| Basic Information | |
|---|---|
| Family ID | F009151 |
| Family Type | Metagenome |
| Number of Sequences | 322 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MKKAAVPSILVAVVLLALGVIAEAQQPKKVPRIGYLA |
| Number of Associated Samples | 194 |
| Number of Associated Scaffolds | 322 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 70.79 % |
| % of genes near scaffold ends (potentially truncated) | 79.81 % |
| % of genes from short scaffolds (< 2000 bps) | 80.43 % |
| Associated GOLD sequencing projects | 179 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (59.938 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (21.118 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.155 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (43.478 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 41.54% β-sheet: 0.00% Coil/Unstructured: 58.46% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 322 Family Scaffolds |
|---|---|---|
| PF04392 | ABC_sub_bind | 13.98 |
| PF02824 | TGS | 1.55 |
| PF07690 | MFS_1 | 1.55 |
| PF00072 | Response_reg | 0.93 |
| PF12680 | SnoaL_2 | 0.93 |
| PF09084 | NMT1 | 0.93 |
| PF01068 | DNA_ligase_A_M | 0.93 |
| PF02518 | HATPase_c | 0.62 |
| PF00300 | His_Phos_1 | 0.62 |
| PF13193 | AMP-binding_C | 0.62 |
| PF13649 | Methyltransf_25 | 0.62 |
| PF08534 | Redoxin | 0.62 |
| PF04238 | DUF420 | 0.62 |
| PF12728 | HTH_17 | 0.62 |
| PF09335 | SNARE_assoc | 0.62 |
| PF00355 | Rieske | 0.62 |
| PF11937 | DUF3455 | 0.62 |
| PF02604 | PhdYeFM_antitox | 0.62 |
| PF00106 | adh_short | 0.62 |
| PF04828 | GFA | 0.31 |
| PF13384 | HTH_23 | 0.31 |
| PF04909 | Amidohydro_2 | 0.31 |
| PF02493 | MORN | 0.31 |
| PF00076 | RRM_1 | 0.31 |
| PF01381 | HTH_3 | 0.31 |
| PF01638 | HxlR | 0.31 |
| PF01161 | PBP | 0.31 |
| PF08299 | Bac_DnaA_C | 0.31 |
| PF01590 | GAF | 0.31 |
| PF00180 | Iso_dh | 0.31 |
| PF00459 | Inositol_P | 0.31 |
| PF12706 | Lactamase_B_2 | 0.31 |
| PF03575 | Peptidase_S51 | 0.31 |
| PF00691 | OmpA | 0.31 |
| PF04326 | AlbA_2 | 0.31 |
| PF08241 | Methyltransf_11 | 0.31 |
| PF01070 | FMN_dh | 0.31 |
| PF00857 | Isochorismatase | 0.31 |
| PF07355 | GRDB | 0.31 |
| PF13197 | DUF4013 | 0.31 |
| PF01797 | Y1_Tnp | 0.31 |
| PF00326 | Peptidase_S9 | 0.31 |
| PF03009 | GDPD | 0.31 |
| PF07366 | SnoaL | 0.31 |
| PF13495 | Phage_int_SAM_4 | 0.31 |
| PF00793 | DAHP_synth_1 | 0.31 |
| PF07603 | DUF1566 | 0.31 |
| PF01882 | DUF58 | 0.31 |
| PF00582 | Usp | 0.31 |
| PF00719 | Pyrophosphatase | 0.31 |
| PF13091 | PLDc_2 | 0.31 |
| PF01145 | Band_7 | 0.31 |
| PF00293 | NUDIX | 0.31 |
| PF13379 | NMT1_2 | 0.31 |
| PF08239 | SH3_3 | 0.31 |
| PF13474 | SnoaL_3 | 0.31 |
| PF00583 | Acetyltransf_1 | 0.31 |
| PF09912 | DUF2141 | 0.31 |
| PF13488 | Gly-zipper_Omp | 0.31 |
| PF03176 | MMPL | 0.31 |
| PF02775 | TPP_enzyme_C | 0.31 |
| PF00578 | AhpC-TSA | 0.31 |
| PF07681 | DoxX | 0.31 |
| PF01522 | Polysacc_deac_1 | 0.31 |
| PF03060 | NMO | 0.31 |
| PF00027 | cNMP_binding | 0.31 |
| PF00194 | Carb_anhydrase | 0.31 |
| PF02655 | ATP-grasp_3 | 0.31 |
| PF01451 | LMWPc | 0.31 |
| PF13565 | HTH_32 | 0.31 |
| PF02371 | Transposase_20 | 0.31 |
| PF04972 | BON | 0.31 |
| COG ID | Name | Functional Category | % Frequency in 322 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 13.98 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.93 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.93 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.93 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.93 |
| COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 0.62 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.62 |
| COG2322 | Cytochrome oxidase assembly protein CtaM/YozB, DUF420 family | Posttranslational modification, protein turnover, chaperones [O] | 0.62 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.62 |
| COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 0.62 |
| COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 0.62 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.31 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.31 |
| COG4642 | Uncharacterized conserved protein | Function unknown [S] | 0.31 |
| COG3338 | Carbonic anhydrase | Inorganic ion transport and metabolism [P] | 0.31 |
| COG2865 | Predicted transcriptional regulator, contains HTH domain | Transcription [K] | 0.31 |
| COG2849 | Antitoxin component YwqK of the YwqJK toxin-antitoxin module | Defense mechanisms [V] | 0.31 |
| COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 0.31 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.31 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.31 |
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 0.31 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.31 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.31 |
| COG1881 | Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) family | General function prediction only [R] | 0.31 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.31 |
| COG1721 | Uncharacterized conserved protein, DUF58 family, contains vWF domain | Function unknown [S] | 0.31 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.31 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.31 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 0.31 |
| COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 0.31 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.31 |
| COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 0.31 |
| COG0584 | Glycerophosphoryl diester phosphodiesterase | Lipid transport and metabolism [I] | 0.31 |
| COG0516 | IMP dehydrogenase/GMP reductase | Nucleotide transport and metabolism [F] | 0.31 |
| COG0221 | Inorganic pyrophosphatase | Energy production and conversion [C] | 0.31 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 59.94 % |
| Unclassified | root | N/A | 40.06 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2067725001|GPWNP_F5MPXY301CV9HJ | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101415650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 947 | Open in IMG/M |
| 3300000709|KanNP_Total_F14TBDRAFT_1020916 | Not Available | 538 | Open in IMG/M |
| 3300000955|JGI1027J12803_106354325 | Not Available | 758 | Open in IMG/M |
| 3300000955|JGI1027J12803_106701975 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300003911|JGI25405J52794_10008548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia | 1915 | Open in IMG/M |
| 3300003997|Ga0055466_10073520 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300005183|Ga0068993_10404137 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300005186|Ga0066676_11045702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 541 | Open in IMG/M |
| 3300005328|Ga0070676_10496871 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300005331|Ga0070670_101597494 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300005332|Ga0066388_101019165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1389 | Open in IMG/M |
| 3300005332|Ga0066388_103159416 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300005332|Ga0066388_104917309 | Not Available | 679 | Open in IMG/M |
| 3300005332|Ga0066388_107599701 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300005354|Ga0070675_100375256 | All Organisms → cellular organisms → Bacteria | 1265 | Open in IMG/M |
| 3300005445|Ga0070708_100903339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 829 | Open in IMG/M |
| 3300005468|Ga0070707_101716729 | Not Available | 595 | Open in IMG/M |
| 3300005526|Ga0073909_10405726 | Not Available | 643 | Open in IMG/M |
| 3300005713|Ga0066905_100602083 | Not Available | 930 | Open in IMG/M |
| 3300005713|Ga0066905_100855159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 793 | Open in IMG/M |
| 3300005713|Ga0066905_102071583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 529 | Open in IMG/M |
| 3300005764|Ga0066903_103117098 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300005764|Ga0066903_105092130 | Not Available | 696 | Open in IMG/M |
| 3300005764|Ga0066903_107186277 | Not Available | 576 | Open in IMG/M |
| 3300005764|Ga0066903_107464117 | Not Available | 564 | Open in IMG/M |
| 3300005841|Ga0068863_100720784 | Not Available | 992 | Open in IMG/M |
| 3300005844|Ga0068862_101733621 | Not Available | 633 | Open in IMG/M |
| 3300005937|Ga0081455_10015615 | All Organisms → cellular organisms → Bacteria | 7368 | Open in IMG/M |
| 3300005983|Ga0081540_1025359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3413 | Open in IMG/M |
| 3300006049|Ga0075417_10061350 | All Organisms → cellular organisms → Bacteria | 1646 | Open in IMG/M |
| 3300006049|Ga0075417_10254609 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300006049|Ga0075417_10696968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. URHB0020 | 521 | Open in IMG/M |
| 3300006058|Ga0075432_10024706 | All Organisms → cellular organisms → Bacteria | 2060 | Open in IMG/M |
| 3300006058|Ga0075432_10198544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 793 | Open in IMG/M |
| 3300006194|Ga0075427_10030824 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 880 | Open in IMG/M |
| 3300006194|Ga0075427_10107325 | Not Available | 524 | Open in IMG/M |
| 3300006796|Ga0066665_11674336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 503 | Open in IMG/M |
| 3300006797|Ga0066659_10526327 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 951 | Open in IMG/M |
| 3300006844|Ga0075428_101415573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 729 | Open in IMG/M |
| 3300006844|Ga0075428_102194564 | Not Available | 570 | Open in IMG/M |
| 3300006845|Ga0075421_100502847 | All Organisms → cellular organisms → Bacteria | 1440 | Open in IMG/M |
| 3300006845|Ga0075421_102154973 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300006845|Ga0075421_102214360 | Not Available | 580 | Open in IMG/M |
| 3300006846|Ga0075430_100468582 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
| 3300006847|Ga0075431_100030244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 5578 | Open in IMG/M |
| 3300006847|Ga0075431_101040703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 785 | Open in IMG/M |
| 3300006847|Ga0075431_101914628 | Not Available | 548 | Open in IMG/M |
| 3300006852|Ga0075433_10083790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_60_19 | 2814 | Open in IMG/M |
| 3300006852|Ga0075433_10204874 | Not Available | 1753 | Open in IMG/M |
| 3300006852|Ga0075433_10312399 | All Organisms → cellular organisms → Bacteria | 1391 | Open in IMG/M |
| 3300006852|Ga0075433_10999774 | Not Available | 728 | Open in IMG/M |
| 3300006852|Ga0075433_11309727 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300006852|Ga0075433_11774806 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300006852|Ga0075433_11922155 | Not Available | 507 | Open in IMG/M |
| 3300006853|Ga0075420_100317563 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1350 | Open in IMG/M |
| 3300006854|Ga0075425_100722424 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1143 | Open in IMG/M |
| 3300006854|Ga0075425_101545592 | Not Available | 749 | Open in IMG/M |
| 3300006854|Ga0075425_102855073 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300006880|Ga0075429_100602581 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300006880|Ga0075429_100981639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 739 | Open in IMG/M |
| 3300006880|Ga0075429_101205812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 661 | Open in IMG/M |
| 3300006880|Ga0075429_101975175 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300006904|Ga0075424_100974763 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300006904|Ga0075424_101811302 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300006969|Ga0075419_10004297 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9073 | Open in IMG/M |
| 3300006969|Ga0075419_10360863 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
| 3300006969|Ga0075419_10461056 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300006969|Ga0075419_11433523 | Not Available | 516 | Open in IMG/M |
| 3300007076|Ga0075435_100577115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 975 | Open in IMG/M |
| 3300009012|Ga0066710_103725664 | Not Available | 573 | Open in IMG/M |
| 3300009094|Ga0111539_10756828 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
| 3300009094|Ga0111539_12705288 | Not Available | 575 | Open in IMG/M |
| 3300009094|Ga0111539_12751428 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300009100|Ga0075418_10382776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1503 | Open in IMG/M |
| 3300009100|Ga0075418_10823192 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
| 3300009100|Ga0075418_12151059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 608 | Open in IMG/M |
| 3300009100|Ga0075418_12695380 | Not Available | 543 | Open in IMG/M |
| 3300009147|Ga0114129_10084236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4415 | Open in IMG/M |
| 3300009147|Ga0114129_10199997 | All Organisms → cellular organisms → Bacteria | 2707 | Open in IMG/M |
| 3300009147|Ga0114129_10382687 | All Organisms → cellular organisms → Bacteria | 1858 | Open in IMG/M |
| 3300009147|Ga0114129_11063941 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300009147|Ga0114129_11521076 | Not Available | 822 | Open in IMG/M |
| 3300009147|Ga0114129_13103852 | Not Available | 543 | Open in IMG/M |
| 3300009147|Ga0114129_13155520 | Not Available | 537 | Open in IMG/M |
| 3300009147|Ga0114129_13501427 | Not Available | 502 | Open in IMG/M |
| 3300009156|Ga0111538_10737595 | Not Available | 1248 | Open in IMG/M |
| 3300009156|Ga0111538_12818852 | Not Available | 609 | Open in IMG/M |
| 3300009157|Ga0105092_10096358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1620 | Open in IMG/M |
| 3300009162|Ga0075423_10543765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1223 | Open in IMG/M |
| 3300009162|Ga0075423_11844426 | Not Available | 653 | Open in IMG/M |
| 3300009168|Ga0105104_10226083 | All Organisms → cellular organisms → Bacteria | 1019 | Open in IMG/M |
| 3300009168|Ga0105104_10256291 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300009168|Ga0105104_10349051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_60_19 | 818 | Open in IMG/M |
| 3300009168|Ga0105104_10359019 | Not Available | 806 | Open in IMG/M |
| 3300009597|Ga0105259_1037909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1052 | Open in IMG/M |
| 3300009597|Ga0105259_1089472 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300009801|Ga0105056_1070305 | Not Available | 519 | Open in IMG/M |
| 3300009810|Ga0105088_1106185 | Not Available | 524 | Open in IMG/M |
| 3300009811|Ga0105084_1082572 | Not Available | 593 | Open in IMG/M |
| 3300009817|Ga0105062_1061154 | Not Available | 703 | Open in IMG/M |
| 3300009817|Ga0105062_1099170 | Not Available | 575 | Open in IMG/M |
| 3300009817|Ga0105062_1140455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 500 | Open in IMG/M |
| 3300009823|Ga0105078_1039298 | Not Available | 602 | Open in IMG/M |
| 3300009836|Ga0105068_1022992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1067 | Open in IMG/M |
| 3300009837|Ga0105058_1119247 | Not Available | 628 | Open in IMG/M |
| 3300010029|Ga0105074_1015332 | Not Available | 1240 | Open in IMG/M |
| 3300010029|Ga0105074_1082705 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300010043|Ga0126380_10039900 | All Organisms → cellular organisms → Bacteria | 2455 | Open in IMG/M |
| 3300010043|Ga0126380_10179003 | Not Available | 1395 | Open in IMG/M |
| 3300010043|Ga0126380_10463043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 962 | Open in IMG/M |
| 3300010046|Ga0126384_10017275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4604 | Open in IMG/M |
| 3300010046|Ga0126384_10278325 | All Organisms → cellular organisms → Bacteria | 1366 | Open in IMG/M |
| 3300010046|Ga0126384_10598507 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Marinilabiliaceae → Saccharicrinis → Saccharicrinis carchari | 965 | Open in IMG/M |
| 3300010046|Ga0126384_10912159 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300010046|Ga0126384_11818689 | Not Available | 579 | Open in IMG/M |
| 3300010046|Ga0126384_12064914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 546 | Open in IMG/M |
| 3300010047|Ga0126382_11402910 | Not Available | 637 | Open in IMG/M |
| 3300010047|Ga0126382_11790696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Noviherbaspirillum → Noviherbaspirillum sedimenti | 577 | Open in IMG/M |
| 3300010301|Ga0134070_10443117 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300010304|Ga0134088_10711257 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300010333|Ga0134080_10684848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 507 | Open in IMG/M |
| 3300010358|Ga0126370_11051022 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300010358|Ga0126370_11902494 | Not Available | 579 | Open in IMG/M |
| 3300010358|Ga0126370_12439926 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300010358|Ga0126370_12469122 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300010359|Ga0126376_11600836 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300010360|Ga0126372_12573824 | Not Available | 560 | Open in IMG/M |
| 3300010361|Ga0126378_12341049 | Not Available | 610 | Open in IMG/M |
| 3300010362|Ga0126377_10849574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 973 | Open in IMG/M |
| 3300010362|Ga0126377_11084434 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300010362|Ga0126377_11156198 | Not Available | 844 | Open in IMG/M |
| 3300010362|Ga0126377_13073777 | Not Available | 539 | Open in IMG/M |
| 3300010362|Ga0126377_13576242 | Not Available | 503 | Open in IMG/M |
| 3300010366|Ga0126379_10216999 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1855 | Open in IMG/M |
| 3300010366|Ga0126379_10314742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1579 | Open in IMG/M |
| 3300010375|Ga0105239_12418836 | Not Available | 612 | Open in IMG/M |
| 3300010376|Ga0126381_101869088 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300010398|Ga0126383_10051781 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3424 | Open in IMG/M |
| 3300010398|Ga0126383_11270547 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300010398|Ga0126383_11814708 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300010400|Ga0134122_10052510 | All Organisms → cellular organisms → Bacteria | 3132 | Open in IMG/M |
| 3300011269|Ga0137392_10850224 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300012034|Ga0137453_1044811 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 788 | Open in IMG/M |
| 3300012160|Ga0137349_1015163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1174 | Open in IMG/M |
| 3300012179|Ga0137334_1047658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 906 | Open in IMG/M |
| 3300012198|Ga0137364_11260400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 552 | Open in IMG/M |
| 3300012200|Ga0137382_10055844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2482 | Open in IMG/M |
| 3300012202|Ga0137363_10027730 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3879 | Open in IMG/M |
| 3300012202|Ga0137363_10139940 | All Organisms → cellular organisms → Bacteria | 1890 | Open in IMG/M |
| 3300012202|Ga0137363_10970207 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300012204|Ga0137374_11093146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 568 | Open in IMG/M |
| 3300012205|Ga0137362_11033808 | Not Available | 699 | Open in IMG/M |
| 3300012208|Ga0137376_10114363 | All Organisms → cellular organisms → Bacteria | 2298 | Open in IMG/M |
| 3300012209|Ga0137379_11489398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. CF079 | 578 | Open in IMG/M |
| 3300012210|Ga0137378_10567924 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1043 | Open in IMG/M |
| 3300012210|Ga0137378_11559756 | Not Available | 570 | Open in IMG/M |
| 3300012211|Ga0137377_11537170 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300012350|Ga0137372_10509080 | Not Available | 895 | Open in IMG/M |
| 3300012354|Ga0137366_10277002 | Not Available | 1239 | Open in IMG/M |
| 3300012354|Ga0137366_10456724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 926 | Open in IMG/M |
| 3300012355|Ga0137369_10034169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 4624 | Open in IMG/M |
| 3300012355|Ga0137369_10229508 | All Organisms → cellular organisms → Bacteria | 1417 | Open in IMG/M |
| 3300012355|Ga0137369_10761306 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300012360|Ga0137375_10056564 | All Organisms → cellular organisms → Bacteria | 4233 | Open in IMG/M |
| 3300012361|Ga0137360_10317357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1297 | Open in IMG/M |
| 3300012362|Ga0137361_11838247 | Not Available | 523 | Open in IMG/M |
| 3300012498|Ga0157345_1026186 | Not Available | 626 | Open in IMG/M |
| 3300012503|Ga0157313_1005504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 917 | Open in IMG/M |
| 3300012513|Ga0157326_1022109 | Not Available | 792 | Open in IMG/M |
| 3300012519|Ga0157352_1001282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1846 | Open in IMG/M |
| 3300012532|Ga0137373_11222499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 529 | Open in IMG/M |
| 3300012922|Ga0137394_10773941 | Not Available | 805 | Open in IMG/M |
| 3300012923|Ga0137359_10148140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2091 | Open in IMG/M |
| 3300012923|Ga0137359_10225082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1675 | Open in IMG/M |
| 3300012925|Ga0137419_10101100 | All Organisms → cellular organisms → Bacteria | 1996 | Open in IMG/M |
| 3300012927|Ga0137416_11750173 | Not Available | 567 | Open in IMG/M |
| 3300012929|Ga0137404_10740772 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300012930|Ga0137407_10026469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 4453 | Open in IMG/M |
| 3300012930|Ga0137407_10163594 | All Organisms → cellular organisms → Bacteria | 1976 | Open in IMG/M |
| 3300012930|Ga0137407_10584763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1047 | Open in IMG/M |
| 3300012930|Ga0137407_11861722 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300012930|Ga0137407_12061530 | Not Available | 544 | Open in IMG/M |
| 3300012944|Ga0137410_11431329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 601 | Open in IMG/M |
| 3300012948|Ga0126375_11941709 | Not Available | 518 | Open in IMG/M |
| 3300012957|Ga0164303_10445586 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300012957|Ga0164303_10509209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 772 | Open in IMG/M |
| 3300012957|Ga0164303_10750450 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 664 | Open in IMG/M |
| 3300012971|Ga0126369_10220137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1846 | Open in IMG/M |
| 3300012986|Ga0164304_10578669 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300012989|Ga0164305_10224225 | All Organisms → cellular organisms → Bacteria | 1339 | Open in IMG/M |
| 3300013297|Ga0157378_10062350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3329 | Open in IMG/M |
| 3300013297|Ga0157378_10209399 | All Organisms → cellular organisms → Bacteria | 1848 | Open in IMG/M |
| 3300014868|Ga0180088_1062599 | Not Available | 658 | Open in IMG/M |
| 3300014875|Ga0180083_1119822 | Not Available | 580 | Open in IMG/M |
| 3300014877|Ga0180074_1004256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2471 | Open in IMG/M |
| 3300014880|Ga0180082_1161542 | Not Available | 520 | Open in IMG/M |
| 3300014883|Ga0180086_1129812 | Not Available | 654 | Open in IMG/M |
| 3300014885|Ga0180063_1078718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 983 | Open in IMG/M |
| 3300015259|Ga0180085_1235114 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300015264|Ga0137403_10121465 | All Organisms → cellular organisms → Bacteria | 2603 | Open in IMG/M |
| 3300015264|Ga0137403_10176603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2083 | Open in IMG/M |
| 3300015358|Ga0134089_10202607 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300015373|Ga0132257_100427100 | All Organisms → cellular organisms → Bacteria | 1615 | Open in IMG/M |
| 3300015374|Ga0132255_101061867 | Not Available | 1216 | Open in IMG/M |
| 3300015374|Ga0132255_101729105 | Not Available | 949 | Open in IMG/M |
| 3300015374|Ga0132255_104211990 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300015374|Ga0132255_106300516 | Not Available | 502 | Open in IMG/M |
| 3300016341|Ga0182035_10426999 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10 → unclassified candidate division NC10 → candidate division NC10 bacterium CSP1-5 | 1119 | Open in IMG/M |
| 3300017997|Ga0184610_1046943 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division KSB1 → unclassified candidate division KSB1 → candidate division KSB1 bacterium 4484_219 | 1266 | Open in IMG/M |
| 3300017997|Ga0184610_1249819 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300018027|Ga0184605_10351523 | Not Available | 665 | Open in IMG/M |
| 3300018027|Ga0184605_10492756 | Not Available | 534 | Open in IMG/M |
| 3300018028|Ga0184608_10144700 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
| 3300018028|Ga0184608_10283104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 729 | Open in IMG/M |
| 3300018051|Ga0184620_10148769 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 756 | Open in IMG/M |
| 3300018053|Ga0184626_10054711 | All Organisms → cellular organisms → Bacteria | 1673 | Open in IMG/M |
| 3300018054|Ga0184621_10299938 | Not Available | 567 | Open in IMG/M |
| 3300018063|Ga0184637_10178224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1307 | Open in IMG/M |
| 3300018072|Ga0184635_10379117 | Not Available | 538 | Open in IMG/M |
| 3300018075|Ga0184632_10063919 | All Organisms → cellular organisms → Bacteria | 1598 | Open in IMG/M |
| 3300018075|Ga0184632_10069877 | All Organisms → cellular organisms → Bacteria | 1528 | Open in IMG/M |
| 3300018075|Ga0184632_10219688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 835 | Open in IMG/M |
| 3300018075|Ga0184632_10314288 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300018076|Ga0184609_10131410 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
| 3300018076|Ga0184609_10265059 | Not Available | 804 | Open in IMG/M |
| 3300018081|Ga0184625_10090913 | All Organisms → cellular organisms → Bacteria | 1569 | Open in IMG/M |
| 3300018081|Ga0184625_10368804 | Not Available | 745 | Open in IMG/M |
| 3300018084|Ga0184629_10159592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1148 | Open in IMG/M |
| 3300018482|Ga0066669_10716449 | Not Available | 882 | Open in IMG/M |
| 3300019879|Ga0193723_1025545 | All Organisms → cellular organisms → Bacteria | 1796 | Open in IMG/M |
| 3300019886|Ga0193727_1023679 | Not Available | 2166 | Open in IMG/M |
| 3300020002|Ga0193730_1169024 | Not Available | 562 | Open in IMG/M |
| 3300020003|Ga0193739_1058625 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 987 | Open in IMG/M |
| 3300020006|Ga0193735_1010708 | All Organisms → cellular organisms → Bacteria | 2889 | Open in IMG/M |
| 3300020583|Ga0210401_11212564 | Not Available | 613 | Open in IMG/M |
| 3300021081|Ga0210379_10504507 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300021344|Ga0193719_10295061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 681 | Open in IMG/M |
| 3300021560|Ga0126371_12335258 | Not Available | 646 | Open in IMG/M |
| 3300022534|Ga0224452_1123288 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300022694|Ga0222623_10240770 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300022694|Ga0222623_10405027 | Not Available | 518 | Open in IMG/M |
| 3300022756|Ga0222622_10308933 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300025925|Ga0207650_10866557 | Not Available | 766 | Open in IMG/M |
| 3300025938|Ga0207704_10530291 | Not Available | 954 | Open in IMG/M |
| 3300026547|Ga0209156_10419546 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300027163|Ga0209878_1050036 | Not Available | 529 | Open in IMG/M |
| 3300027277|Ga0209846_1065618 | Not Available | 545 | Open in IMG/M |
| 3300027490|Ga0209899_1014981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1761 | Open in IMG/M |
| 3300027527|Ga0209684_1057701 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Candidatus Troglogloeales → Candidatus Manganitrophaceae → Candidatus Manganitrophus → Candidatus Manganitrophus noduliformans | 601 | Open in IMG/M |
| 3300027646|Ga0209466_1009187 | All Organisms → cellular organisms → Bacteria | 2092 | Open in IMG/M |
| 3300027722|Ga0209819_10208670 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300027873|Ga0209814_10017859 | All Organisms → cellular organisms → Bacteria | 2857 | Open in IMG/M |
| 3300027873|Ga0209814_10029120 | All Organisms → cellular organisms → Bacteria | 2269 | Open in IMG/M |
| 3300027873|Ga0209814_10085049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1335 | Open in IMG/M |
| 3300027873|Ga0209814_10305753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 693 | Open in IMG/M |
| 3300027875|Ga0209283_10531266 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 753 | Open in IMG/M |
| 3300027880|Ga0209481_10127140 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
| 3300027880|Ga0209481_10236722 | Not Available | 918 | Open in IMG/M |
| 3300027909|Ga0209382_10383752 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1567 | Open in IMG/M |
| 3300027909|Ga0209382_10924312 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
| 3300027909|Ga0209382_12250577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 514 | Open in IMG/M |
| 3300027915|Ga0209069_10674115 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300027957|Ga0209857_1015385 | Not Available | 1508 | Open in IMG/M |
| 3300030606|Ga0299906_10560873 | Not Available | 869 | Open in IMG/M |
| 3300031231|Ga0170824_110837206 | Not Available | 930 | Open in IMG/M |
| 3300031474|Ga0170818_109990042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 514 | Open in IMG/M |
| 3300031720|Ga0307469_10078599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2224 | Open in IMG/M |
| 3300031731|Ga0307405_10004815 | All Organisms → cellular organisms → Bacteria | 6438 | Open in IMG/M |
| 3300031740|Ga0307468_100032562 | All Organisms → cellular organisms → Bacteria | 2506 | Open in IMG/M |
| 3300031740|Ga0307468_100673670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 859 | Open in IMG/M |
| 3300031820|Ga0307473_10858045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 652 | Open in IMG/M |
| 3300031854|Ga0310904_11406951 | Not Available | 508 | Open in IMG/M |
| 3300031912|Ga0306921_11443466 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10 → unclassified candidate division NC10 → candidate division NC10 bacterium CSP1-5 | 755 | Open in IMG/M |
| 3300031962|Ga0307479_10669479 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
| 3300031962|Ga0307479_10825211 | Not Available | 902 | Open in IMG/M |
| 3300031965|Ga0326597_11372931 | Not Available | 686 | Open in IMG/M |
| 3300032012|Ga0310902_11383284 | Not Available | 500 | Open in IMG/M |
| 3300032157|Ga0315912_10268987 | Not Available | 1342 | Open in IMG/M |
| 3300032180|Ga0307471_100016626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5214 | Open in IMG/M |
| 3300032180|Ga0307471_100819181 | Not Available | 1098 | Open in IMG/M |
| 3300032180|Ga0307471_101940968 | Not Available | 737 | Open in IMG/M |
| 3300032180|Ga0307471_102369803 | Not Available | 670 | Open in IMG/M |
| 3300032205|Ga0307472_100242272 | All Organisms → cellular organisms → Bacteria | 1407 | Open in IMG/M |
| 3300032205|Ga0307472_100541399 | Not Available | 1014 | Open in IMG/M |
| 3300033433|Ga0326726_11571709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 640 | Open in IMG/M |
| 3300033551|Ga0247830_11723279 | Not Available | 502 | Open in IMG/M |
| 3300034148|Ga0364927_0028599 | Not Available | 1370 | Open in IMG/M |
| 3300034354|Ga0364943_0367751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 552 | Open in IMG/M |
| 3300034354|Ga0364943_0395323 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300034417|Ga0364941_018565 | All Organisms → cellular organisms → Bacteria | 1393 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 21.12% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.35% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.87% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 7.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.66% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 4.66% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.04% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.04% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 3.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.42% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.17% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.55% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.24% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.24% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.93% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.93% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.62% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.62% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.62% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.62% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.62% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.62% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.31% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.31% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.31% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.31% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.31% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.31% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.31% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.31% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.31% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.31% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2067725001 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000709 | Amended soil microbial communities from Kansas Great Prairies, USA - Total DNA F1.4 TB amended with BrdU and acetate no abondance | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300003997 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005183 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005889 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_201 | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006194 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Host-Associated | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009597 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT299 | Environmental | Open in IMG/M |
| 3300009801 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 | Environmental | Open in IMG/M |
| 3300009810 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 | Environmental | Open in IMG/M |
| 3300009811 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 | Environmental | Open in IMG/M |
| 3300009817 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 | Environmental | Open in IMG/M |
| 3300009823 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 | Environmental | Open in IMG/M |
| 3300009836 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 | Environmental | Open in IMG/M |
| 3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
| 3300010029 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_10_20 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012034 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT526_2 | Environmental | Open in IMG/M |
| 3300012160 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT630_2 | Environmental | Open in IMG/M |
| 3300012179 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT262_2 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Host-Associated | Open in IMG/M |
| 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Host-Associated | Open in IMG/M |
| 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Host-Associated | Open in IMG/M |
| 3300012519 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610 | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014868 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT830_16_10D | Environmental | Open in IMG/M |
| 3300014875 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_1_16_10D | Environmental | Open in IMG/M |
| 3300014877 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10D | Environmental | Open in IMG/M |
| 3300014880 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_16_10D | Environmental | Open in IMG/M |
| 3300014883 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10D | Environmental | Open in IMG/M |
| 3300014885 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10D | Environmental | Open in IMG/M |
| 3300015259 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10D | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025993 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027163 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 (SPAdes) | Environmental | Open in IMG/M |
| 3300027277 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027490 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027527 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027722 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027957 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300030606 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034148 | Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17 | Environmental | Open in IMG/M |
| 3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
| 3300034417 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPWNP_02025020 | 2067725001 | Soil | MKKAAVPSILVAGVLLVLGVTADAQQPKKVPRIGYLSNTDAATD |
| INPhiseqgaiiFebDRAFT_1014156501 | 3300000364 | Soil | MKKVAVSSILVAVVLLVLAAMAEAQQPAKVPRIGYLILCHL* |
| F14TC_1000314492 | 3300000559 | Soil | MKKAGVLSILFVVLLLAVAVIAEAQQPKKVHRIGYLGATDAAGESTRSEA |
| KanNP_Total_F14TBDRAFT_10209161 | 3300000709 | Soil | MKKAAVPSILVAVVLLAVAVIAEVQQXKKVSRIGF* |
| JGI1027J12803_1063543251 | 3300000955 | Soil | MRAMKKAALPSILVAVVLLALGVMAEAQQANKIPR |
| JGI1027J12803_1067019752 | 3300000955 | Soil | MKKAAVRSILVVVVLLALRVTCEAQQPKKVIRIGYLS |
| JGI25405J52794_100085481 | 3300003911 | Tabebuia Heterophylla Rhizosphere | MKRAVMPSILVAVGLLPLGVIAEAQQPKKLPKIGFLSSGGEGT |
| Ga0055466_100735202 | 3300003997 | Natural And Restored Wetlands | MRKAGVLSILFVVVLLAVAVIAEARQAKKVPRIGYLFGARRAG* |
| Ga0063356_1054148241 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKKASVPLILLAVILLAFAVIIEAQQSMKVYRIGYLAPRSA |
| Ga0068993_104041372 | 3300005183 | Natural And Restored Wetlands | MKKAGVLAILVAVILLAVGVVVEAQQQTKMPRIGYLGTVASSNR |
| Ga0066676_110457022 | 3300005186 | Soil | MVCAMKKAGVLSILFVVVLLAVAVIAEAQQPKKVPRIGYLSNGDAATDTRSEAIRLAAMWMSITNTRMLS* |
| Ga0065704_105194352 | 3300005289 | Switchgrass Rhizosphere | MVCAMKKAGVLSILLAVILLAVAVIADAQQPAKVPRIGYLS |
| Ga0070676_104968712 | 3300005328 | Miscanthus Rhizosphere | MNKPRALSILILVMVLSVVISVEAQQAKKIPRIGYLSNNDPA |
| Ga0070670_1015974941 | 3300005331 | Switchgrass Rhizosphere | MEPRGKYAMKKAAVLSSLVVAVVVAVGEIAEAQQAKKIPRIGYL |
| Ga0066388_1010191652 | 3300005332 | Tropical Forest Soil | MKRAAVPSILVAVVLFALGVTAGAQQPKKVPRIGYLSNLDPATE* |
| Ga0066388_1031594162 | 3300005332 | Tropical Forest Soil | MKRAAVPSILVAVVVLAVAVVAAAQQPAKIPRIGYLSIADPATESTRSEAIRL |
| Ga0066388_1049173092 | 3300005332 | Tropical Forest Soil | MKRAAVRSILVVVIFLAFTVITEAQQPKRVPRIIYLSPLSPSSESTRSEAI |
| Ga0066388_1075997012 | 3300005332 | Tropical Forest Soil | MKKAAVPSILVAVVLLALGVTAEAQQPKKVARIGYLSSGDPASESARSE |
| Ga0070675_1003752564 | 3300005354 | Miscanthus Rhizosphere | MKKTTLLSILVVAVLLTIGVVGEAQQPAKVPRIGYLSGAGLSGL |
| Ga0070708_1009033391 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MGKAGVLSILFVVVLLAVAVIAEAQQPGKIPRIGYLSTTGDPSD |
| Ga0070707_1017167291 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKTGVSSILVAVVLLTLAVVAEAQQPKKVFRIGYLVATDPATESARFEA |
| Ga0073909_104057261 | 3300005526 | Surface Soil | MKKVEAKKAVPSILVAVVLFALGITAEAQQPKKIPRIGYL |
| Ga0066692_100639714 | 3300005555 | Soil | MVCAMRKAGVLSILFVVVPLAVAVIAEAQQPTKVPRMGFLS |
| Ga0066691_104651611 | 3300005586 | Soil | MKKAGVLSILILAVLLALAVVSEAQQPKKVPHIGFLSG |
| Ga0066905_1006020832 | 3300005713 | Tropical Forest Soil | MKRAEVPSILVAAVLLALGVIAEAQQRRKFRGWVF* |
| Ga0066905_1008551591 | 3300005713 | Tropical Forest Soil | MKRASTPAILVALVLLAVAVIAEAQQPKKVPRIGVLRLGSPPEPQIDAF |
| Ga0066905_1020715831 | 3300005713 | Tropical Forest Soil | MKKAAALSFLVVAVLLAVAVMAEAQQPKKVPRIGY |
| Ga0066903_1031170981 | 3300005764 | Tropical Forest Soil | MKKAAVPILVAVILLTVAVVTEAQQPAKVPRIGYLSNAD |
| Ga0066903_1050921301 | 3300005764 | Tropical Forest Soil | MSRVMKRAAVPLILVAVVLLVLGVTAEAQPTKIPRIGYLGASP |
| Ga0066903_1071862771 | 3300005764 | Tropical Forest Soil | MKKAAVPILVAVILLTLAVVTEAQQPKKVPRIGYLSGFDPATEAA |
| Ga0066903_1074641172 | 3300005764 | Tropical Forest Soil | MKKAAVPILVAVILLTVAIVTEAQQPKKVPRIGYLWPGNPTSETTDS |
| Ga0068863_1007207844 | 3300005841 | Switchgrass Rhizosphere | MVCAMRKAGVLSTLVAWVVLAVGVAAEAQQPTKIPQVGYL |
| Ga0068862_1017336212 | 3300005844 | Switchgrass Rhizosphere | MRKAGVLSTLVAWVVLAVGVAAEAQQPKKVPGIGYLSTNS |
| Ga0075290_10010683 | 3300005889 | Rice Paddy Soil | MVCAMKKAGVLSILLLAVLLAVAAEAPQPTKIPPIGYLGAGRSSF* |
| Ga0081455_100156151 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MKRAAVPSILVAVVLLALGVIAEVEQPKKVSRIGYLSNTDPAGE |
| Ga0081540_10253591 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MKRAAVPSILVAVVLLAVAVIAEAQQPKKVPRIGYLAASSSG |
| Ga0075417_100613503 | 3300006049 | Populus Rhizosphere | MTKAAVPSVLIAVVLLAVAVIAEAQQPKKASRIGYLSTYDPTRESPRAEAIRQAAMWMSRH* |
| Ga0075417_102546092 | 3300006049 | Populus Rhizosphere | MKRAAVPSILIAVVLLAFRVAVEAQQPKKVPRIGYLSVSSPSAMS |
| Ga0075417_106969681 | 3300006049 | Populus Rhizosphere | MKRAAVPSSFVAVVLLALGVIAEAQQPKKVARIGYISSGDPASESNRIEAIRLA |
| Ga0075432_100247062 | 3300006058 | Populus Rhizosphere | MTKAAVPSVLIAVVLLAVAVIAEAQQPKKVSRIGYLSTYDPTRESPRAEAIRQAAMWMSRH* |
| Ga0075432_101985442 | 3300006058 | Populus Rhizosphere | MKRAAVPSILVAVVLLVLGVTAEAQRPAKVPRIGYLILCHL* |
| Ga0075427_100308241 | 3300006194 | Populus Rhizosphere | MKKAAVPSVLIAVVLLAVAVIAEAQQPKKASRIGYLSTYDPTHESPRAEAIRQAAMWMSRH* |
| Ga0075427_101073251 | 3300006194 | Populus Rhizosphere | MKRAAVPSILVAVVLFAVTIIVEAEQPTKVARIGYLSVGRCS* |
| Ga0066665_116743362 | 3300006796 | Soil | MKRAAVPSILVVVVLLAVGVIAHAQQPKKVPRIGYLAPGDAAGDSIRSEA |
| Ga0066659_105263271 | 3300006797 | Soil | MKKAAVSSVLVAVLLGLGVIVEAQQPKKVPRIGYLSTGDAATESARAE |
| Ga0075428_1014155733 | 3300006844 | Populus Rhizosphere | MKKAAVPSILIAAILFAVATIAEAQPTKASKIGWLGIGT |
| Ga0075428_1021945642 | 3300006844 | Populus Rhizosphere | MKKIAVSSILVTVMLLTVGAIAEAQQPAKVWRIGVLVSSSSAAGP |
| Ga0075421_1005028471 | 3300006845 | Populus Rhizosphere | MCANKKARVLLILVVVVLLAVGVIAEAQQPKKVPRIGYL |
| Ga0075421_1021549731 | 3300006845 | Populus Rhizosphere | MTGNVCAMRKAAVFSVLFVLVLLAVAVIAEAQQPKKVPRIGYLS |
| Ga0075421_1022143601 | 3300006845 | Populus Rhizosphere | MKKAATPSILCAVMLLAFAVIAEAQQPIKSWRLGYLSA |
| Ga0075430_1004685821 | 3300006846 | Populus Rhizosphere | MKRAAVPSILVAVVLLALGVIAEAQQPKKVPRIGFLARSDQASQSTEAIRLAL |
| Ga0075431_1000302448 | 3300006847 | Populus Rhizosphere | VPSILIAVVLLAFRVAVEAQQPKKVPRIGYLSVSSPSAMSTRTEA |
| Ga0075431_1010407032 | 3300006847 | Populus Rhizosphere | MKRAAVPSILIAVVLLALGVIAEAQQPKKIPGIGYISSGNPAS |
| Ga0075431_1019146282 | 3300006847 | Populus Rhizosphere | MKGAAVPSSFVAVVLLALGVIAEAQQPKKVARIGYISSGDPASESNRIEAIRLAAMWMSSH* |
| Ga0075433_100837904 | 3300006852 | Populus Rhizosphere | MKGAAVPSILVAVMLCTVAAGSEAQQLGKVHRIGVLSGGFRGSSA |
| Ga0075433_102048743 | 3300006852 | Populus Rhizosphere | MKRAAVPSIRIAVLLLAVAVIAEAQQPKKVHQIGYLSGADPTTGIAGGR* |
| Ga0075433_103123993 | 3300006852 | Populus Rhizosphere | MCAMKKARVLSILFVAVLLAVAVIAEAQRPKKIPRIGYLVEGDPTTESTRSK |
| Ga0075433_109997742 | 3300006852 | Populus Rhizosphere | MKQAAVPSTLIAVVLLAVAAIAEAQQPKKVFRIGYLSALDPARESARSEAIKL |
| Ga0075433_113097272 | 3300006852 | Populus Rhizosphere | MKKAAVTSILVAVVLLALGVTAESQQSKKVTRIGYLS |
| Ga0075433_117748062 | 3300006852 | Populus Rhizosphere | MKKAAVRSILVVVVLLVLGVIAEAQQPKKVPRIGYL |
| Ga0075433_119221551 | 3300006852 | Populus Rhizosphere | MKRAAVPSILIAVVLLAFRVAVEAQQPKKVPRIGYL |
| Ga0075420_1003175632 | 3300006853 | Populus Rhizosphere | MKKAAVPSSHVVVVLLAVAVIAEAQQPTKVPRIGHLSIFG |
| Ga0075425_1007224241 | 3300006854 | Populus Rhizosphere | MKKAAVPSVLIAVVLLAVAVIAEAQQPKKASRIGYLSTYDPTRESPRAEAIRQAAMWMSRH* |
| Ga0075425_1015455921 | 3300006854 | Populus Rhizosphere | MKKAGVLSILFVVTLLVVGVIAEAQQAKKVSRLGYLSPVDAA |
| Ga0075425_1028550732 | 3300006854 | Populus Rhizosphere | MKKAAVPSILVVAVLLAVAVIAEAQQPKKIPGIGYISSGNPASESTRAEAIRL |
| Ga0075429_1000318811 | 3300006880 | Populus Rhizosphere | YITLETRCAMKRAAVPSILVAVVLLVLGVTAEAQRPAKVPRIGYLILCHL* |
| Ga0075429_1006025811 | 3300006880 | Populus Rhizosphere | MKRAAVPSILIAVVLLAFRVAVEAQQPKKVPRIGY |
| Ga0075429_1009816391 | 3300006880 | Populus Rhizosphere | MKKAAVPSTLVAVVLLVLGVTAEAQQPKKVPQIGH |
| Ga0075429_1012058122 | 3300006880 | Populus Rhizosphere | MKKAAVLSILFILLLLAVSVIAEAQEAKKMPRIGYIS |
| Ga0075429_1019751751 | 3300006880 | Populus Rhizosphere | MRKAIFSILFVVVLLAVAVSAEAQQPGKIPRIGYLSGARSDG |
| Ga0075424_1009747631 | 3300006904 | Populus Rhizosphere | MRKARALSILFVVVVLAVAVVAEAQQPKKVPRIGHLNA |
| Ga0075424_1018113021 | 3300006904 | Populus Rhizosphere | MKRAGVPSILVVVVLLALGVIAEAQQPKKVPRIGYLAGFD |
| Ga0075419_100042971 | 3300006969 | Populus Rhizosphere | CAMKRAAVPSILVAVVLLALAAMAEAQQPAKVPRIGYLILCHL* |
| Ga0075419_103608632 | 3300006969 | Populus Rhizosphere | MKRAAVPSILIAVVLLAFRVAVEAQQPKKVPRIGYLSVSSPS |
| Ga0075419_104610561 | 3300006969 | Populus Rhizosphere | MKRAAVPSILIVVVLLAVGVIADAQQTGKVARIGFLD |
| Ga0075419_114335232 | 3300006969 | Populus Rhizosphere | MKRAAVPSILIAVILLAVAVTGEEQQTGKVFRIGILDP |
| Ga0075435_1005771154 | 3300007076 | Populus Rhizosphere | MMRAMRKVGVFSILFVTVPLALAVIAEAQQQAKLPKIGW |
| Ga0066710_1037256641 | 3300009012 | Grasslands Soil | MRKAGVLSILLGVVLLAVAVIGEAQQPNKGRRIVILSASY |
| Ga0111539_107568281 | 3300009094 | Populus Rhizosphere | MKRAAVPSILVAVVLLALGVIAEAQQPKKVPRIGFLARFDKARETTE |
| Ga0111539_127052881 | 3300009094 | Populus Rhizosphere | MKRAAVPSILVAVVLLAVAVIAEAQQPKKVSKIGYLTGASPSFEA |
| Ga0111539_127514282 | 3300009094 | Populus Rhizosphere | MMRAMKKAGVLSILFVVVMLAVSVIANAQQPTKVPRIGILH |
| Ga0075418_103827761 | 3300009100 | Populus Rhizosphere | MKRAAVSSILVVMVLLAVAVIAEAQQPKKVPLIGYFSSTDPATE |
| Ga0075418_108231921 | 3300009100 | Populus Rhizosphere | MKRAAVPSILVAVLLLAVAITAEAQQPKKVPRIGFLARSDQASQSTEAIRL |
| Ga0075418_121510592 | 3300009100 | Populus Rhizosphere | MKRAAVPTILVAVVLLAIGVIAEAQQAKKVPRIAYLGGGSA |
| Ga0075418_126953803 | 3300009100 | Populus Rhizosphere | MKKAAVPSILVAVVLLPLGVIAQAQQPAKTFKVGWLESAT |
| Ga0114129_100842361 | 3300009147 | Populus Rhizosphere | MRKAGLPSIVVVVVLLAVAVIAEAQQPNKVPRIGYLLPG |
| Ga0114129_101999971 | 3300009147 | Populus Rhizosphere | MKKAGLLSILFAVTLLVVGVIAEGQQPKKVPLIGYLSAGGDAASESTRAEAIRLA |
| Ga0114129_103826875 | 3300009147 | Populus Rhizosphere | MGMKKAGVLSILLVAVQLAVAVIAEAQQPKKVFRIGYLSNTDA |
| Ga0114129_110639412 | 3300009147 | Populus Rhizosphere | MRKAGVLSTLLVVVLLAVAVIAEAQQPKKVPRIGYLSAAQGTRFL* |
| Ga0114129_115210762 | 3300009147 | Populus Rhizosphere | MKKAAVPSILIVVVLLAVAVIAEAQQSKKVTRIGYLAPSDAATESTRSEP |
| Ga0114129_131038521 | 3300009147 | Populus Rhizosphere | MKRAAVTSILVAVVLLALGVIAEAQQPGKIPRIGYLESSGGPNI |
| Ga0114129_131555201 | 3300009147 | Populus Rhizosphere | MKKAAVPSILIAVVLLALGVIAEAQQPKKVPLIGYLSNSDPATESTRSEAIRL |
| Ga0114129_135014271 | 3300009147 | Populus Rhizosphere | MKKAAVPSILVAVVLLALGVTAEAQQAAKVQRIGYLSSGDAARESTRAEAI |
| Ga0111538_107375953 | 3300009156 | Populus Rhizosphere | MKKAAVPSILVAVVLLALGVIAEAQQPKKVTRIGYLSNTD |
| Ga0111538_128188521 | 3300009156 | Populus Rhizosphere | MKKTALSSILVVVVLLAAVTAEAQQSTKIPRIGYLSGGF |
| Ga0105092_100963581 | 3300009157 | Freshwater Sediment | MNKFGLPSILILVVLLAVAVIAEAQQPKKVHRIGYLSSA |
| Ga0075423_105437651 | 3300009162 | Populus Rhizosphere | MRKAGVLSILFVVVLLAVESEAQQAGKVPRIGILAPGSS |
| Ga0075423_118444261 | 3300009162 | Populus Rhizosphere | MKKAAMPSILVAVVLLALGVIAEAQQPKKVSRIGYLV |
| Ga0105104_102260831 | 3300009168 | Freshwater Sediment | MKKATVPSILFAVVLLALGVTAGAQQPKKVSRIGFLSALSPSA |
| Ga0105104_102562912 | 3300009168 | Freshwater Sediment | MKKAAVPSILVAVVLLALGVIAEAQQPTKVPRIGYLSNTDNSGFFI |
| Ga0105104_103490511 | 3300009168 | Freshwater Sediment | MKKAAVPSILVAVVLLALGVTAAAQQTKKIPKIGYVSGGDAASE |
| Ga0105104_103590191 | 3300009168 | Freshwater Sediment | MKKAAVPSILVAVVLLAVGVTAEAQQPKKIPTIGYLV |
| Ga0105259_10379093 | 3300009597 | Soil | MRKAAVPSILVVVVLLAVAVIAEAQQPKKVPRIGYLWGG |
| Ga0105259_10894722 | 3300009597 | Soil | MKKAGLSSILVAVVLLAVGVTAEAQQPKKVWRIGYLSNVEAVSDSARTEAI |
| Ga0105056_10703051 | 3300009801 | Groundwater Sand | LETRCAMKKAAVPSILVAVVLLAVAVIAEVQQPKKVSPIGF* |
| Ga0105088_11061852 | 3300009810 | Groundwater Sand | MKKAAVPSILVVVVLLAVAVIAEAQQPTKVPRIGYLSNGGPA |
| Ga0105084_10825721 | 3300009811 | Groundwater Sand | MKKAAVPSILVAVVLLALAVIGEAQQPKKVYRIGLLRGSSAST |
| Ga0105062_10611541 | 3300009817 | Groundwater Sand | MKRAAVPSILLAVVLLAVGVIAEAQQPRMYKIGELTARPGL |
| Ga0105062_10991701 | 3300009817 | Groundwater Sand | MKKAAVPSILVAVVLLALGVIAEAQQPKKVPRLGYLSVGDPATDSGR |
| Ga0105062_11404551 | 3300009817 | Groundwater Sand | MLETRCAMKKSAVPSILVAVVLLALGVIAIAEAQQPKKVPRIGYLSASDPGSESARSEAIRL |
| Ga0105078_10392981 | 3300009823 | Groundwater Sand | MKKAAVPSILFAVMLLAVAVITEAQQPKKVSRIGYLA |
| Ga0105068_10229921 | 3300009836 | Groundwater Sand | MNKFGLPSILIAVVLLLVAVIAEAQQPKKVPLIGYLSAFEPAFESTRAEAIR |
| Ga0105058_11192471 | 3300009837 | Groundwater Sand | MKRAAVPSILVAVVLLALGVIAIAEAQQPKKVPRIGYLSA |
| Ga0105074_10153322 | 3300010029 | Groundwater Sand | MKKAAVSSILVAVVLLAVAVIAQAQQPGKVHRIGYLSTV |
| Ga0105074_10827051 | 3300010029 | Groundwater Sand | MKKARLSSILIAVVLLALGVIAEAQQPKKVPQIGYLSSTDAARESTRAEAI |
| Ga0126380_100399003 | 3300010043 | Tropical Forest Soil | MLETRYAMKKAAVPSILIAVVLLALGVIAEAQQPKKVHRIGFLAPGDPVSQSTEAIRLAAMWMSSH* |
| Ga0126380_101790031 | 3300010043 | Tropical Forest Soil | MRCALKRAAVLSIGVAVVMLAVAVMVEAQQPKKVPRIGYGQ* |
| Ga0126380_102219711 | 3300010043 | Tropical Forest Soil | MKKARVSSILVAVVLLAAGVIAEAQQATKIWRIGCLTSGSTVTESGRAEGTRLAL |
| Ga0126380_104630433 | 3300010043 | Tropical Forest Soil | MKHAGVSSILVALVLLSFGVIAEAQQAAKVHRIGYLSALDPG |
| Ga0126384_100172755 | 3300010046 | Tropical Forest Soil | MMRAAVPSILVAVVLLALGVTAEAQETKKVSRLGYLSSLDPARESPRSEAIRLAFRNRCYIGRTR* |
| Ga0126384_102783251 | 3300010046 | Tropical Forest Soil | MKKAAVPAILVAVVLLAVRLIAEAQHAKKVPRIGYLSNFDP |
| Ga0126384_105985072 | 3300010046 | Tropical Forest Soil | MKKAAVPILVAVVMLALGVTAEAQQPKKVPRIGYLSNLDPATE* |
| Ga0126384_109121592 | 3300010046 | Tropical Forest Soil | MKKAAVPILVAVVMLALGVTAEAQQPKQVSRIGYISALDPARESARFEGIKLALRE |
| Ga0126384_118186891 | 3300010046 | Tropical Forest Soil | MKKAAVPILGAVILLTVAVVTEAQRPKKVPRIGYLSSSDA |
| Ga0126384_120649141 | 3300010046 | Tropical Forest Soil | MKKAAVQSILVAVVMLALGVAAEAQQPKQVSRIGYISALDPARESARFEGIKLALRE |
| Ga0126382_114029101 | 3300010047 | Tropical Forest Soil | MKQAGVSSALVAVMLLAAGVIAEAQQPNKVPLIGCLS |
| Ga0126382_117906961 | 3300010047 | Tropical Forest Soil | MKKVGWSSILVAAMLLALGVIAEAQQPAKIPRIGYLSNADAATDSAR |
| Ga0126382_122120471 | 3300010047 | Tropical Forest Soil | MKQAGVSSILVVVALLAAGVIAEAQPAGKAFRIGYLTSFGP |
| Ga0134070_104431172 | 3300010301 | Grasslands Soil | MKKAAVSSILVAVVLLALGVIAQAQQPKKVPRMGYLTA |
| Ga0134088_107112572 | 3300010304 | Grasslands Soil | MRCGVKRAAVPSILIAVVLLAVEVIAEAQQPKKVPRIGYLSSGNP |
| Ga0134086_100456711 | 3300010323 | Grasslands Soil | MRKAAVLSILVLLAVAVMAEAQQPVKVPRIGIVTAQPLSAGA |
| Ga0134080_106848481 | 3300010333 | Grasslands Soil | MVWAMRKASVLSILVLLAVAVIVEAQQPKKVSRIG |
| Ga0126370_110510221 | 3300010358 | Tropical Forest Soil | MKRAKTRSILVAVLLLIGAVKAEAQQPKKVPRIGYLSNADAA |
| Ga0126370_119024941 | 3300010358 | Tropical Forest Soil | MKRAAVPSILVVVVLLALGVTAEAQQAEKVFRIGYLGS |
| Ga0126370_124399261 | 3300010358 | Tropical Forest Soil | MKRAAVPSILVAVVLLAVGVTAEAQQSKKVPRVGYLASGDPDSDSARSEAIRVAL |
| Ga0126370_124691221 | 3300010358 | Tropical Forest Soil | MKKAGLSSILITVVLLAVGVMAEAQQPKKVPRMGYLSEV |
| Ga0126376_116008362 | 3300010359 | Tropical Forest Soil | MKKAAVLSVLCAVVLLALAVIAEAQQPKKVPRIGYLSSSD |
| Ga0126372_125738241 | 3300010360 | Tropical Forest Soil | MKKAAAILVAVVLLALGVTAKAQQPKKVPRIGYLSALDPASESF |
| Ga0126378_123410492 | 3300010361 | Tropical Forest Soil | MKRAAVPSILVAVVLLAVAAIAAAQQTRLPRVGYASTNY |
| Ga0126377_108495742 | 3300010362 | Tropical Forest Soil | MKKPAVPSILIAVVLLALGVIAEAQQPKKVHRIGFLAPGDPISQS |
| Ga0126377_110844342 | 3300010362 | Tropical Forest Soil | MKKTAVPSIFVVVLQLALGVIAEAQQSKKVPRIGYLSAFDAASDF |
| Ga0126377_111561981 | 3300010362 | Tropical Forest Soil | MKKAAVPSILVAVVLVALGVTAEAQQPKKLPRLGYLSSGDP |
| Ga0126377_130737771 | 3300010362 | Tropical Forest Soil | MKKAAVLSSLIAVVLLAVAVITQAQQPAKVSRIGY |
| Ga0126377_135762422 | 3300010362 | Tropical Forest Soil | MKKTAVPSILGTVILFAITAIAEGQQPVKVRRIGYLGLSIP |
| Ga0126379_102169991 | 3300010366 | Tropical Forest Soil | MKKAAPSILIAVVLLALGAIAEAQQPAKIPRIGYLSNADAARE |
| Ga0126379_103147421 | 3300010366 | Tropical Forest Soil | MKRAPVPSILVAVVLLAVAVVVEAQQPKKVHRIGYLSSQDAAG |
| Ga0105239_124188361 | 3300010375 | Corn Rhizosphere | MRKAAVLSILVVAMLLAVGVMAEAQQTKKVPRIGYLSS |
| Ga0126381_1018690881 | 3300010376 | Tropical Forest Soil | MMRAAVPSILVAVVLLALVVTAEAQQPKKVSQIGFLNFSS |
| Ga0126381_1041806411 | 3300010376 | Tropical Forest Soil | MVSAMKKAGVSSILFVVILLAVAVIAEAQQTRSVTRIGYLSSVNPANESARAD |
| Ga0126383_100517811 | 3300010398 | Tropical Forest Soil | MMRAAVPSILVAVVLLALGVTAEAQETKKVSRLGYLSSLDPARESP |
| Ga0126383_112705471 | 3300010398 | Tropical Forest Soil | MKKAAVPSILIAVVLLAVAVIAEEQQPKKVPRIG* |
| Ga0126383_118147082 | 3300010398 | Tropical Forest Soil | MMRAAVPSILVALVLLALGVTAEAQETKKVSRLGYLSSLDPARESPRSEA |
| Ga0134122_100525103 | 3300010400 | Terrestrial Soil | MKKAGAVSILFVVVLLAVGVIAEAQQPKKVPRIG* |
| Ga0137392_108502241 | 3300011269 | Vadose Zone Soil | MKKASVLSILIAVVLLGVEMTAETQQPAKIPRIGLLTGTAL |
| Ga0137453_10448112 | 3300012034 | Soil | MKKTGWSLILIAALLLTVAVVADAQQPKKVPLLGYLSNSDPATDST |
| Ga0137349_10151632 | 3300012160 | Soil | MKRAAVPSILVVVVLLALGGIAEAQQPKKVTRIGYLSTSDPATDSTRAEAIRL |
| Ga0137334_10476581 | 3300012179 | Soil | MKRAAVPSILVAVVLLAVAVIAGAQQPKKVPRIGYL |
| Ga0137364_112604001 | 3300012198 | Vadose Zone Soil | MKKAGVLSILFMVVLLGIAVIIEAQQPKKVPRIGYL |
| Ga0137382_100558444 | 3300012200 | Vadose Zone Soil | MKKAGVLSILFMVVLLGIAVIIEAQQPKKVPRIGY |
| Ga0137363_100277307 | 3300012202 | Vadose Zone Soil | MRKAGVLSILVAVVLLALGVIADAQQPKKVPRIGYL |
| Ga0137363_101399401 | 3300012202 | Vadose Zone Soil | MKRAAVPSILVAVVLLALGVTADAQQPKKVSRLGYLTPAEPAREYARAEAVRLA |
| Ga0137363_109702072 | 3300012202 | Vadose Zone Soil | MKRAAVRSILVVVVLLALGVIAEAQQPKKVPRIGYLSIGDPATESTRTE |
| Ga0137374_110931462 | 3300012204 | Vadose Zone Soil | MKKAGVLSILFVVVLLAVAVIAEAQQPNKVPRVGFLAGVSPSTI |
| Ga0137362_110338081 | 3300012205 | Vadose Zone Soil | MRKAGVLSILFVVVPLAVAVIAEAQQPKKILRIGYL |
| Ga0137376_101143631 | 3300012208 | Vadose Zone Soil | MKKAAVPSILVVVVLLAVGVIAHAQQPKKVPRIGYLAPGDAAGDSIRS |
| Ga0137376_101583593 | 3300012208 | Vadose Zone Soil | MKKAGVLSILFVAVLLAVAVIAKAQQPTKIARIGFLSNNSLAAVS |
| Ga0137379_114893981 | 3300012209 | Vadose Zone Soil | MKKAAVPSILVAVVLLALGVTAEAQQPKKVPRIGYLSSVDSATESTRSEPFGT |
| Ga0137378_105679243 | 3300012210 | Vadose Zone Soil | MKEAGVSSILIAVVLLALGVIAEAQQTKKVPRIGHLSSF |
| Ga0137378_115597562 | 3300012210 | Vadose Zone Soil | MKKAAVPSILVAVVLLALGVTAEAQQPKKVPRIGYLS |
| Ga0137377_115371702 | 3300012211 | Vadose Zone Soil | VKRAAVPSILAVVLLALGVTAEAQQAKKVPRIGYLSIGDPAT |
| Ga0137372_105090801 | 3300012350 | Vadose Zone Soil | MRKAAVLSILFVAVPLAVAVIAEAQQLTKVPRMGFLSSLS |
| Ga0137366_102770023 | 3300012354 | Vadose Zone Soil | MKKARLSSILIAVLMLAVAVMAEAQQPKKVPRIGFLSGFSSSSDRK |
| Ga0137366_104567241 | 3300012354 | Vadose Zone Soil | MRKAGVSSSLFVVALLAVAVIAEGQQPKKVPRIGLLRPGSPPDPYVDAFR |
| Ga0137369_100341695 | 3300012355 | Vadose Zone Soil | MKKAGVLSILFVVVLLAVAVIAEAQQPKKVHRIGQLSQFDVAGESSRSEAIRLAAMWMSSH* |
| Ga0137369_102295081 | 3300012355 | Vadose Zone Soil | MRKVSVLSILFVVVLLALGVTAEAQQPKKVPLIGYIGSQD |
| Ga0137369_107613062 | 3300012355 | Vadose Zone Soil | MAGLSVIAVILLVLGAVAEAQQPIKIPRIGYLSSNSVAAM |
| Ga0137385_102489251 | 3300012359 | Vadose Zone Soil | MRKAGVLSILFVVMLLAVAVIAEAQQTGKIAHIGF |
| Ga0137375_100565645 | 3300012360 | Vadose Zone Soil | MRKAGVLSILVLLAVAVAAEAQQPKKVPRIGYISSGDAARE |
| Ga0137360_103173573 | 3300012361 | Vadose Zone Soil | MKRAAVPSILVAVVLLALAVIAEAQQPKKVHRIGY |
| Ga0137360_104846751 | 3300012361 | Vadose Zone Soil | MKKVGRSSILVAAMLLTVAIIAEAQQPKKVQRIGYLGATDAAGEST |
| Ga0137361_118382471 | 3300012362 | Vadose Zone Soil | MKKEVLLSILVVAVQLAVAVIAEPQQQKKVPRIGYLS |
| Ga0157345_10261862 | 3300012498 | Arabidopsis Rhizosphere | MRKASVLSTLVAWVVLAVGVIAEAQQPTKIPQVGYLNGGFLSGI |
| Ga0157313_10055043 | 3300012503 | Arabidopsis Rhizosphere | MRKAIFSILFVVVLLAGAIIAEAQQPKKVPRIGYLSSF |
| Ga0157326_10221093 | 3300012513 | Arabidopsis Rhizosphere | MRKAAVLSTLVAWVVLAVGVAAEAQQPKKVPGIGYLSTNSSSTNPAR |
| Ga0157352_10012824 | 3300012519 | Unplanted Soil | MMRAMKKAGVLPILFVVALLVAVIAKAQQPTKMSRIGFIG |
| Ga0137373_104413581 | 3300012532 | Vadose Zone Soil | MRKAGVLSILFVVILLAVAVIADAQQPAKVPRIGVISTGSPSLTGATNLDA |
| Ga0137373_112224991 | 3300012532 | Vadose Zone Soil | MKRAAVPSILVAVVLLAVAVIAEAQQPKKVPLIGYFSSTSY* |
| Ga0137394_107739412 | 3300012922 | Vadose Zone Soil | SKRGAQMKKAAVTSILVAVVLLALGVTAGAQQPKKVPRIGYLSPFDPVA* |
| Ga0137359_101481403 | 3300012923 | Vadose Zone Soil | MKKTGFLSILFVVALLAIAVIAEAQQPTKMSRIGF |
| Ga0137359_102250823 | 3300012923 | Vadose Zone Soil | MKKAAVPSILVAVVLLALGVIAEAQQPTKIPRIGYLGFGSPSTI |
| Ga0137419_101011002 | 3300012925 | Vadose Zone Soil | MKKAGLLSILFAVTLLVVGVIAEAQQPKKVHRIGYLSSFD* |
| Ga0137416_117501731 | 3300012927 | Vadose Zone Soil | MKKAAVPSILVAVVLLALGVIAEAQQPKNVPRIGYLAAGD |
| Ga0137404_102516085 | 3300012929 | Vadose Zone Soil | MMRAMRKVGVFSILFVTVPLAVAVIAEAQQQAKLPKIGWL |
| Ga0137404_107407722 | 3300012929 | Vadose Zone Soil | MKKAGVLSILFLVVLLAVAVMAEAQQPKKVPRIGYL |
| Ga0137407_100264699 | 3300012930 | Vadose Zone Soil | MRKTGVLSILFLVVLLAVAVIAEAQQPTKVPRIGYL |
| Ga0137407_101635941 | 3300012930 | Vadose Zone Soil | MKRAAVPSILVVVILLAVGVTTEAQQPKKVSRLGYLS |
| Ga0137407_105847631 | 3300012930 | Vadose Zone Soil | MKRAAVPSILVVVGLLTLAVIAEAQQPKKVHRIGYLSPFDPVA |
| Ga0137407_118617221 | 3300012930 | Vadose Zone Soil | MKKAGLSSILIAVVLLAVGVIVEAPQPKKVPRIGYLASADAATESTRAE* |
| Ga0137407_120615302 | 3300012930 | Vadose Zone Soil | MVWAMKKAALLSILIVVVQLAVGVIAEAQQPKKVPRIGYLSS |
| Ga0137410_114313291 | 3300012944 | Vadose Zone Soil | MKRAAVPSILVPVVLLAVGVIAEAQQPKKVPRIGYLSAADPTRESARSEAI |
| Ga0126375_119417091 | 3300012948 | Tropical Forest Soil | MKRAAVPSILVAVVLLAVGVITEAQQPKEAPRIGYLSPVDAATDSPRADGI |
| Ga0164303_104455863 | 3300012957 | Soil | MMRAMKKAGVLSILFVVVLLAVAVIAKAQQPKKIARIGFL |
| Ga0164303_105092091 | 3300012957 | Soil | MKKTAVPSILIAVVLLAVAVIAEAQQPKKVPQIGYLSSSDP |
| Ga0164303_107504502 | 3300012957 | Soil | MKRAAVPSMLVAVVLFAATIVVEAEQPKKVPRIGYL |
| Ga0164303_110606172 | 3300012957 | Soil | MKKAGVLSILFVVEMLAVGVIANAQQPKKMPRIGFLS |
| Ga0126369_102201372 | 3300012971 | Tropical Forest Soil | MKRASMPSILVLVVLLAFAVIAEAQQSGKIFRIGI |
| Ga0164304_105786691 | 3300012986 | Soil | MKRAAVPSILVAVVLLALGGIAEAQQPKKVPLIGYLSPLDSASEFTRAE |
| Ga0164305_102242251 | 3300012989 | Soil | MKRAAVPSILVVVVLLALGVIAEAQQPKKVSRLGYLTPAEPAREYARAEAVRL |
| Ga0157378_100623501 | 3300013297 | Miscanthus Rhizosphere | MKKTAVPSILIAVILLAVAVIAEAQQPGKVPRIGF |
| Ga0157378_102093994 | 3300013297 | Miscanthus Rhizosphere | MKKAGVLSILVLLAVGLIAEAQQPKKVSRIGYLSSFHPASESARS |
| Ga0157378_121894461 | 3300013297 | Miscanthus Rhizosphere | MKKTGWASIMFAAMLLAVAAIAEAQQPKKVHRIGYLSVLDPARESARA* |
| Ga0180088_10625992 | 3300014868 | Soil | MMYTMTKAGLLSILFTVGLLAVAVIAEAQQAAKVPRI |
| Ga0180083_11198221 | 3300014875 | Soil | MRCVKKRAAVPSILVVVVLLAVAVIAEAQQAKKIPRIGYLSSQEP |
| Ga0180074_10042561 | 3300014877 | Soil | GGLSILFVVVLLAVAIIAEAQQPKKVSRIGSELL* |
| Ga0180082_11615422 | 3300014880 | Soil | MKKAAVPSILVAVVLLAVAVIAEAQQPTKVYRIGYL |
| Ga0180086_11298121 | 3300014883 | Soil | MKKALAPSILVAMMLFAVGVTAQAQQPKKVPRIGYLS |
| Ga0180063_10787181 | 3300014885 | Soil | MKEAGVSSILIAVVLLAVAVMAEAQQAPRVGVLLALSHSDIS |
| Ga0180085_12351142 | 3300015259 | Soil | MKRAAVPSILVAVVLLGVGVIAEAQQATKIPQIGYL |
| Ga0137403_101214651 | 3300015264 | Vadose Zone Soil | MKKAGVLSILFLVVLLAVAVMAEAQQPKKVPRIGYLTLTASPRG |
| Ga0137403_101766031 | 3300015264 | Vadose Zone Soil | MKKAAVPSILVAVVLLALGVIAEAQQPKKVPRIGYLA |
| Ga0134089_102026072 | 3300015358 | Grasslands Soil | MYTMKNPGLLSIPFVVVLLAVGVIAEAQQPEKIPRIGY |
| Ga0132258_117770132 | 3300015371 | Arabidopsis Rhizosphere | MKKAAVLSILVVAMLLAVGLIAEAQQPKKILRIGYLSNTDPASESGRS |
| Ga0132257_1004271001 | 3300015373 | Arabidopsis Rhizosphere | MKKAGLLSILFAVTLLVVGVIAEAQQPKKVPLIGYLSAGGDAASESTRAEAIRLA |
| Ga0132255_1010618671 | 3300015374 | Arabidopsis Rhizosphere | MKRAAVPSILVAAVLLGLGVIAEAQQPKKVPRIGYFWASDTTRSEAIR |
| Ga0132255_1017291051 | 3300015374 | Arabidopsis Rhizosphere | MKKTAVPSILIAAMLLAVAVLAEAQQPKKVYRIGYLS |
| Ga0132255_1020992381 | 3300015374 | Arabidopsis Rhizosphere | MRKAGVVSVLLVLLLAIAVIAEAQQTGKVPRIGFLAA |
| Ga0132255_1042119902 | 3300015374 | Arabidopsis Rhizosphere | MKKAGVLSILFVVVLLAVAVIAKAQQPTKMSRIGFIGAS |
| Ga0132255_1063005162 | 3300015374 | Arabidopsis Rhizosphere | MRKAGVLSTLVAWVVLAVGVIAEAQQPTKIPQVGYLNGGFLSGIA |
| Ga0182035_104269991 | 3300016341 | Soil | MRGMKKAVALSMLVAIVLLALGVIAEAQQPAKIPRGYRPL |
| Ga0182040_114748721 | 3300016387 | Soil | MKKAGVLSILLVVVLLAFAVIADAQQTRLPRIGYASTN |
| Ga0184610_10469431 | 3300017997 | Groundwater Sediment | MGRAMRKAVLTILFVVVLLAVAVIAAAQQPKKIPRIG |
| Ga0184610_12498192 | 3300017997 | Groundwater Sediment | MRKAGVLFILFVVVLLGIVEAQQPKKVPRIGYLSALD |
| Ga0184605_103515231 | 3300018027 | Groundwater Sediment | MKKALPPSILIAVMLLAVAVIAEAQQTRSVTRIGYLS |
| Ga0184605_104927562 | 3300018027 | Groundwater Sediment | MKKAAVPSILVAVVLLALGVIAEAQQPKKVPRIGYLSVSDP |
| Ga0184608_101447001 | 3300018028 | Groundwater Sediment | MRKARVLSILFVVLLFAVAIIAEAQQPKKVPRIGYLSA |
| Ga0184608_102831041 | 3300018028 | Groundwater Sediment | MKRAAVPSILIAVVLLAVAVTAEAQQPKKVPRIVYLSALDPASEAFRSEPI |
| Ga0184620_101252891 | 3300018051 | Groundwater Sediment | MRKAGVLSILFVVVLLAFAVIAEAQQAQKVPRIGVLRSVTLTPTAQ |
| Ga0184620_101487692 | 3300018051 | Groundwater Sediment | MKRAAMPSILVAVVLLAVGVIAEAQQPKKVTRIGYLSNTDPAR |
| Ga0184626_100547111 | 3300018053 | Groundwater Sediment | MKKAALLSILFVVVLLAVAVRAEAQQPGKVPRIGFLESSTASGIA |
| Ga0184621_102999381 | 3300018054 | Groundwater Sediment | MKKAGWTSWTSFLVAAVLLNVAVVAEAQQPKKVPRIGYLSAFEPATE |
| Ga0184619_101190691 | 3300018061 | Groundwater Sediment | MRKAGVLSILLVVLLLAVAVIAEAQQPKKVLRIGYLSSFESAFESTR |
| Ga0184637_101782241 | 3300018063 | Groundwater Sediment | MKKAAVTSILVVVVLLAVAVIAEAQQPKKVPRIGYLSAIDAAT |
| Ga0184635_103791171 | 3300018072 | Groundwater Sediment | MKRAAVTSILVAVVLLALGVTAEAQQPKKVHRIGYLSALDPASES |
| Ga0184632_100639191 | 3300018075 | Groundwater Sediment | MKKAAVPSILVAVVLLVLGVIAEAQQPKKVPRIGYLSAFD |
| Ga0184632_100698771 | 3300018075 | Groundwater Sediment | RCAMKKAAVPSILVVVVQLAVGVIAEAQQPKKLHRIAFY |
| Ga0184632_102196881 | 3300018075 | Groundwater Sediment | MKKAAVLSILVTVVSLAFEVTGEGQQAKKVYRIGYLT |
| Ga0184632_103142881 | 3300018075 | Groundwater Sediment | MKRSGLSSILVAVVLLVLGVIAEAQQPKKVYRIGYLSSVDATGDSARA |
| Ga0184632_103747851 | 3300018075 | Groundwater Sediment | MRKAGVLSILFLAILPAVAGMAEAQQPKKVVRIGYLRPSVST |
| Ga0184609_101314102 | 3300018076 | Groundwater Sediment | MKKAGVLSILVVVVLLAVAVVADAQQTKKIPRIGYLAGDPRAP |
| Ga0184609_101532512 | 3300018076 | Groundwater Sediment | MVCAMRKAGVLSILFVVILLAFAVIAEAQQPKKVPQIGYLSATDPADES |
| Ga0184609_102650591 | 3300018076 | Groundwater Sediment | MKRAAVPSILVAVVLLAVGVTAEAQQPKKVPRIGYLSPFDPARESSR |
| Ga0184625_100909133 | 3300018081 | Groundwater Sediment | MKKAAVPSILIAVVLLAVAAIAEAQQPKKVHRIAFY |
| Ga0184625_103688041 | 3300018081 | Groundwater Sediment | MKRVAVPSILVAVVLLAVAVIAEAQQVKKVARIGYLSGGDAARESSRAEAIR |
| Ga0184629_101595923 | 3300018084 | Groundwater Sediment | MKNAGLSSVVIAVVLLAVGAIADAQQPNKVPRIGYLSSFDP |
| Ga0066667_101364411 | 3300018433 | Grasslands Soil | MVCAMRKAGVLSILFVVVPLAVAVIAEAQQPTKVPRMGFLSSLSP |
| Ga0066669_107164491 | 3300018482 | Grasslands Soil | MKKAAVLPILFVVVLLAVAVIAAAQQPKKVLRVGLLAGGRG |
| Ga0193723_10255451 | 3300019879 | Soil | MKARVSILFVAVLLAFSVIAEAQQPKKVPRIGYLSLT |
| Ga0193727_10236791 | 3300019886 | Soil | MKKAGLLSILFVVALLAVAVIAEAQQPKKVHRIGYLSSFDAAT |
| Ga0193730_11690241 | 3300020002 | Soil | MRKAGVLSILFVPVLLAVAVIAEAQQPTKDPRIGYLTALNPVTES |
| Ga0193739_10586252 | 3300020003 | Soil | MKKAAVLSILVVVVLLAVGVIAEAQQPTKIPRIGFLTGSPSV |
| Ga0193735_10107083 | 3300020006 | Soil | MRKAGVLPILVVVAVLAVGVIAEAQQPKKVPRIGYLSSFHPASE |
| Ga0210401_112125642 | 3300020583 | Soil | MKKAAVLSILVVAVQLAVGVSAEAQQPAKVSRIGFLT |
| Ga0210379_105045071 | 3300021081 | Groundwater Sediment | MKKAGLSSILIAVTLLAVAVIAEAQQPKKVPRIGYLSS |
| Ga0193719_102950612 | 3300021344 | Soil | MRKAGVLSILFAVVLLAVADIANAQQPKKVPVIGYL |
| Ga0126371_123352582 | 3300021560 | Tropical Forest Soil | MKKGAVLSILVAVAVLAVGAIAEAQQPRKVPRIGFSQRPTSGTR |
| Ga0224452_11232881 | 3300022534 | Groundwater Sediment | MKRAAMPSILVAVVLLAVGVIAEAQQPKKVTRIGYLSNTD |
| Ga0222623_102407701 | 3300022694 | Groundwater Sediment | MKKAAVSSILVAVVLLALGVIAEAQQPKKVPLIGYLSTQDPALESIRSERVRLALR |
| Ga0222623_104050271 | 3300022694 | Groundwater Sediment | MKRAAVPSILVVVVLVAVAVIAEAQQPKKVPRIGY |
| Ga0222622_103089331 | 3300022756 | Groundwater Sediment | MKKAAVPSILVAVVLLALGVIAEAQQPKKVPRIGYLSPSDAAIES |
| Ga0207650_108665571 | 3300025925 | Switchgrass Rhizosphere | MEPRGKYAMKKAAVLSSLVVAVVVAVGEIAEAQQAKKIPRIGYLS |
| Ga0207704_105302911 | 3300025938 | Miscanthus Rhizosphere | MRKAGVLSTLVAWVVLAVGVAAEAQHPKKVPGIGYLSTNSSST |
| Ga0208415_10315311 | 3300025993 | Rice Paddy Soil | MVCAMKKAGVLSILLLAVLLAVAAEAPQPTKVPPIGYLGASDPVFESP |
| Ga0209055_11754222 | 3300026309 | Soil | MVCAMRKAGVLSILFVVVPLAVAVIAEAQQPTKVPR |
| Ga0209156_104195461 | 3300026547 | Soil | MKKAVVPSILITVVLLALGVIAEAQQPKKLPRIGILLVGSS |
| Ga0209878_10500361 | 3300027163 | Groundwater Sand | MRKAGVLSILLIVVLLAVAIIAEAQQSKKVARIGYLS |
| Ga0209846_10656181 | 3300027277 | Groundwater Sand | MKKANLSSILIAVVLLAVGVTAEAQQTGKILRIGFLTGA |
| Ga0209899_10149811 | 3300027490 | Groundwater Sand | MKTAAVPSILVAVILLAFAVITEAQLPKKVPRIGYLSSNDPASESIRAEAI |
| Ga0209684_10577012 | 3300027527 | Tropical Forest Soil | MNKAGWSSILVAVVLLAVAVKAEAQQPKKVFRIGYLSSADPATDSDRAEGL |
| Ga0209466_10091871 | 3300027646 | Tropical Forest Soil | VNKAARPAILVAVMLLAVAVIAEAQQPRKVFRIGYL |
| Ga0209819_102086701 | 3300027722 | Freshwater Sediment | MKKARLSSIMIAVVLLAIAVIAEAQQPKKIPRIGYLSQLDL |
| Ga0209814_100009861 | 3300027873 | Populus Rhizosphere | ITLETRCAMKRAAVPSILVAVVLLVLGVTAEAQRPAKVPRIGYLILCHL |
| Ga0209814_100178591 | 3300027873 | Populus Rhizosphere | MNKAAVSSNLVAVVLLALGVIAEAQQPKKVPRIGYLS |
| Ga0209814_100291202 | 3300027873 | Populus Rhizosphere | MKKAAVPSVLIAVVLLAVAVIAEAQQPKKASRIGYLSTYDPTHESPRAEAIRQAAMWMSR |
| Ga0209814_100850491 | 3300027873 | Populus Rhizosphere | MKKAGLSSILIAVTLLAVGVIAEAQQPTKVPRIGYLSND |
| Ga0209814_103057531 | 3300027873 | Populus Rhizosphere | MKKAAVPSILVVVVLLAFGVTAEAQQTGKVPRIGYVSE |
| Ga0209283_105312662 | 3300027875 | Vadose Zone Soil | MRKAGVPSILFVVVLLAVAVIAEAQQPKKVPRIGFLGGTSASI |
| Ga0209481_101271403 | 3300027880 | Populus Rhizosphere | MTKAAVPSVLIAVVLLAVAVIAEAQQPKKASRIGYLSTYDPTHESPRAEAIRQAAMWMSR |
| Ga0209481_102367221 | 3300027880 | Populus Rhizosphere | MKRAAVPSILVVVVLLALGVIAEAQQPKKVPRIGYLSGV |
| Ga0209382_103837521 | 3300027909 | Populus Rhizosphere | MTKAAVPSVLIAVVLLAVAVIAEAQQPKKASRIGYLSTYDPTRESPRAEAIRQAAMWMSR |
| Ga0209382_109243121 | 3300027909 | Populus Rhizosphere | MKGAAVPSSFVAVVLLALGVIAEAQQPKKVARIGYISSGDPASESNRIEAIRLAAM |
| Ga0209382_122505771 | 3300027909 | Populus Rhizosphere | MKKARVSSILVAVVLLALGVTAEAQQPKKVPRIGYLGAGDP |
| Ga0209069_106741152 | 3300027915 | Watersheds | MKKAVVPSILVAVVLLALGVTAEAQQPKKVFRIGYLSSFDPVTGHERTEKAPH |
| Ga0209857_10153851 | 3300027957 | Groundwater Sand | MKKAAVPSILVVVVLLAVAVIAEAQQPTKVPRIGYLSNGG |
| Ga0299906_105608731 | 3300030606 | Soil | MKKATALSILIAIVVLAFGLIAEAQQPKKVPRIGYLSG |
| Ga0170824_1108372062 | 3300031231 | Forest Soil | MKKAAVPSILVAVVLLAVAVIAEAQQAAKVHRIGVLSGGFPGSSPD |
| Ga0170818_1099900422 | 3300031474 | Forest Soil | MKRATVPSILVVVVLLAVGVIAEAQQPKKIPRIGFLAPSDPASQSTEA |
| Ga0307469_100785993 | 3300031720 | Hardwood Forest Soil | MKKAAVPSILVAVVLLAIGATAEAQQPKKVYRIGYLSAAA |
| Ga0307405_100048159 | 3300031731 | Rhizosphere | MRKAEVVSVLLGVLLAVAVTAEAQQPKKTSRIGYLVSND |
| Ga0307468_1000325621 | 3300031740 | Hardwood Forest Soil | MMYTMKNPGLLSILFVVVLLAVAVIAEAQQLEKIPR |
| Ga0307468_1006736702 | 3300031740 | Hardwood Forest Soil | MKKAAVPSILVAVVLLALVVTAEAQQPGKIPRIGYLSGTPTN |
| Ga0307473_108580452 | 3300031820 | Hardwood Forest Soil | MKRAAVPSILVAVVLLALGVIAEAQQPKKVPRIGYLSIGDPATESTR |
| Ga0307473_115789311 | 3300031820 | Hardwood Forest Soil | MKKAGLSSILIAVVLLAVGVIAEAQQAEKVFRIGYLGSSGSGP |
| Ga0307413_106193302 | 3300031824 | Rhizosphere | MRKAVWSLILVAAVLLTVTVIAEAQQPKKIHRIGYLSSETAAGESTRSE |
| Ga0310904_114069511 | 3300031854 | Soil | MRKAGFLSVLYVLALLAVAVIADAQQAKKVPRIGYLSSFD |
| Ga0306921_114434662 | 3300031912 | Soil | MRAMKKAVALSMLVAIVLLALGVIAEAQQPAKIPRGYRPL |
| Ga0307479_106694793 | 3300031962 | Hardwood Forest Soil | MKKAAVPSIPVAVVLVALGVTAEAQQPKKVPRIGYLSVLNPASE |
| Ga0307479_108252111 | 3300031962 | Hardwood Forest Soil | MKKAAVPSILVAMVLVALGVTTEAQQPKKVPRIGYLSALNPASESTRA |
| Ga0326597_113729311 | 3300031965 | Soil | MKKATALSILIAIVVLAFGLIAAAQQPKKVPRIGYLSGSPP |
| Ga0310902_113832841 | 3300032012 | Soil | MRKAGLLPILVVAVLVAVAVIAEAQQPTKVPRDPK |
| Ga0315912_102689872 | 3300032157 | Soil | MKRAAVPSILVAVVLFAVTIIVEAEQRKKVPWIGYLAVGPFS |
| Ga0307471_1000166261 | 3300032180 | Hardwood Forest Soil | MKKAAVPSILFAVVLLAVGVTAQAQQPTKVPRIGFLVDGS |
| Ga0307471_1008191811 | 3300032180 | Hardwood Forest Soil | MKKAGLLSILFAVTLLVVDVITEAQQPKKVPHIGYL |
| Ga0307471_1019409683 | 3300032180 | Hardwood Forest Soil | MKEAAVPSTLVVVVLLAVAVLADAQQATKIPRIGVLAASIPSFSPS |
| Ga0307471_1023698031 | 3300032180 | Hardwood Forest Soil | MRKASVLSTLVAWVVLAVGVIAEAQQPTKVPRIGFLSTIS |
| Ga0307472_1002422721 | 3300032205 | Hardwood Forest Soil | MKKADLSSILLAAVLLTVAVVAEAQQPTKVPRIGFLTAN |
| Ga0307472_1005413991 | 3300032205 | Hardwood Forest Soil | MKRAAVPSILVVVVLLALGVTAEAQQAKKIYRLGF |
| Ga0326726_115717092 | 3300033433 | Peat Soil | MKKAAVPSILVAVVMIAVAVIAEAQQPKKVPRIGYLSSQDPASESIRSEPI |
| Ga0247830_117232791 | 3300033551 | Soil | MTRIGVLSIVFAVVLLAVAIPAEAQEPKKIYRIGYLM |
| Ga0364927_0028599_1240_1368 | 3300034148 | Sediment | MTKAAVPSILVAVVLLAVAIIAEAQQPAMPKIGWLAVRPASAA |
| Ga0364943_0367751_426_551 | 3300034354 | Sediment | MKKAGVSSILIAVTVLAVGVIAEAQQPKKVPRIGYLSNSDPV |
| Ga0364943_0395323_2_136 | 3300034354 | Sediment | PSILVVVVLLALGIAEAQQPKKVHRIGYLSNTDNSGFFIKQKRN |
| Ga0364941_018565_1258_1392 | 3300034417 | Sediment | MKRALPSILVAVVLLAVGVIAEAQQPNKVPLIGYLSTTDAATDSA |
| ⦗Top⦘ |