEAAAGAAKIGASFTLGSCTGLSECPARPT* |
| Ga0126380_100996652 | 3300010043 | Tropical Forest Soil | MTDISMKKEEEILFLDVFDEALEVAAAATKVHASFTLGSCTGLSECPG* |
| Ga0126380_107728682 | 3300010043 | Tropical Forest Soil | MTDITLKTQEETLSLDVSDEVLELAGGATKEQINFTLGSCTGLSECPG* |
| Ga0126384_100244515 | 3300010046 | Tropical Forest Soil | MTDIRLKTQEDVLIFDISDEVLEIAGGAARAQTNFTLGACTGLSECPGSPA* |
| Ga0126384_114539322 | 3300010046 | Tropical Forest Soil | MNDIAMNAQEETLSFNVSDEALEAAAGATKIGASFTLGSCTGLSECPARPA* |
| Ga0126384_119504841 | 3300010046 | Tropical Forest Soil | MTGIAQKAREEILLDVSDEALEVAAGAAKVYASFTLGS |
| Ga0126382_100036993 | 3300010047 | Tropical Forest Soil | MNMMTDITLKAQEEITFFDVADETLEIAGGATNTHASFTLGSCTGLSECPGLPA* |
| Ga0126382_105778922 | 3300010047 | Tropical Forest Soil | AQKAQDEVLLDVSDEALEVAAGAAKVHASFTLGSCTGLSECPGSPT* |
| Ga0126382_114873751 | 3300010047 | Tropical Forest Soil | MTEIAPKEQEEILFSEVFDEALEVAAGAAKVHASFTLGSCTGLSECPG* |
| Ga0126373_120465461 | 3300010048 | Tropical Forest Soil | MTDIVQKAQEEIIFDVSDEALEVAADAAKIHASFTLGSCTGLSECPGSQA* |
| Ga0127503_108671882 | 3300010154 | Soil | MMDIALKAQDEILSFDVSDEALEVAAGAARTGASFTLGSCTGLSECPGRPA* |
| Ga0126370_100769863 | 3300010358 | Tropical Forest Soil | MTDMVLKAQEEILFLHVSDEALEVAAGAAKVHSSFTLGSCTGLSECPGRPA* |
| Ga0126370_105831092 | 3300010358 | Tropical Forest Soil | MTEIAPKEQEEILFSEVFDEVLEVAGGAAMVHASFTLGSCTGLSECPG* |
| Ga0126376_100325102 | 3300010359 | Tropical Forest Soil | MSDIALKAQEEMLFLEVSDEVLEVAAGAVKVHASFTLGSCTGLSECPG* |
| Ga0126376_110240312 | 3300010359 | Tropical Forest Soil | MMDIAQKGQKEILSDVSDEALEIAAGAAIHASFTLGSCT |
| Ga0126376_130283992 | 3300010359 | Tropical Forest Soil | MTEIAPKAQEEILFSDVFDEALEVAAGAAKVQASFTLGSCTGLSECPG* |
| Ga0126372_107941191 | 3300010360 | Tropical Forest Soil | MTDIVQKAQEEIIFDVSHEALEVAADAAKIHASFTLGSCTGLS |
| Ga0126372_121635201 | 3300010360 | Tropical Forest Soil | MTDIVLKAQEEILFLDVSDEALEVAAGAAKVHSSFTLGSCTGLSECPGRPA* |
| Ga0126372_127360822 | 3300010360 | Tropical Forest Soil | MNVMSDIAVKAQEETHFLDVSISDEVLEVAAGAAKVHASFTLGSCTGLSECPG* |
| Ga0126378_100597262 | 3300010361 | Tropical Forest Soil | MTEIAPKEQEEILFSEVFDEVLEVAGGAAKVHASFTLGSCTGLSECPG* |
| Ga0126377_100890844 | 3300010362 | Tropical Forest Soil | MMDIAQKEQKEILSDVSDEALEIAAGAAIHASFTLGSCTGLSECPGSPA* |
| Ga0126377_106196242 | 3300010362 | Tropical Forest Soil | MSDIALKVQEEMLFLDVYVSDEVLEVAAGAAKVHFTLGSCTGLSECPG* |
| Ga0126377_110771702 | 3300010362 | Tropical Forest Soil | MTDITQKEQEEILLDVSDEALEVAAGAAKVHASFTLGSC |
| Ga0126379_101244612 | 3300010366 | Tropical Forest Soil | MTDIVQKAQEEIIFDVSDEALEVAADAAKIHESFTLGSCTGLCECPGSPA* |
| Ga0126379_102679664 | 3300010366 | Tropical Forest Soil | MTDIVIKAQEETLFFDVSDETLEAAAGAAKIGASFTLGSCTGLSECPARPA* |
| Ga0126379_105798241 | 3300010366 | Tropical Forest Soil | MLDRGVTKRTNAMTEIAPKEQEEVLFSEVFDEVLEVAGGAAKVHASFTLGSCTGLSECPG |
| Ga0126379_115553422 | 3300010366 | Tropical Forest Soil | MTDIVMKAQEEAFSFDVSDETLEAAAGAAKLGASFTLGSCTGLSDCPARPL* |
| Ga0134125_103309483 | 3300010371 | Terrestrial Soil | NVMSDIALKAQEEMLFSDVSDEVLEVGAGAAKVHGRFTLGSCIGLSECPG* |
| Ga0105239_107917803 | 3300010375 | Corn Rhizosphere | MTDIALKAQKETLSFDVSDETLEVAAGAAKLGASFTLGSCTGLSECPA* |
| Ga0126381_1000452334 | 3300010376 | Tropical Forest Soil | MTGIAQKAQEEILLDVSDEALEVAAGAAKVYASFTLGSCTGLSECPGSPA* |
| Ga0126381_1025917902 | 3300010376 | Tropical Forest Soil | MTDIVIKAQEETLFFDVSDETLEAAAGAAKIGASFTLGSCTGLSECPAR |
| Ga0134126_130622062 | 3300010396 | Terrestrial Soil | AQIAKEEILFLDISDEVLEIAAGALKVHASFTLGSCTGLSECPG* |
| Ga0134124_110210501 | 3300010397 | Terrestrial Soil | TDIALNAQEETLSFDVSDETLEVAAGAAKLGASFTLGSCTGLSECPA* |
| Ga0134124_110654411 | 3300010397 | Terrestrial Soil | VMTDIALKAQEDLLSFDVSDDALEVAASAARIGASFTLGSCTGLSECPG* |
| Ga0126383_102882441 | 3300010398 | Tropical Forest Soil | TKRTNAMTEIAPKEQEEILFSEVFDEVLEVAGGAAMVHASFTLGSCTGLSECPG* |
| Ga0126383_114821811 | 3300010398 | Tropical Forest Soil | MTDIVLKAQDETLSFDVSDETLEVAAGAAKIGASFTLGACTGLSECPARPA* |
| Ga0126383_122619872 | 3300010398 | Tropical Forest Soil | AQGEILFSEVLDEALEVAAGAAKVHASFTLGSCTGLSECPG* |
| Ga0126383_123364841 | 3300010398 | Tropical Forest Soil | MKNIAIEVQEEATFLDVSDEALEVAAGAAKVHASFTLGSCTGLSECPGLPA* |
| Ga0126383_123505702 | 3300010398 | Tropical Forest Soil | MNVMSDIALKAQEEMLFLDVSDEELEVAAGAAKVHASFTLGSCTGLSECPG* |
| Ga0134122_106016902 | 3300010400 | Terrestrial Soil | MTDIALKAQEETLSFDISDETLEVAASVTKLGASFTLGSCTGLSECPA* |
| Ga0134122_112352541 | 3300010400 | Terrestrial Soil | IVQKGQEEILLDISDEALEVAAGAAKVHASFTLGSCTGLSECPGSPA* |
| Ga0134123_114657583 | 3300010403 | Terrestrial Soil | LEHAPTKRIRVMTDIAPKAQEETLCFDISDETLEVAAGVTKLGASFTLGSCTGLSECPA* |
| Ga0134123_122069081 | 3300010403 | Terrestrial Soil | MTDIALKAKEDLLSSDISDDALEVAAGAARIGASFTLGSCTGLSECPG* |
| Ga0105246_104120921 | 3300011119 | Miscanthus Rhizosphere | MTDIALKTQEDLLCFDVSDDALEVAAGVARIGASFTLGSCTGLS |
| Ga0105246_106587273 | 3300011119 | Miscanthus Rhizosphere | GAAISTIWTSATNKRINVMTDIALKAKEDLLSSDISDDALEVAAGATRIGASFTLGSCTGLSECPG* |
| Ga0157321_10223602 | 3300012487 | Arabidopsis Rhizosphere | AQEETLSFDISDETLEVAASVTKLGASFTLGSCTGLSECPA* |
| Ga0157329_10164721 | 3300012491 | Arabidopsis Rhizosphere | MTDIALKAQEETLSFDVSDETLEVTAGAAKLGASFTLGS |
| Ga0157335_10177832 | 3300012492 | Arabidopsis Rhizosphere | MTDIALKAQEETLSFDVSDETLEVAADAAKLGASFTLGSCTGLSECPA* |
| Ga0157341_10147201 | 3300012494 | Arabidopsis Rhizosphere | ALKTQEDLLCFDVSDDALEVAAGVARIGASFTLGSCTGLSECPG* |
| Ga0157345_10343421 | 3300012498 | Arabidopsis Rhizosphere | MTDIALKAQEETLSFDVSDETLEVAAGATKLRASFTLGSCTGLSECPA* |
| Ga0157351_10446562 | 3300012501 | Unplanted Soil | MTDIALKAQEETLSFDISDETLEVAAGVTKLGASFTLGSC |
| Ga0157330_10163191 | 3300012514 | Soil | MTDIALKAQEETLSFDISDETLEVAAGVTKLGASFT |
| Ga0157338_10113911 | 3300012515 | Arabidopsis Rhizosphere | EEIVMSDIALKAQEEMLFLDVSDEVLEVAAGAAKVHASFTLGSCTGLSECPG* |
| Ga0162653_1000934211 | 3300012937 | Soil | MTDITQKKEEETLTFDVSDEALEVAAGAAREQVNFTLGSCTGLSECPG* |
| Ga0126375_100232693 | 3300012948 | Tropical Forest Soil | MTEIAQKAQDEVLLDVSDEALEVAAGAAKVHASFTLGSCTGLSECPGSPA* |
| Ga0126375_111699111 | 3300012948 | Tropical Forest Soil | MSDIAAKAQEEMLFLDVPVSDEVLEVAAGAAKVRVKRT* |
| Ga0164300_103604472 | 3300012951 | Soil | MSDIVLKAQEEMLFLDVSDEVLEVVAGAAKVHVSFTLGSCTGLSECPG* |
| Ga0164298_102627772 | 3300012955 | Soil | MTDIALKAKEDLLSSDISDDALELAAGATRIGASFTLGSCTGLSECPG* |
| Ga0164303_102307582 | 3300012957 | Soil | MTDIALKAQEDLLFFDVSDDALEVAAGAARIGASFTLGSCTGLSECPG* |
| Ga0164299_101599292 | 3300012958 | Soil | MTDIVQKGQEEILLDVSDEALEVAAGAAKVHASFTLGSCTGLSECPGSPD* |
| Ga0164299_111650773 | 3300012958 | Soil | MTDIARKAQEDLLSFDVSDDALEVAAGAARIGASFTLGSCTGLSECPG* |
| Ga0164301_105553143 | 3300012960 | Soil | MTDIARKAQEDLLFFDVSDDALEVAAGAARIGESFTLGSCTGLSECPG* |
| Ga0164301_107788721 | 3300012960 | Soil | EKLLFLDVSDEALEVAAGAARVQASFTLGSCTGLSECPGLPA* |
| Ga0164301_110721703 | 3300012960 | Soil | MTDIALKEKEDLLSSDISDDALEVAAGATRIGASFTLGSCTGLSECPG* |
| Ga0164301_113573521 | 3300012960 | Soil | MKDIAIEVQEKFLDVSDEALEVAAGAAKVHASFTLGSCTGLSECPGRPA* |
| Ga0164302_100047664 | 3300012961 | Soil | MKDIAIEVQEKLLFLDVSDEALEVAAGAARVQASLTLGSCTGLSECRGLPA* |
| Ga0164302_107317981 | 3300012961 | Soil | MMDSALKAQDEIIPFDVSDEALEVAAGAARTGASFTLGSCTGLSECPG* |
| Ga0164302_115480191 | 3300012961 | Soil | NVMTDLVQKGQEEILLDVSDEAREVAAGAARVHASFTLGSCTGLSECPSSPD* |
| Ga0126369_102328562 | 3300012971 | Tropical Forest Soil | MTDIEIKVQKETLSFDVSDETLEAAAGAAKIGASFTLGSCTGLSDCPARPA* |
| Ga0126369_102470652 | 3300012971 | Tropical Forest Soil | MSDNAVKAQEEMLFLDVPVSDEVLEVAAGAAKVDAFTLGSCTGLSECPG* |
| Ga0126369_118508982 | 3300012971 | Tropical Forest Soil | MNMMNIMSDITLKAQEEMLFLDVSDEGLELAAGAAKIHASFTLGSCTGLSECPG* |
| Ga0164308_109970943 | 3300012985 | Soil | AQEETLSFDVSDETLEVAAGAAKLGASFTLGSCTGLSECPA* |
| Ga0164308_116591842 | 3300012985 | Soil | MTDIVLKAQEEVLFLYVSDEALEVAAGAAKVHASFTLGSCTG |
| Ga0164304_106136181 | 3300012986 | Soil | MTDIVQKGQEEILLDVSDEALEVAAGAAKVHASFTLGSCTGLSECPGSPA* |
| Ga0164304_113802792 | 3300012986 | Soil | TQEELLFVDVPDETLEVAAGAAKIHASFTLGSCTGLSECPGLPV* |
| Ga0164307_103685351 | 3300012987 | Soil | MTDIALKAQEDLLSFDVSDDALEVAAGAARIGASFTLGSCTGLSECPG* |
| Ga0164307_108411871 | 3300012987 | Soil | SSWKSTNRRIRVMTDIVMKAQEGAFSFDVSDETLEAAAGAAKIGASFTLGSCTGLSECPARPT* |
| Ga0164307_111994981 | 3300012987 | Soil | MSDIALKAQEEMLFLDVSDEVLEVAAGAAKIHASFTLGSCTGLSECPG* |
| Ga0164307_115906792 | 3300012987 | Soil | ANLIGKGANKRINVMTDIVLKAQEEILFLYVSDEALEVAAGAAKVHASFTLGSCTGLSECPG* |
| Ga0164305_100770652 | 3300012989 | Soil | MTDIAQIAKEEILFLDISDEVLEIAAGALKVHASFTLGSCTGLSECP |
| Ga0157374_101024351 | 3300013296 | Miscanthus Rhizosphere | LVQKGQEEILLDVSDEALEVAAGAAKVHASFTLGSCTGLSECPGSPA* |
| Ga0157374_115831572 | 3300013296 | Miscanthus Rhizosphere | MTDIALKAQEDLLSFDVSDDALEVAASAARIGASFT |
| Ga0157378_113709042 | 3300013297 | Miscanthus Rhizosphere | MTDIALKAQEETLSFNVSEETLEVAAGAAKLGARFTLGSCTGLSECPA* |
| Ga0157378_124773191 | 3300013297 | Miscanthus Rhizosphere | MTDIALKAKEDLLSSDISDDALEVAAGATRIGASFTLGSCTGLSECPG* |
| Ga0163162_102118473 | 3300013306 | Switchgrass Rhizosphere | PGAAISTIWTSATNKRINVMTDIALKAQEDLLSFDVSDDALEVAASAARIGASFTLGSCTGLSECPG* |
| Ga0163162_109071112 | 3300013306 | Switchgrass Rhizosphere | NVMTDIVLKAQEEILFLYVSDEALEVAAGAAKVHASFTLGSCTGLSECPG* |
| Ga0157375_118485513 | 3300013308 | Miscanthus Rhizosphere | PTKRIRVMTDIALKAQEETLSFDVSDETLEVAAGAAKLGASFTLGSCTGLSECPA* |
| Ga0157377_108740131 | 3300014745 | Miscanthus Rhizosphere | MTDIVQKGQEEILLDISDEALEVAAGAAKVHASFTLGSCT |
| Ga0157379_116252672 | 3300014968 | Switchgrass Rhizosphere | MDGGAEKRIKVMKDIAIDVQEKLLFLDVSDEALEIAAGSAKVHASFTLGSCTGLSECPGLPA* |
| Ga0157376_101204414 | 3300014969 | Miscanthus Rhizosphere | MSDIVLKAQEEMLFLEVSDEVLEVVAGAAKVHASFTLGSCTGLSECPG* |
| Ga0132258_105691972 | 3300015371 | Arabidopsis Rhizosphere | MTDITLKTQEDILTFDVSDEVLETAGGVAREQANFTLGSCTGLSECPGSPA* |
| Ga0132258_106489743 | 3300015371 | Arabidopsis Rhizosphere | MDGGAGKGSKDIAIEVQEKLLFLDVSDEVLEVAAGAAKVHASFTLGSCTGLSECPG* |
| Ga0132258_111238062 | 3300015371 | Arabidopsis Rhizosphere | MNVMSDIELKAQEEMLFLDGSDEVLEVAAGGAKVHASFTLGSCTGLSECPG* |
| Ga0132258_117404482 | 3300015371 | Arabidopsis Rhizosphere | MSDIVLKAQEEMLFLDVSDEVLEVVAGAAKVHASFTLGSCTGLSECPG* |
| Ga0132258_120639891 | 3300015371 | Arabidopsis Rhizosphere | MADIALKAQEEIIFMDVSDETLEIAGGAAKVHGSFTLGSCTGLSECPG* |
| Ga0132256_1029213741 | 3300015372 | Arabidopsis Rhizosphere | MNVMSDIELKAQEEMLFLDGSDEVLEVAAGGAKVHASFTLGSCTGLS |
| Ga0132257_1038282432 | 3300015373 | Arabidopsis Rhizosphere | MTDIALKAQEETLSFDVSDETLEVAAGATKLGASFTLGSCTGLSECPA* |
| Ga0132257_1042099912 | 3300015373 | Arabidopsis Rhizosphere | MDGGAGKGSKDIAIEVQEKLLFLDVSDEALEVAAGAAKVHASFTLGSCTGLSECPGLPA* |
| Ga0132255_1021275711 | 3300015374 | Arabidopsis Rhizosphere | EHAPTKRIRVMTDIALKAQEETLSFDVSDETLEVAAGATKLGASFTLGSCTGLSECPA* |
| Ga0132255_1040949261 | 3300015374 | Arabidopsis Rhizosphere | MNVMTDIVQKGLKEILLDVSDEALEVAAGAAKVQASFTLGSCTGLSECPGSPN |
| Ga0187785_100670041 | 3300017947 | Tropical Peatland | MTDIALKAQEETLCFDVCDETLEVAAGATKLGASFTLGSCTGLSEC |
| Ga0187777_100903633 | 3300017974 | Tropical Peatland | MTDIALNAQEETLCFDVSDETLEVAAGTTKLGASFTLGSCTGLSECPA |
| Ga0187777_101160102 | 3300017974 | Tropical Peatland | MTDITLKTQEDILTFDVSDEVLETAGGVAREQANFTLGSCTGLSECPGSPA |
| Ga0184608_102858452 | 3300018028 | Groundwater Sediment | MTDLALKAQEDLLCFDVSDEALEVAARAARIGASFTLGSCTGLSECPG |
| Ga0187766_108733772 | 3300018058 | Tropical Peatland | MTDIALKAQDETLCFDVCDETLEVAAGATKLGASFTLGSC |
| Ga0187765_100099904 | 3300018060 | Tropical Peatland | MTDIALKAQDETLCFDVCDETLEVAAGATKLGASFTLGSCTGLSECPA |
| Ga0184625_101989142 | 3300018081 | Groundwater Sediment | MTDITLNKEEETLTFDVSDEALEVAAGAAREQVNFTLGSCTGLSECPG |
| Ga0193719_101156082 | 3300021344 | Soil | MTDIALKAQEDLLCFDVSDEALEVAARAARIGASFTLGSCTGLSECPG |
| Ga0126371_1000240018 | 3300021560 | Tropical Forest Soil | MTDITLKTQEDVLIFDISDEVLEIAGGAARAQTNFTLGACTGLSECPGSPA |
| Ga0126371_100642932 | 3300021560 | Tropical Forest Soil | MTDIAQKAQDEVLLDVSDEALEVAAGAAKVHASFTLGSCTGLSECPGSPA |
| Ga0126371_101980563 | 3300021560 | Tropical Forest Soil | MTDIALKAQEEMLFLNVSDEALEVAAGAAKAHASFTLGSCTGLSECPG |
| Ga0126371_104442563 | 3300021560 | Tropical Forest Soil | MTEIAPKEQEEVLFSEVFDEVLEVAGGAAKVHASFTLGSCTGLSECPG |
| Ga0126371_111236962 | 3300021560 | Tropical Forest Soil | VLKAQEEILFLHVSDEALEVAAGAAKVHSSFTLGSCTGLSECPGRPA |
| Ga0126371_112962791 | 3300021560 | Tropical Forest Soil | MSDTALKAQEEMPFLDVSDEVLEAAAGAAKVYASFTLGSCTGLSECPG |
| Ga0126371_113140331 | 3300021560 | Tropical Forest Soil | AQEEIIFDVSDEALEVAADAAKIHASFTLGSCTGLSECPSSPA |
| Ga0126371_113140332 | 3300021560 | Tropical Forest Soil | MTDIAQKAQEEIIFDVSDEALEVAADAAKVHASFTLGSCTGLSECPGSPA |
| Ga0126371_120930441 | 3300021560 | Tropical Forest Soil | MNMMTDITLKAQEEITFFDVADETLEIAGGATNTHASFTLGSCTGLSECPGLPA |
| Ga0126371_128562252 | 3300021560 | Tropical Forest Soil | QEEMLFLDVSDEVLELAAGAAKIHASFTLGSCTGLSECPG |
| Ga0126371_128894002 | 3300021560 | Tropical Forest Soil | VMSDNAVKAQEEMLFLDVPVSDEVLEVAAGAAKVDAFTLGSCTGLSECPG |
| Ga0222624_11983012 | 3300021951 | Groundwater Sediment | MTDIALKAQEEILSFDVSDEALEVVAGTAKIHVSFTLGSCTGLS |
| Ga0222622_106116851 | 3300022756 | Groundwater Sediment | MGAPRLSKGISTMTDITLKTDEETLTFDASDQALEIAAGAARELVNFTLGSCTGLSECPG |
| Ga0207642_103375432 | 3300025899 | Miscanthus Rhizosphere | MTDIALKAQEETLSFDVSDETLEAAAGAAKIGASFTLGSCTGLSECPARPT |
| Ga0207710_100480913 | 3300025900 | Switchgrass Rhizosphere | MTDIAPKAQEETLCFDISDETLEVAAGVTKLGASFTLGSCTGLSECPA |
| Ga0207685_106556321 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MTDIALKTQEDLLCFDVSDDALEVAAGVARIGASFTLG |
| Ga0207699_102840281 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MTDIVQKGQEEILLDISDEALEVAAGAAKVHASFTLGSCTGLSECPG |
| Ga0207693_100392916 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MTDIALKAQEETLSFDISDETLEVAASVTKLGASFTLGSCTGLSECPA |
| Ga0207657_105067332 | 3300025919 | Corn Rhizosphere | MTDIARKAQEDLLFFDVSDDALEVAAGVARIGASFTLGSCTGLSECPG |
| Ga0207649_113682791 | 3300025920 | Corn Rhizosphere | MTDIALKAQEETLSFDISDETLEVAAGVTKLGASFTLGSCTGLSECPA |
| Ga0207706_111246851 | 3300025933 | Corn Rhizosphere | MTDIALKAQEDLLSFDVSDDALEVAASAARIGASFTLGSCTGLSECPG |
| Ga0207709_111158341 | 3300025935 | Miscanthus Rhizosphere | ATNKRINVMTDITLKAQEDLLSSDISDDALELAAGATRIGASFTLGSCTGLSECPG |
| Ga0207670_111150311 | 3300025936 | Switchgrass Rhizosphere | KEKRMNVMSDIALKAQEEMLFSDVSDEVLEVVAGAAKVHASFTLGSCTGLSECPG |
| Ga0207689_101552144 | 3300025942 | Miscanthus Rhizosphere | EHAPTKRIRVMTDIALNAQEETLSFDVSDETLEVAAGAAKLGASFTLGSCTGLSECPA |
| Ga0207679_117391141 | 3300025945 | Corn Rhizosphere | MTDIALKAQEETLSFDISDETLEVAAGVTKLGASFTLGSCTGL |
| Ga0207679_120214072 | 3300025945 | Corn Rhizosphere | LHNKRINVMTTDIAVKVQEEILSFDVSDEVLEIAAGAASINASFTLGSCTGLSECPG |
| Ga0207668_112286452 | 3300025972 | Switchgrass Rhizosphere | MTDIALKAKEDLLSSDISDDALEVAAGVARIGASFTLGSCTGLSECPG |
| Ga0207641_106264303 | 3300026088 | Switchgrass Rhizosphere | MSDIVLKAQEEMLFLDVSDEVLEVAAGAAKIHASFTLGSCTGLSECPG |
| Ga0207676_101363732 | 3300026095 | Switchgrass Rhizosphere | MSDIALKAQEAMLFSDVSDEVLEVVAGAAKVHASFTLGSCTGLSECPG |
| Ga0207676_107298343 | 3300026095 | Switchgrass Rhizosphere | MTDIALKAKEDLLSSDISDDALEVAAGATRIGASFTLGSCTGLSE |
| Ga0207698_124551101 | 3300026142 | Corn Rhizosphere | MTDIALKAQEETLCFDISDETLEVAASVTKLGASFTLGSCTGLSECPA |
| Ga0209465_100058772 | 3300027874 | Tropical Forest Soil | MSDNAVKAQEEMLFLDVPVSDEVLEVAAGAAKVHAFTLGSCTGLSECPG |
| Ga0209465_100059663 | 3300027874 | Tropical Forest Soil | MMTDITLKAQEEITFFDVADETLEIAGGATNTHASFTLGSCTGLSECPGLPA |
| Ga0209465_100746522 | 3300027874 | Tropical Forest Soil | MTDIVLKAQEEILFLHVSDEALEVAAGAAKVHSSFTLGSCTGLSECPGRPA |
| Ga0209465_100922473 | 3300027874 | Tropical Forest Soil | MTDIVIKAQEETLSFDVSDETLEAAAGAAKIGASFTLGSCTGLSDCPARPA |
| Ga0209465_102302511 | 3300027874 | Tropical Forest Soil | ANKRINVMTDIAQKAQEEIIFDVSDEALEVAADAAKVHASFTLGSCTGLSECPGSPA |
| Ga0209069_106029011 | 3300027915 | Watersheds | MTDIALKAQEEILSFDVSDEALEVAAGAARIGASFTLGSCTGLSECPG |
| Ga0307498_100004963 | 3300031170 | Soil | MTDIALNAQEETLSFDVSDETLEVAADAAKLGASFTLGSCTGLSECPA |
| Ga0307495_100372712 | 3300031199 | Soil | MTDIALKAQEDLLCFDVSDEALEVAARAARIGASFTLGSCTGLSECPD |
| Ga0307497_100452312 | 3300031226 | Soil | MTDIALKAQEDLLSFDVSDDALEIAASAARIGASFTLGSCTGLSECPG |
| Ga0170824_1080612401 | 3300031231 | Forest Soil | MTDIALKAQEDLICFDVSDEALEVAAGAARIGASFTLGSCTGLSECPG |
| Ga0310888_103338113 | 3300031538 | Soil | LKAQEEMLFLDVSDEVLEVAAGAAKIHASFTLGSCTGLSECPG |
| Ga0318541_100762502 | 3300031545 | Soil | MTEIVPKEQEEILFSEVFDEVLEVAAGAAKVHANFTLGSCTGLSECPG |
| Ga0318538_100064023 | 3300031546 | Soil | MTDIVLKAQEEILFLHVSDEALEVAAGAAKVHASFTLGSCTGLSECPGRPA |
| Ga0318538_102840761 | 3300031546 | Soil | PKEQEEILFSEVFDEVLEVAAGAAKVHANFTLGSCTGLSECPG |
| Ga0310887_103757042 | 3300031547 | Soil | MSDIVLKAQEEMLFLDASDEVLEVVAGAAKVHASFTLGSCTGLSECPG |
| Ga0318573_101357101 | 3300031564 | Soil | MSDNAVKTQEEMLFLDVPVSDEVLEVAAGAAKVHAFTLGSCTGLSECP |
| Ga0310915_103622092 | 3300031573 | Soil | MMDKTIKNEEETLAFNVSDEALETAASATKIGASFTLGSCTGLSDCPA |
| Ga0306917_100007031 | 3300031719 | Soil | MTEIAPKEQEELLFSEVFDEVLEVAGGAAKVHASFTLGSCTGLSECPG |
| Ga0307469_111338811 | 3300031720 | Hardwood Forest Soil | MTDIALKAQEEMLSFDVSDETLEVAAGVTKLGASFTLGSCTGLSECP |
| Ga0307468_1002690794 | 3300031740 | Hardwood Forest Soil | MTDIALKAQEETLSFDVSDETLEVAAGVTKLGASFTLGSCTGLSECPA |
| Ga0307468_1005556551 | 3300031740 | Hardwood Forest Soil | MTDIVLKAQEEILFLYVSDEALEVAAGAAKVHASFTLGSCTGLS |
| Ga0307468_1011532091 | 3300031740 | Hardwood Forest Soil | MSDIALKAQEEMLFSDVSDEVLEVVAGAAKVHASFTLGSCTGLSECPGSPA |
| Ga0306918_100648627 | 3300031744 | Soil | PGHGRNQRTNAMTEIVPKEQEEILFSEVFDEVLEVAAGAAKVHANFTLGSCTGLSECPG |
| Ga0318492_105539691 | 3300031748 | Soil | MTEIVPKEQEEILFSEVFDEVLEVAAGAAKVHANFTLGSCTG |
| Ga0318548_100402873 | 3300031793 | Soil | MTDIVIKAQEETLSFDVSDETLEAAAGAAKIGASFTLGSCTGLAECPARPA |
| Ga0318548_105864562 | 3300031793 | Soil | VMSDNAVKTQEEMLFLDVPVSDEVLEVAAGAAKVHAFTLGSCTGLSECPG |
| Ga0318523_106923731 | 3300031798 | Soil | MTDIAQKAQEEIIFDVSDEALEVAADAAKVHASFTLGSC |
| Ga0310904_102944792 | 3300031854 | Soil | MSDIALKAQEEMLFLDVSDEVLEVAAGAAKIHASFTLGSCTGLSECPG |
| Ga0306919_100617804 | 3300031879 | Soil | MSDNAVKTQEEMLFLDVPVSDEVLEVAAGAAKVHAFTLGSCTGLSECPG |
| Ga0310893_103667942 | 3300031892 | Soil | MSDIVLKAQEEMLFLDVSDEVLEVVAGAAKVHVSFTLGSCTGLSECPG |
| Ga0318536_103952892 | 3300031893 | Soil | MTDIVLKAQEEILFLHVSDEALEVAAGAAKVHASFTLG |
| Ga0318551_102485572 | 3300031896 | Soil | MPGHGRNQRTNAMTEIVPKEQEEILFSEVFDEVLEVAAGAAKVHANFTLGSCTGLSECPG |
| Ga0318520_102514131 | 3300031897 | Soil | MSDNAVKTQEEMLFLDVPVSDEVLEVAADAAKVHA |
| Ga0310900_100305482 | 3300031908 | Soil | MTQEELLFVDVPDETLEVAAGAAKIHASFTLGSCTGLSECPGLPV |
| Ga0310900_105087621 | 3300031908 | Soil | KRIRVMTDIALKAQEETLCFDISDETLEVAAGVTKLGASFTLGSCTGLSECPA |
| Ga0310891_101943961 | 3300031913 | Soil | VMTQEELLFVDVPDETLEVAAGAAKIHASFTLGSCTGLSECPGLPV |
| Ga0310901_102551942 | 3300031940 | Soil | MSDIALKAQEEMLFLDVSDEVLEVVAGAAKVHVSFTLGSCTGLSECPG |
| Ga0310885_104609722 | 3300031943 | Soil | MTEIAPKAQEEILFSEVFDEVLEVAAGAAKVHASFTLGSCTGLSECPG |
| Ga0310884_100420031 | 3300031944 | Soil | IRVMTDIALKAQEETLSFDVSDETLEVAAGAAKLGASFTLGSCTGLSECPA |
| Ga0318530_104545761 | 3300031959 | Soil | NQRTNAMTEIVPKEQEEILFSEVFDEVLEVAAGAAKVHANFTLGSCTGLSECPG |
| Ga0310897_100488341 | 3300032003 | Soil | MTDIALKAQEETLSFDVSDETLEVAAGAAKLGASFTLGSCT |
| Ga0310902_110885041 | 3300032012 | Soil | MSDIALKAQEEMLFLDVSDEVLEVAAGAAKIHASFTLGS |
| Ga0310906_104831633 | 3300032013 | Soil | MTDIVMKAQEGAFSFDVSDETLEAAAGAAKIGASFTLGSCTGLSEC |
| Ga0310906_107540473 | 3300032013 | Soil | MTTDIAVKVQEEILSFDVSDEVLEIAAGAASINASFTLGSCTGLSECPG |
| Ga0318559_103627312 | 3300032039 | Soil | SWHSTNKRIRVMTDIVIKAQEETLSFDVSDETLEAAAGAAKIGASFTLGSCTGLSDCPARPA |
| Ga0318549_103516901 | 3300032041 | Soil | MTDIVLKAQEEILFLHVSDEALEVAAGAAKVHASFTLGSCTGLSECP |
| Ga0318545_103782701 | 3300032042 | Soil | MTDIVLKAQEEILFLHVSDEALEVAAGAAKVHASFTLGSCTGLSECPGR |
| Ga0318545_103937152 | 3300032042 | Soil | MMDKTIKNEEETLAFNVSDEALETAASATKIGASFTLGSCTGLSDC |
| Ga0318558_102993972 | 3300032044 | Soil | NKRTNVMTDIVLKAQEEILFLHVSDEALEVAAGAAKVHASFTLGSCTGLSECPGRPA |
| Ga0318558_106823692 | 3300032044 | Soil | VIKAQEETLSFDVSDETLEAAAGAAKIGASFTLGSCTGLSDCPARPA |
| Ga0318532_102836651 | 3300032051 | Soil | INVMTDIAQKAQEEIIFDVSDEALEVAADAAKVHASFTLGSCTGLSECPGSPA |
| Ga0318514_101045961 | 3300032066 | Soil | QEETLSFDVSDETLEAAAGAAKIGASFTLGSCTGLSDCPARPA |
| Ga0318524_100591941 | 3300032067 | Soil | IKAQEETLSFDVSDETLEAAAGAAKIGASFTLGSCTGLSDCPARPA |
| Ga0318518_101026351 | 3300032090 | Soil | KGANKRTNVMTDIVLKAQEEILFLHVSDEALEVAAGAAKVHASFTLGSCTGLSECPGRPA |
| Ga0310895_100220685 | 3300032122 | Soil | MTEIAPKAQEEILFSEVFDEVLEVAAGAAKVHASFTLGSC |
| Ga0307470_103297212 | 3300032174 | Hardwood Forest Soil | MTDIALKAKEDLLSSDISDDVLEVAAGATRIGASFTLGSCTGLSECPG |
| Ga0307470_114162892 | 3300032174 | Hardwood Forest Soil | MTDIALKAQEETLSFDVSDETLEVAAGAAKLGASFTLGSCTG |
| Ga0310889_103331051 | 3300032179 | Soil | MTDIALKAQEETLSFDVSDETLEVAAGAAKLGASFTLGSCTGLS |
| Ga0307471_1024199181 | 3300032180 | Hardwood Forest Soil | MTDLVQKGQEEILLDVSDEALEVAAGAAKVHASFTLGSCTGLSECPGSPD |
| Ga0307472_1000611143 | 3300032205 | Hardwood Forest Soil | MTDIALKAKEDLLSSDISDDALEVAAGATRIGASFTLGSCTGLSECPG |
| ⦗Top⦘ |