Metagenome Family F009145

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F009145
Family Type	Metagenome
Number of Sequences	322
Average Sequence Length	37 residues
Representative Sequence	MGTAAKKPRAMRSRRSGVKSLNIVKKNLEILKKLKG
Number of Associated Samples	164
Number of Associated Scaffolds	322

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	2.22 %
% of genes near scaffold ends (potentially truncated)	12.42 %
% of genes from short scaffolds (< 2000 bps)	66.77 %
Associated GOLD sequencing projects	154
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (66.460 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (14.907 % of family members)
Environment Ontology (ENVO)	Unclassified (55.280 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (64.907 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 34.38% β-sheet: 0.00% Coil/Unstructured: 65.62%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.42
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.42
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 322 Family Scaffolds
PF01329	Pterin_4a	4.97
PF04023	FeoA	4.04
PF01471	PG_binding_1	3.11
PF01223	Endonuclease_NS	1.86
PF01764	Lipase_3	1.86
PF01832	Glucosaminidase	1.55
PF00149	Metallophos	1.24
PF13715	CarbopepD_reg_2	1.24
PF10263	SprT-like	1.24
PF04024	PspC	0.93
PF11655	DUF2589	0.93
PF00085	Thioredoxin	0.93
PF02675	AdoMet_dc	0.62
PF12385	Peptidase_C70	0.62
PF01370	Epimerase	0.62
PF11697	DUF3293	0.62
PF13517	FG-GAP_3	0.62
PF07715	Plug	0.62
PF00670	AdoHcyase_NAD	0.31
PF01592	NifU_N	0.31
PF00551	Formyl_trans_N	0.31
PF12850	Metallophos_2	0.31
PF02678	Pirin	0.31
PF16861	Carbam_trans_C	0.31
PF00166	Cpn10	0.31
PF01521	Fe-S_biosyn	0.31
PF00160	Pro_isomerase	0.31
PF13385	Laminin_G_3	0.31
PF05050	Methyltransf_21	0.31
PF13459	Fer4_15	0.31
PF13578	Methyltransf_24	0.31
PF00059	Lectin_C	0.31
PF07691	PA14	0.31
PF00534	Glycos_transf_1	0.31
PF01541	GIY-YIG	0.31
PF10908	DUF2778	0.31
PF03976	PPK2	0.31
PF13645	YkuD_2	0.31

COG ID	Name	Functional Category	% Frequency in 322 Family Scaffolds
COG2154	Pterin-4a-carbinolamine dehydratase	Coenzyme transport and metabolism [H]	4.97
COG1918	Fe2+ transport protein FeoA	Inorganic ion transport and metabolism [P]	4.04
COG1864	DNA/RNA endonuclease G, NUC1	Nucleotide transport and metabolism [F]	1.86
COG1586	S-adenosylmethionine decarboxylase	Amino acid transport and metabolism [E]	0.62
COG0234	Co-chaperonin GroES (HSP10)	Posttranslational modification, protein turnover, chaperones [O]	0.31
COG0316	Fe-S cluster assembly iron-binding protein IscA	Posttranslational modification, protein turnover, chaperones [O]	0.31
COG0499	S-adenosylhomocysteine hydrolase	Coenzyme transport and metabolism [H]	0.31
COG0652	Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family	Posttranslational modification, protein turnover, chaperones [O]	0.31
COG0822	Fe-S cluster assembly scaffold protein IscU, NifU family	Posttranslational modification, protein turnover, chaperones [O]	0.31
COG1741	Redox-sensitive bicupin YhaK, pirin superfamily	General function prediction only [R]	0.31
COG2326	Polyphosphate kinase 2, PPK2 family	Energy production and conversion [C]	0.31
COG4841	Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family	Function unknown [S]	0.31

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.46 %
All Organisms	root	All Organisms	33.54 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.46 %
cellular organisms	root	All Organisms → cellular organisms	22.05 %
Viruses	superkingdom	All Organisms → Viruses	11.49 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.46 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	13.98 %
Archaea	superkingdom	All Organisms → cellular organisms → Archaea	8.07 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	5.90 %
Duplodnaviria	clade	All Organisms → Viruses → Duplodnaviria	4.97 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.46 %
unclassified Archaea	no rank	All Organisms → cellular organisms → Archaea → unclassified Archaea	8.07 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	5.90 %
Spirochaetes	phylum	All Organisms → cellular organisms → Bacteria → Spirochaetes	5.28 %
Heunggongvirae	kingdom	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	4.97 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	4.66 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.31 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.46 %
archaeon	species	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	8.07 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	5.90 %
unclassified Spirochaetota	no rank	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota	5.28 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	4.35 %
Uroviricota	phylum	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota	4.97 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	0.31 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.46 %
archaeon	species	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	8.07 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	5.90 %
Spirochaetota bacterium	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	5.28 %
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	4.97 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	4.04 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.31 %
Balneolaeota	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota	0.31 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.46 %
archaeon	species	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	8.07 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	5.90 %
Spirochaetota bacterium	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	5.28 %
environmental samples	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples	3.73 %
Chitinophagia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia	3.11 %
Myxococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	0.31 %
unclassified Bacteroidetes	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes	0.31 %
Balneolia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia	0.31 %
Bacteroidia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia	0.31 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.46 %
archaeon	species	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	8.07 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	5.90 %
Spirochaetota bacterium	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	5.28 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3.73 %
Chitinophagales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales	3.11 %
Bacteroidales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	0.31 %
Balneolales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales	0.31 %
Bacteroidetes bacterium ADurb.Bin028	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin028	0.31 %
unclassified Myxococcales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales	0.31 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.46 %
archaeon	species	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	8.07 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	5.90 %
Spirochaetota bacterium	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	5.28 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3.73 %
Chitinophagaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	3.11 %
Myxococcales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	0.31 %
unclassified Bacteroidales	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales	0.31 %
Balneolaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae	0.31 %
Bacteroidetes bacterium ADurb.Bin028	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin028	0.31 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.46 %
archaeon	species	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	8.07 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	5.90 %
Spirochaetota bacterium	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	5.28 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3.73 %
unclassified Chitinophagaceae	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae	3.11 %
Bacteroidales bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium	0.31 %
Balneola	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola	0.31 %
Myxococcales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	0.31 %
Bacteroidetes bacterium ADurb.Bin028	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin028	0.31 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.46 %
archaeon	species	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	8.07 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	5.90 %
Spirochaetota bacterium	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	5.28 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3.73 %
Chitinophagaceae bacterium BSSC1	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium BSSC1	2.48 %
Chitinophagaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium	0.62 %
unclassified Balneola	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola	0.31 %
Bacteroidales bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium	0.31 %
Myxococcales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	0.31 %
Bacteroidetes bacterium ADurb.Bin028	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin028	0.31 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.46 %
archaeon	species	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	8.07 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	5.90 %
Spirochaetota bacterium	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	5.28 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3.73 %
Chitinophagaceae bacterium BSSC1	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium BSSC1	2.48 %
Chitinophagaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium	0.62 %
Balneola sp.	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.	0.31 %
Bacteroidales bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium	0.31 %
Myxococcales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	0.31 %
Bacteroidetes bacterium ADurb.Bin028	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin028	0.31 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000882\|FwDRAFT_10047604	All Organisms → Viruses → Predicted Viral	2478	Open in IMG/M
3300000882\|FwDRAFT_10132323	Not Available	948	Open in IMG/M
3300000929\|NpDRAFT_10385413	Not Available	765	Open in IMG/M
3300001844\|RCM35_1069821	Not Available	615	Open in IMG/M
3300001847\|RCM41_1034989	Not Available	1788	Open in IMG/M
3300001848\|RCM47_1147220	Not Available	718	Open in IMG/M
3300001848\|RCM47_1162353	Not Available	507	Open in IMG/M
3300001849\|RCM26_1287165	Not Available	629	Open in IMG/M
3300002098\|JGI24219J26650_1012222	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1364	Open in IMG/M
3300002408\|B570J29032_108840002	Not Available	521	Open in IMG/M
3300002408\|B570J29032_109060070	Not Available	581	Open in IMG/M
3300002408\|B570J29032_109861831	Not Available	1737	Open in IMG/M
3300002408\|B570J29032_109958730	Not Available	14672	Open in IMG/M
3300002835\|B570J40625_100284307	Not Available	1691	Open in IMG/M
3300003798\|Ga0007842_1001106	Not Available	2404	Open in IMG/M
3300004240\|Ga0007787_10628032	Not Available	538	Open in IMG/M
3300005517\|Ga0070374_10148453	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	1217	Open in IMG/M
3300005527\|Ga0068876_10027484	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	3555	Open in IMG/M
3300005580\|Ga0049083_10105002	Not Available	978	Open in IMG/M
3300005582\|Ga0049080_10022576	Not Available	2197	Open in IMG/M
3300005662\|Ga0078894_10007017	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	8754	Open in IMG/M
3300005662\|Ga0078894_10016957	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	5830	Open in IMG/M
3300005662\|Ga0078894_10022698	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin028	5097	Open in IMG/M
3300005662\|Ga0078894_10026288	Not Available	4757	Open in IMG/M
3300005662\|Ga0078894_10106500	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	2481	Open in IMG/M
3300005662\|Ga0078894_10708874	Not Available	887	Open in IMG/M
3300005662\|Ga0078894_10823590	Not Available	810	Open in IMG/M
3300005662\|Ga0078894_11638956	Not Available	530	Open in IMG/M
3300005662\|Ga0078894_11745146	Not Available	509	Open in IMG/M
3300005805\|Ga0079957_1004901	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	11018	Open in IMG/M
3300005805\|Ga0079957_1025910	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3972	Open in IMG/M
3300006072\|Ga0007881_1163167	Not Available	541	Open in IMG/M
3300006108\|Ga0007862_1014771	Not Available	1779	Open in IMG/M
3300006484\|Ga0070744_10003104	All Organisms → cellular organisms → Bacteria	4997	Open in IMG/M
3300006484\|Ga0070744_10097080	Not Available	852	Open in IMG/M
3300006484\|Ga0070744_10153941	Not Available	659	Open in IMG/M
3300006802\|Ga0070749_10697240	Not Available	543	Open in IMG/M
3300007547\|Ga0102875_1229730	Not Available	570	Open in IMG/M
3300007548\|Ga0102877_1215945	Not Available	540	Open in IMG/M
3300007549\|Ga0102879_1137530	Not Available	750	Open in IMG/M
3300007555\|Ga0102817_1015316	Not Available	1716	Open in IMG/M
3300007560\|Ga0102913_1129761	Not Available	815	Open in IMG/M
3300007562\|Ga0102915_1298833	Not Available	520	Open in IMG/M
3300007630\|Ga0102903_1092669	Not Available	837	Open in IMG/M
3300007639\|Ga0102865_1122516	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	778	Open in IMG/M
3300007706\|Ga0102899_1088799	Not Available	749	Open in IMG/M
3300007974\|Ga0105747_1024401	Not Available	1676	Open in IMG/M
3300007992\|Ga0105748_10554082	Not Available	505	Open in IMG/M
3300008021\|Ga0102922_1260087	Not Available	544	Open in IMG/M
3300008107\|Ga0114340_1033735	Not Available	2329	Open in IMG/M
3300008107\|Ga0114340_1037117	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	2198	Open in IMG/M
3300008107\|Ga0114340_1072449	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	3898	Open in IMG/M
3300008107\|Ga0114340_1085672	Not Available	1291	Open in IMG/M
3300008107\|Ga0114340_1089845	Not Available	1249	Open in IMG/M
3300008107\|Ga0114340_1097654	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.	1180	Open in IMG/M
3300008107\|Ga0114340_1124474	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	992	Open in IMG/M
3300008107\|Ga0114340_1164796	Not Available	797	Open in IMG/M
3300008108\|Ga0114341_10478237	Not Available	570	Open in IMG/M
3300008110\|Ga0114343_1070210	Not Available	2085	Open in IMG/M
3300008110\|Ga0114343_1075691	Not Available	1222	Open in IMG/M
3300008110\|Ga0114343_1104934	Not Available	972	Open in IMG/M
3300008111\|Ga0114344_1025035	All Organisms → Viruses → Predicted Viral	2401	Open in IMG/M
3300008113\|Ga0114346_1002795	Not Available	12469	Open in IMG/M
3300008113\|Ga0114346_1024181	Not Available	3236	Open in IMG/M
3300008113\|Ga0114346_1145909	Not Available	1017	Open in IMG/M
3300008113\|Ga0114346_1184936	Not Available	850	Open in IMG/M
3300008116\|Ga0114350_1027426	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	2950	Open in IMG/M
3300008116\|Ga0114350_1054326	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	1437	Open in IMG/M
3300008116\|Ga0114350_1075609	Not Available	1134	Open in IMG/M
3300008117\|Ga0114351_1259635	Not Available	855	Open in IMG/M
3300008261\|Ga0114336_1127782	Not Available	1156	Open in IMG/M
3300008262\|Ga0114337_1127502	Not Available	1139	Open in IMG/M
3300008266\|Ga0114363_1037232	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium BSSC1	2010	Open in IMG/M
3300008267\|Ga0114364_1000304	Not Available	29685	Open in IMG/M
3300008267\|Ga0114364_1000606	Not Available	37362	Open in IMG/M
3300008267\|Ga0114364_1114969	Not Available	811	Open in IMG/M
3300008448\|Ga0114876_1083587	All Organisms → cellular organisms → Bacteria	1318	Open in IMG/M
3300008448\|Ga0114876_1089119	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	1259	Open in IMG/M
3300008448\|Ga0114876_1102878	Not Available	1133	Open in IMG/M
3300008448\|Ga0114876_1199106	Not Available	678	Open in IMG/M
3300008996\|Ga0102831_1009949	All Organisms → Viruses → Predicted Viral	3362	Open in IMG/M
3300008996\|Ga0102831_1160437	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	745	Open in IMG/M
3300008999\|Ga0102816_1081145	Not Available	982	Open in IMG/M
3300009026\|Ga0102829_1021364	Not Available	1851	Open in IMG/M
3300009026\|Ga0102829_1232855	Not Available	603	Open in IMG/M
3300009026\|Ga0102829_1300403	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium BSSC1	534	Open in IMG/M
3300009050\|Ga0102909_1141874	Not Available	578	Open in IMG/M
3300009051\|Ga0102864_1121893	Not Available	712	Open in IMG/M
3300009059\|Ga0102830_1033685	Not Available	1581	Open in IMG/M
3300009068\|Ga0114973_10051290	Not Available	2435	Open in IMG/M
3300009068\|Ga0114973_10108751	All Organisms → Viruses → Predicted Viral	1570	Open in IMG/M
3300009068\|Ga0114973_10419644	Not Available	699	Open in IMG/M
3300009068\|Ga0114973_10514064	Not Available	619	Open in IMG/M
3300009086\|Ga0102812_10511283	Not Available	656	Open in IMG/M
3300009151\|Ga0114962_10013048	Not Available	6057	Open in IMG/M
3300009151\|Ga0114962_10063377	All Organisms → Viruses → Predicted Viral	2390	Open in IMG/M
3300009151\|Ga0114962_10067681	All Organisms → Viruses → Predicted Viral	2296	Open in IMG/M
3300009151\|Ga0114962_10082876	All Organisms → cellular organisms → Bacteria	2028	Open in IMG/M
3300009151\|Ga0114962_10176989	Not Available	1262	Open in IMG/M
3300009151\|Ga0114962_10299474	Not Available	898	Open in IMG/M
3300009151\|Ga0114962_10682903	Not Available	526	Open in IMG/M
3300009152\|Ga0114980_10137937	Not Available	1449	Open in IMG/M
3300009158\|Ga0114977_10002282	All Organisms → Viruses	12357	Open in IMG/M
3300009158\|Ga0114977_10005037	All Organisms → cellular organisms → Bacteria	8398	Open in IMG/M
3300009158\|Ga0114977_10037816	All Organisms → Viruses → Predicted Viral	3013	Open in IMG/M
3300009158\|Ga0114977_10649214	Not Available	565	Open in IMG/M
3300009159\|Ga0114978_10002895	Not Available	14102	Open in IMG/M
3300009159\|Ga0114978_10010937	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	6978	Open in IMG/M
3300009159\|Ga0114978_10011573	All Organisms → cellular organisms → Bacteria	6772	Open in IMG/M
3300009159\|Ga0114978_10253138	Not Available	1093	Open in IMG/M
3300009159\|Ga0114978_10357958	Not Available	882	Open in IMG/M
3300009160\|Ga0114981_10407528	Not Available	732	Open in IMG/M
3300009161\|Ga0114966_10683713	Not Available	563	Open in IMG/M
3300009161\|Ga0114966_10691620	Not Available	559	Open in IMG/M
3300009164\|Ga0114975_10016668	All Organisms → cellular organisms → Bacteria	4488	Open in IMG/M
3300009165\|Ga0105102_10242508	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	915	Open in IMG/M
3300009169\|Ga0105097_10088246	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1690	Open in IMG/M
3300009170\|Ga0105096_10561462	Not Available	597	Open in IMG/M
3300009180\|Ga0114979_10329177	Not Available	903	Open in IMG/M
3300009181\|Ga0114969_10322099	Not Available	906	Open in IMG/M
3300009182\|Ga0114959_10609941	Not Available	521	Open in IMG/M
3300009183\|Ga0114974_10000105	Not Available	68321	Open in IMG/M
3300009187\|Ga0114972_10833049	Not Available	504	Open in IMG/M
3300009419\|Ga0114982_1007385	Not Available	4040	Open in IMG/M
3300009419\|Ga0114982_1016289	All Organisms → Viruses → Predicted Viral	2526	Open in IMG/M
3300009419\|Ga0114982_1076742	Not Available	1039	Open in IMG/M
3300009419\|Ga0114982_1096687	Not Available	913	Open in IMG/M
3300010158\|Ga0114960_10057402	All Organisms → Viruses → Predicted Viral	2282	Open in IMG/M
3300010354\|Ga0129333_10025318	All Organisms → cellular organisms → Bacteria → FCB group	5623	Open in IMG/M
3300010354\|Ga0129333_10100632	Not Available	2671	Open in IMG/M
3300010354\|Ga0129333_10210174	All Organisms → Viruses → Predicted Viral	1767	Open in IMG/M
3300010885\|Ga0133913_10003015	Not Available	41668	Open in IMG/M
3300010885\|Ga0133913_10215020	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5119	Open in IMG/M
3300010885\|Ga0133913_10771389	Not Available	2509	Open in IMG/M
3300010885\|Ga0133913_10799053	Not Available	2459	Open in IMG/M
3300010885\|Ga0133913_10821561	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	2420	Open in IMG/M
3300010885\|Ga0133913_11428752	Not Available	1758	Open in IMG/M
3300010885\|Ga0133913_11770446	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	1548	Open in IMG/M
3300012017\|Ga0153801_1000862	All Organisms → cellular organisms → Bacteria	6736	Open in IMG/M
3300012352\|Ga0157138_1000328	All Organisms → cellular organisms → Bacteria	10663	Open in IMG/M
3300012352\|Ga0157138_1003875	Not Available	2551	Open in IMG/M
3300012665\|Ga0157210_1020289	Not Available	1078	Open in IMG/M
3300013004\|Ga0164293_10015906	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	6316	Open in IMG/M
3300013004\|Ga0164293_10027707	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	4705	Open in IMG/M
3300013004\|Ga0164293_10036804	Not Available	4033	Open in IMG/M
3300013004\|Ga0164293_10095663	Not Available	2291	Open in IMG/M
3300013004\|Ga0164293_10291363	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	1135	Open in IMG/M
3300013004\|Ga0164293_10344746	Not Available	1018	Open in IMG/M
3300013005\|Ga0164292_10063628	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2862	Open in IMG/M
3300013005\|Ga0164292_10095318	Not Available	2251	Open in IMG/M
3300013005\|Ga0164292_10175098	Not Available	1547	Open in IMG/M
3300013005\|Ga0164292_11012974	Not Available	518	Open in IMG/M
3300013093\|Ga0164296_1100766	Not Available	1214	Open in IMG/M
3300013285\|Ga0136642_1086087	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium BSSC1	821	Open in IMG/M
3300013286\|Ga0136641_1004552	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5181	Open in IMG/M
3300013295\|Ga0170791_12131145	Not Available	698	Open in IMG/M
3300013372\|Ga0177922_10276972	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	1598	Open in IMG/M
3300017766\|Ga0181343_1131959	Not Available	699	Open in IMG/M
3300019784\|Ga0181359_1092432	Not Available	1120	Open in IMG/M
3300019784\|Ga0181359_1121049	Not Available	935	Open in IMG/M
3300019784\|Ga0181359_1215684	Not Available	607	Open in IMG/M
3300020141\|Ga0211732_1241490	Not Available	19009	Open in IMG/M
3300020141\|Ga0211732_1336038	All Organisms → Viruses → Predicted Viral	1303	Open in IMG/M
3300020141\|Ga0211732_1375949	Not Available	713	Open in IMG/M
3300020141\|Ga0211732_1380751	Not Available	760	Open in IMG/M
3300020141\|Ga0211732_1484541	All Organisms → Viruses	21744	Open in IMG/M
3300020151\|Ga0211736_10310099	Not Available	1157	Open in IMG/M
3300020151\|Ga0211736_10429320	Not Available	3177	Open in IMG/M
3300020151\|Ga0211736_10579233	Not Available	573	Open in IMG/M
3300020159\|Ga0211734_10080783	Not Available	580	Open in IMG/M
3300020159\|Ga0211734_10089355	Not Available	1016	Open in IMG/M
3300020159\|Ga0211734_10123718	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	1332	Open in IMG/M
3300020159\|Ga0211734_10235698	Not Available	1537	Open in IMG/M
3300020159\|Ga0211734_10235881	Not Available	612	Open in IMG/M
3300020159\|Ga0211734_10531818	Not Available	586	Open in IMG/M
3300020159\|Ga0211734_10550486	Not Available	522	Open in IMG/M
3300020159\|Ga0211734_10759710	All Organisms → cellular organisms → Bacteria	5650	Open in IMG/M
3300020159\|Ga0211734_11249078	Not Available	566	Open in IMG/M
3300020160\|Ga0211733_10837831	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium	2933	Open in IMG/M
3300020160\|Ga0211733_10997477	Not Available	1144	Open in IMG/M
3300020160\|Ga0211733_11176294	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	1915	Open in IMG/M
3300020161\|Ga0211726_10788454	Not Available	1058	Open in IMG/M
3300020161\|Ga0211726_10801440	Not Available	2060	Open in IMG/M
3300020162\|Ga0211735_10926338	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium	1920	Open in IMG/M
3300020162\|Ga0211735_11141171	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	1067	Open in IMG/M
3300020172\|Ga0211729_10568096	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	2715	Open in IMG/M
3300020172\|Ga0211729_10600196	Not Available	500	Open in IMG/M
3300020172\|Ga0211729_10814500	Not Available	642	Open in IMG/M
3300020205\|Ga0211731_10516747	Not Available	976	Open in IMG/M
3300020205\|Ga0211731_10854952	All Organisms → Viruses → Predicted Viral	3311	Open in IMG/M
3300020205\|Ga0211731_10855134	Not Available	927	Open in IMG/M
3300020205\|Ga0211731_11328888	Not Available	523	Open in IMG/M
3300020205\|Ga0211731_11711418	Not Available	1134	Open in IMG/M
3300020490\|Ga0208052_121147	Not Available	540	Open in IMG/M
3300020506\|Ga0208091_1011560	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	1091	Open in IMG/M
3300020527\|Ga0208232_1013872	Not Available	1211	Open in IMG/M
3300020527\|Ga0208232_1023192	Not Available	876	Open in IMG/M
3300020539\|Ga0207941_1017652	Not Available	1084	Open in IMG/M
3300020548\|Ga0208856_1028240	Not Available	784	Open in IMG/M
3300020558\|Ga0208362_1043211	Not Available	735	Open in IMG/M
3300020564\|Ga0208719_1019357	Not Available	1408	Open in IMG/M
3300020723\|Ga0214249_1035028	Not Available	751	Open in IMG/M
3300021141\|Ga0214163_1013546	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2625	Open in IMG/M
3300021141\|Ga0214163_1035007	Not Available	1399	Open in IMG/M
3300021354\|Ga0194047_10045859	Not Available	2006	Open in IMG/M
3300021519\|Ga0194048_10099595	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1120	Open in IMG/M
3300021519\|Ga0194048_10121867	Not Available	993	Open in IMG/M
3300021602\|Ga0194060_10050085	Not Available	2437	Open in IMG/M
3300021956\|Ga0213922_1125782	Not Available	502	Open in IMG/M
3300021961\|Ga0222714_10030626	All Organisms → Viruses → Predicted Viral	4010	Open in IMG/M
3300021961\|Ga0222714_10034698	Not Available	3696	Open in IMG/M
3300021961\|Ga0222714_10087611	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	2009	Open in IMG/M
3300021961\|Ga0222714_10384735	Not Available	745	Open in IMG/M
3300021962\|Ga0222713_10141657	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	1670	Open in IMG/M
3300021962\|Ga0222713_10168232	Not Available	1495	Open in IMG/M
3300021962\|Ga0222713_10216124	Not Available	1271	Open in IMG/M
3300021962\|Ga0222713_10337514	Not Available	947	Open in IMG/M
3300021962\|Ga0222713_10426772	Not Available	809	Open in IMG/M
3300021962\|Ga0222713_10797270	Not Available	528	Open in IMG/M
3300021963\|Ga0222712_10044064	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	3388	Open in IMG/M
3300021963\|Ga0222712_10054624	Not Available	2961	Open in IMG/M
3300021963\|Ga0222712_10184662	All Organisms → Viruses → Predicted Viral	1378	Open in IMG/M
3300021963\|Ga0222712_10726595	Not Available	556	Open in IMG/M
3300022179\|Ga0181353_1042472	Not Available	1200	Open in IMG/M
3300022179\|Ga0181353_1164298	Not Available	504	Open in IMG/M
3300022190\|Ga0181354_1162031	Not Available	692	Open in IMG/M
3300022592\|Ga0236342_1014144	Not Available	2393	Open in IMG/M
3300023174\|Ga0214921_10011123	Not Available	10991	Open in IMG/M
3300023174\|Ga0214921_10336850	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium BSSC1	813	Open in IMG/M
3300023184\|Ga0214919_10000672	All Organisms → cellular organisms → Bacteria	58104	Open in IMG/M
3300023184\|Ga0214919_10126942	Not Available	2087	Open in IMG/M
3300023184\|Ga0214919_10144501	All Organisms → Viruses → Predicted Viral	1903	Open in IMG/M
3300023184\|Ga0214919_10289528	Not Available	1139	Open in IMG/M
3300023184\|Ga0214919_10332624	Not Available	1025	Open in IMG/M
3300023184\|Ga0214919_10421754	Not Available	855	Open in IMG/M
3300023184\|Ga0214919_10470543	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	786	Open in IMG/M
3300024289\|Ga0255147_1000469	Not Available	11563	Open in IMG/M
3300024289\|Ga0255147_1106023	Not Available	515	Open in IMG/M
3300024343\|Ga0244777_10537723	Not Available	714	Open in IMG/M
3300024343\|Ga0244777_10707749	Not Available	602	Open in IMG/M
3300024346\|Ga0244775_10025180	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	5345	Open in IMG/M
3300024346\|Ga0244775_10088930	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	2634	Open in IMG/M
3300024346\|Ga0244775_10100457	Not Available	2460	Open in IMG/M
3300024346\|Ga0244775_10498091	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	995	Open in IMG/M
3300024346\|Ga0244775_10585931	Not Available	906	Open in IMG/M
3300024346\|Ga0244775_10973904	Not Available	671	Open in IMG/M
3300024348\|Ga0244776_10070147	All Organisms → Viruses → Predicted Viral	2679	Open in IMG/M
3300024348\|Ga0244776_10660209	Not Available	651	Open in IMG/M
3300024507\|Ga0255176_1094360	Not Available	512	Open in IMG/M
3300025357\|Ga0208383_1004164	Not Available	2003	Open in IMG/M
3300025372\|Ga0207957_1008678	Not Available	1454	Open in IMG/M
3300025389\|Ga0208257_1000562	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	10409	Open in IMG/M
3300025426\|Ga0208739_1075755	Not Available	525	Open in IMG/M
3300026478\|Ga0255156_1076475	Not Available	596	Open in IMG/M
3300027193\|Ga0208800_1040644	Not Available	629	Open in IMG/M
3300027193\|Ga0208800_1051149	Not Available	561	Open in IMG/M
3300027387\|Ga0208311_1144021	Not Available	501	Open in IMG/M
3300027396\|Ga0255146_1100297	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	594	Open in IMG/M
3300027396\|Ga0255146_1100332	Not Available	594	Open in IMG/M
3300027541\|Ga0255158_1112841	Not Available	589	Open in IMG/M
3300027693\|Ga0209704_1200340	All Organisms → cellular organisms → Bacteria	582	Open in IMG/M
3300027710\|Ga0209599_10001689	Not Available	10002	Open in IMG/M
3300027710\|Ga0209599_10009237	All Organisms → Viruses → Predicted Viral	3093	Open in IMG/M
3300027710\|Ga0209599_10154102	Not Available	613	Open in IMG/M
3300027721\|Ga0209492_1244168	Not Available	609	Open in IMG/M
3300027733\|Ga0209297_1013744	Not Available	3920	Open in IMG/M
3300027733\|Ga0209297_1033715	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	2376	Open in IMG/M
3300027733\|Ga0209297_1054958	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	1789	Open in IMG/M
3300027746\|Ga0209597_1369034	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium BSSC1	531	Open in IMG/M
3300027749\|Ga0209084_1015665	Not Available	4280	Open in IMG/M
3300027749\|Ga0209084_1067024	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1667	Open in IMG/M
3300027759\|Ga0209296_1030164	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	2997	Open in IMG/M
3300027798\|Ga0209353_10125303	Not Available	1154	Open in IMG/M
3300027804\|Ga0209358_10154864	Not Available	1222	Open in IMG/M
3300027804\|Ga0209358_10474421	Not Available	574	Open in IMG/M
3300027973\|Ga0209298_10237743	Not Available	730	Open in IMG/M
3300028025\|Ga0247723_1008108	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4377	Open in IMG/M
3300028025\|Ga0247723_1034339	Not Available	1566	Open in IMG/M
3300028393\|Ga0304728_1072216	All Organisms → Viruses → Predicted Viral	1375	Open in IMG/M
3300031758\|Ga0315907_10200744	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	1671	Open in IMG/M
3300031758\|Ga0315907_10212119	Not Available	1618	Open in IMG/M
3300031758\|Ga0315907_10262118	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	1430	Open in IMG/M
3300031759\|Ga0316219_1008482	Not Available	6274	Open in IMG/M
3300031784\|Ga0315899_10786825	Not Available	872	Open in IMG/M
3300031784\|Ga0315899_11353926	Not Available	606	Open in IMG/M
3300031787\|Ga0315900_10450888	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	994	Open in IMG/M
3300031787\|Ga0315900_10550486	Not Available	859	Open in IMG/M
3300031787\|Ga0315900_10667602	Not Available	744	Open in IMG/M
3300031857\|Ga0315909_10001161	Not Available	35739	Open in IMG/M
3300031857\|Ga0315909_10036995	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	4656	Open in IMG/M
3300031857\|Ga0315909_10200435	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium BSSC1	1582	Open in IMG/M
3300031857\|Ga0315909_10512672	Not Available	825	Open in IMG/M
3300031951\|Ga0315904_10409151	Not Available	1227	Open in IMG/M
3300032116\|Ga0315903_10052613	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	4135	Open in IMG/M
3300032665\|Ga0316221_1040313	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	1968	Open in IMG/M
3300033978\|Ga0334977_0242064	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	889	Open in IMG/M
3300033984\|Ga0334989_0515647	Not Available	591	Open in IMG/M
3300033992\|Ga0334992_0326619	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium BSSC1	710	Open in IMG/M
3300033994\|Ga0334996_0215271	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	1014	Open in IMG/M
3300033996\|Ga0334979_0030591	Not Available	3586	Open in IMG/M
3300034012\|Ga0334986_0030513	Not Available	3567	Open in IMG/M
3300034013\|Ga0334991_0023515	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium	3548	Open in IMG/M
3300034061\|Ga0334987_0535407	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	706	Open in IMG/M
3300034061\|Ga0334987_0650788	Not Available	613	Open in IMG/M
3300034096\|Ga0335025_0003466	All Organisms → cellular organisms → Bacteria	12048	Open in IMG/M
3300034101\|Ga0335027_0424936	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	855	Open in IMG/M
3300034101\|Ga0335027_0427056	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	852	Open in IMG/M
3300034101\|Ga0335027_0851346	Not Available	523	Open in IMG/M
3300034102\|Ga0335029_0406326	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium BSSC1	820	Open in IMG/M
3300034104\|Ga0335031_0096977	Not Available	2083	Open in IMG/M
3300034104\|Ga0335031_0430955	Not Available	820	Open in IMG/M
3300034104\|Ga0335031_0455989	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	789	Open in IMG/M
3300034104\|Ga0335031_0790990	Not Available	532	Open in IMG/M
3300034106\|Ga0335036_0853958	Not Available	521	Open in IMG/M
3300034108\|Ga0335050_0093139	All Organisms → Viruses → Predicted Viral	1760	Open in IMG/M
3300034284\|Ga0335013_0756660	Not Available	548	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	100.00%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	97.20%
Terrestrial	Environmental → Terrestrial	2.79%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	79.19%
Marine	Environmental → Aquatic → Marine	18.01%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	2.79%

Habitat	Taxonomy	Distribution
Lake	Environmental → Aquatic → Freshwater → Lake	51.55%
Lentic	Environmental → Aquatic → Freshwater → Lentic	15.84%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	8.39%
Unclassified	Environmental → Aquatic → Marine → Unclassified	7.14%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	4.35%
Lotic	Environmental → Aquatic → Freshwater → Lotic	3.11%
River	Environmental → Aquatic → Freshwater → River	2.17%
Coastal	Environmental → Aquatic → Marine → Coastal	2.17%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	2.79%
Sediment	Environmental → Aquatic → Freshwater → Sediment	1.86%
Creek	Environmental → Aquatic → Freshwater → Creek	0.31%
Neritic Zone	Environmental → Aquatic → Marine → Neritic Zone	0.31%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	51.55%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	11.80%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	8.39%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	7.14%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	4.35%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	3.11%
Unclassified	Environmental → Aquatic → Freshwater → Lotic → Unclassified	3.11%
Unclassified	Environmental → Aquatic → Freshwater → River → Unclassified	2.17%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	2.17%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	2.79%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	1.86%
Hypolimnion	Environmental → Aquatic → Freshwater → Lentic → Hypolimnion	0.93%
Unclassified	Environmental → Aquatic → Freshwater → Creek → Unclassified	0.31%
Unclassified	Environmental → Aquatic → Marine → Neritic Zone → Unclassified	0.31%

Habitat	Taxonomy	Distribution
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	14.91%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	13.04%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	12.11%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	8.39%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	8.39%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	6.83%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	4.35%
Estuarine Water	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water	4.35%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater	3.73%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	3.11%
Freshwater	Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater	2.17%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface	2.17%
Estuarine	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine	2.79%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	1.55%
Marine Plankton	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton	1.55%
Anoxic Zone Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater	1.24%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	1.24%
Freshwater To Marine Saline Gradient	Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient	1.24%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater	0.93%
Freshwater	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater	0.93%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	0.62%
Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic	0.62%
Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake	0.62%
Freshwater And Marine	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine	0.62%
Estuary Water	Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water	0.62%
Deep Subsurface Sediment	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment	0.62%
Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment	0.31%
Freshwater	Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater	0.31%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	0.31%
Freshwater And Marine	Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine	0.31%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000882	Freshwater microbial communities from the Columbia River	Environmental	Open in IMG/M
3300000929	Marine plume microbial communities from the Columbia River - 15 PSU	Environmental	Open in IMG/M
3300001844	Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM35, ROCA_DNA220_0.2um_bLM_C_3a	Environmental	Open in IMG/M
3300001847	Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM41. ROCA_DNA251_0.2um_TAP-D_2a	Environmental	Open in IMG/M
3300001848	Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM47, ROCA_DNA265_0.2um_TAP-S_3a	Environmental	Open in IMG/M
3300001849	Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM26, ROCA_DNA190_2.0um_MCP-N_C_2b	Environmental	Open in IMG/M
3300002098	Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B7 metagenome	Environmental	Open in IMG/M
3300002408	Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)	Environmental	Open in IMG/M
3300002835	Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)	Environmental	Open in IMG/M
3300003798	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Sep07	Environmental	Open in IMG/M
3300004240	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN	Environmental	Open in IMG/M
3300004481	Combined Assembly of Gp0112041, Gp0112042, Gp0112043	Environmental	Open in IMG/M
3300005517	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4)	Environmental	Open in IMG/M
3300005527	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG	Environmental	Open in IMG/M
3300005580	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF	Environmental	Open in IMG/M
3300005582	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF	Environmental	Open in IMG/M
3300005662	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)	Environmental	Open in IMG/M
3300005805	Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA	Environmental	Open in IMG/M
3300006072	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09	Environmental	Open in IMG/M
3300006108	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH20Aug07	Environmental	Open in IMG/M
3300006484	Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535	Environmental	Open in IMG/M
3300006802	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18	Environmental	Open in IMG/M
3300007547	Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02	Environmental	Open in IMG/M
3300007548	Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3	Environmental	Open in IMG/M
3300007549	Estuarine microbial communities from the Columbia River estuary - metaG 1548B-02	Environmental	Open in IMG/M
3300007555	Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555	Environmental	Open in IMG/M
3300007560	Estuarine microbial communities from the Columbia River estuary - metaG 1560A-02	Environmental	Open in IMG/M
3300007562	Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02	Environmental	Open in IMG/M
3300007630	Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02	Environmental	Open in IMG/M
3300007639	Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02	Environmental	Open in IMG/M
3300007706	Estuarine microbial communities from the Columbia River estuary - metaG 1555B-3	Environmental	Open in IMG/M
3300007974	Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um	Environmental	Open in IMG/M
3300007992	Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um	Environmental	Open in IMG/M
3300008021	Estuarine microbial communities from the Columbia River estuary - metaG 1569A-3	Environmental	Open in IMG/M
3300008107	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA	Environmental	Open in IMG/M
3300008108	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA	Environmental	Open in IMG/M
3300008110	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA	Environmental	Open in IMG/M
3300008111	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA	Environmental	Open in IMG/M
3300008113	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA	Environmental	Open in IMG/M
3300008116	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA	Environmental	Open in IMG/M
3300008117	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA	Environmental	Open in IMG/M
3300008261	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA	Environmental	Open in IMG/M
3300008262	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA	Environmental	Open in IMG/M
3300008266	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA	Environmental	Open in IMG/M
3300008267	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR	Environmental	Open in IMG/M
3300008448	Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs	Environmental	Open in IMG/M
3300008996	Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747	Environmental	Open in IMG/M
3300008999	Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545	Environmental	Open in IMG/M
3300009026	Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575	Environmental	Open in IMG/M
3300009050	Estuarine microbial communities from the Columbia River estuary - metaG 1557A-02	Environmental	Open in IMG/M
3300009051	Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02	Environmental	Open in IMG/M
3300009059	Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703	Environmental	Open in IMG/M
3300009068	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG	Environmental	Open in IMG/M
3300009086	Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713	Environmental	Open in IMG/M
3300009151	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG	Environmental	Open in IMG/M
3300009152	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG	Environmental	Open in IMG/M
3300009158	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG	Environmental	Open in IMG/M
3300009159	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG	Environmental	Open in IMG/M
3300009160	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG	Environmental	Open in IMG/M
3300009161	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG	Environmental	Open in IMG/M
3300009164	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG	Environmental	Open in IMG/M
3300009165	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015	Environmental	Open in IMG/M
3300009169	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015	Environmental	Open in IMG/M
3300009170	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015	Environmental	Open in IMG/M
3300009180	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG	Environmental	Open in IMG/M
3300009181	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG	Environmental	Open in IMG/M
3300009182	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG	Environmental	Open in IMG/M
3300009183	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG	Environmental	Open in IMG/M
3300009187	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG	Environmental	Open in IMG/M
3300009419	Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT	Environmental	Open in IMG/M
3300010158	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG	Environmental	Open in IMG/M
3300010354	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA	Environmental	Open in IMG/M
3300010885	northern Canada Lakes Co-assembly	Environmental	Open in IMG/M
3300011995	Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 880 - Top - Depth 1m	Environmental	Open in IMG/M
3300012017	Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m	Environmental	Open in IMG/M
3300012352	Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37	Environmental	Open in IMG/M
3300012665	Freshwater microbial communities from Talbot River, Ontario, Canada - S11	Environmental	Open in IMG/M
3300013004	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG	Environmental	Open in IMG/M
3300013005	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG	Environmental	Open in IMG/M
3300013093	Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES057 metaG	Environmental	Open in IMG/M
3300013285	Freshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31Y	Environmental	Open in IMG/M
3300013286	Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y	Environmental	Open in IMG/M
3300013295	northern Canada Lakes metatranscriptome co-assembly	Environmental	Open in IMG/M
3300013372	Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs	Environmental	Open in IMG/M
3300017766	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D	Environmental	Open in IMG/M
3300019784	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D	Environmental	Open in IMG/M
3300020141	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1	Environmental	Open in IMG/M
3300020151	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1	Environmental	Open in IMG/M
3300020159	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1	Environmental	Open in IMG/M
3300020160	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1	Environmental	Open in IMG/M
3300020161	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1	Environmental	Open in IMG/M
3300020162	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1	Environmental	Open in IMG/M
3300020172	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1	Environmental	Open in IMG/M
3300020205	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1	Environmental	Open in IMG/M
3300020490	Freshwater microbial communities from Lake Mendota, WI - 18JUL2008 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020506	Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020527	Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020539	Freshwater microbial communities from Lake Mendota, WI - 13SEP2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020548	Freshwater microbial communities from Lake Mendota, WI - 13JUL2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020558	Freshwater microbial communities from Lake Mendota, WI - 13OCT2010 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020564	Freshwater microbial communities from Lake Mendota, WI - 30JUL2009 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020723	Freshwater microbial communities from Trout Bog Lake, WI - 23JUN2009 hypolimnion	Environmental	Open in IMG/M
3300021141	Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion	Environmental	Open in IMG/M
3300021354	Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L221-5m	Environmental	Open in IMG/M
3300021519	Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m	Environmental	Open in IMG/M
3300021602	Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L222-5m	Environmental	Open in IMG/M
3300021956	Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG	Environmental	Open in IMG/M
3300021961	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D	Environmental	Open in IMG/M
3300021962	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D	Environmental	Open in IMG/M
3300021963	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D	Environmental	Open in IMG/M
3300022179	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N	Environmental	Open in IMG/M
3300022190	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N	Environmental	Open in IMG/M
3300022592	Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S3	Environmental	Open in IMG/M
3300023174	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505	Environmental	Open in IMG/M
3300023184	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503	Environmental	Open in IMG/M
3300024289	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h	Environmental	Open in IMG/M
3300024343	Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction	Environmental	Open in IMG/M
3300024346	Whole water sample coassembly	Environmental	Open in IMG/M
3300024348	0.2um to 3um size fraction coassembly	Environmental	Open in IMG/M
3300024507	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8d	Environmental	Open in IMG/M
3300025357	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Sep07 (SPAdes)	Environmental	Open in IMG/M
3300025372	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jun07 (SPAdes)	Environmental	Open in IMG/M
3300025389	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Sep07 (SPAdes)	Environmental	Open in IMG/M
3300025426	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul09 (SPAdes)	Environmental	Open in IMG/M
3300026478	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8h	Environmental	Open in IMG/M
3300027193	Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes)	Environmental	Open in IMG/M
3300027387	Estuarine microbial communities from the Columbia River estuary - metaG 1562A-02 (SPAdes)	Environmental	Open in IMG/M
3300027396	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8h	Environmental	Open in IMG/M
3300027541	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8h	Environmental	Open in IMG/M
3300027693	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes)	Environmental	Open in IMG/M
3300027710	Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes)	Environmental	Open in IMG/M
3300027721	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes)	Environmental	Open in IMG/M
3300027733	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027746	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027749	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027759	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027798	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes)	Environmental	Open in IMG/M
3300027804	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes)	Environmental	Open in IMG/M
3300027973	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300028025	Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC	Environmental	Open in IMG/M
3300028393	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2)	Environmental	Open in IMG/M
3300031758	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123	Environmental	Open in IMG/M
3300031759	Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003P	Environmental	Open in IMG/M
3300031784	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112	Environmental	Open in IMG/M
3300031787	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114	Environmental	Open in IMG/M
3300031857	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125	Environmental	Open in IMG/M
3300031951	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120	Environmental	Open in IMG/M
3300032116	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119	Environmental	Open in IMG/M
3300032665	Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18007	Environmental	Open in IMG/M
3300033978	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002	Environmental	Open in IMG/M
3300033984	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030	Environmental	Open in IMG/M
3300033992	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035	Environmental	Open in IMG/M
3300033994	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046	Environmental	Open in IMG/M
3300033996	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004	Environmental	Open in IMG/M
3300034012	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027	Environmental	Open in IMG/M
3300034013	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034	Environmental	Open in IMG/M
3300034061	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028	Environmental	Open in IMG/M
3300034096	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098	Environmental	Open in IMG/M
3300034101	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107	Environmental	Open in IMG/M
3300034102	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112	Environmental	Open in IMG/M
3300034104	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120	Environmental	Open in IMG/M
3300034106	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131	Environmental	Open in IMG/M
3300034108	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157	Environmental	Open in IMG/M
3300034284	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
FwDRAFT_100476042	3300000882	Freshwater And Marine	MGTRPKKPRAMRSVRSGRKSLNLLKKNLEILKRLKG*
FwDRAFT_101323232	3300000882	Freshwater And Marine	TRPKKPRAMRSRRSGVKSLNIVKKNLEILKKLKG*
NpDRAFT_103854132	3300000929	Freshwater And Marine	MGTAPKKPRAMRSRRSGVKSLNIVKKNLEILKKLKG*
RCM35_10698212	3300001844	Marine Plankton	MAHAAKKPRPMRSRRSGLKKLKQIKQNLEILEKFKK*
RCM41_10349892	3300001847	Marine Plankton	MGTAAKKPRPMRSRRSGVKKLEIMKKNLEILKKFKKEYVS*
RCM47_11472203	3300001848	Marine Plankton	MGTAAKKPRAMRSRRSGVKKLRLIKQNLEILNKYK*
RCM47_11623532	3300001848	Marine Plankton	MGTAAKKPRAMRSRRSGVKKLELVKKNLEILNKLKSI*
RCM26_12871652	3300001849	Marine Plankton	MGSAPAKPRPMRSRRSGIKKLRIVQQNLEILKKLKAN*
JGI24219J26650_10024757	3300002098	Lentic	MCLKNKTMGSAASKKRPMRSKRSGVKKLELVKVNLDILKKSR*
JGI24219J26650_10122223	3300002098	Lentic	MGTATKKKRPMRSRRSGIKKSELVKANLEILKKAN*
B570J29032_1088400021	3300002408	Freshwater	MGAAAKKKRPMRSRRSGVKKLTLIKSNREILNKIK*
B570J29032_1090600702	3300002408	Freshwater	MGTAAKKKRPMRSKRSGVKKLEQVKKNLLILQKLK*
B570J29032_1098618311	3300002408	Freshwater	MGTAAPKPRAMRSRRSGIKKLEIVKKNLEILKKLKGN*
B570J29032_10995873011	3300002408	Freshwater	MGTAAKKPRAMRSRRSGVKSFNIVKKNLEILKKLKG*
B570J40625_1002843071	3300002835	Freshwater	MGTAAKKPRAMRSVRSGRKKMEIYKKNQEILKKYLKLVKE*
Ga0007842_10011061	3300003798	Freshwater	YINMGTAAPKPRPMRSRRSGIKKLVLVQKNLEILKRLKG*
Ga0007787_106280322	3300004240	Freshwater Lake	MVTAAKKPRAMRSRRSGIKKAELVRKNQEILKKLINDKVK*
Ga0069718_143287933	3300004481	Sediment	ARMVKKDYLKNKIMGTAAKKKRPMRSRRSGVKKLTLVKSNLGILSKLK*
Ga0070374_101484532	3300005517	Freshwater Lake	MAHAKPKKRAMRSRRSGVKKLEQLKANLAVLSKLK*
Ga0068876_100274842	3300005527	Freshwater Lake	MGSKAKKPRAMRSRRSGIKKAEQIKKNLAILNKLK*
Ga0049083_101050022	3300005580	Freshwater Lentic	MGTAPKKKRAMRSRRSGVKKSEQMKKNLAILQKIK*
Ga0049080_100225762	3300005582	Freshwater Lentic	MGTRPKKPRAMRSRRSGIKKLEIVKKNLEILKKLKGN*
Ga0078894_1000701714	3300005662	Freshwater Lake	MGTSSKKPRAMRSRRSGIKSLNVVKKNLEILKKLKG*
Ga0078894_1001695711	3300005662	Freshwater Lake	MGTKAKKPRAMRSRRSGIKKAELVRKNQEILKKLINDKV
Ga0078894_100226985	3300005662	Freshwater Lake	MGTAAKKPRAMRSKRSGLKNFIRTHKNLTIINRLIKELKSK*
Ga0078894_100262888	3300005662	Freshwater Lake	MGTRAKKPRAMRSRRSGIKSLNIVKKNLEILKKLKG*
Ga0078894_101065004	3300005662	Freshwater Lake	MGTAAKKPRAMRSRRSGVKKAELVRKNQEILKKLINDKVK*
Ga0078894_107088742	3300005662	Freshwater Lake	MGSKAKKPRAMRSRRSGVKKAEQMKKNLAILNKLK*
Ga0078894_108235903	3300005662	Freshwater Lake	KAKKPRAMRSVKSGVKNALRTKSNQEILNRLIKELKKQ*
Ga0078894_116389562	3300005662	Freshwater Lake	TAAKKPRAMRSVRSGRKKMEIYKKNQEIIKKYLKLVKE*
Ga0078894_117451462	3300005662	Freshwater Lake	MGSKAKKPRAMRSRRSGVKKAELVRKNQEILKKLINDKVK*
Ga0079957_100490113	3300005805	Lake	MGTAAKKPRPMRSRRSGIKKMRLIKNNLEILKKIEKGV*
Ga0079957_10259105	3300005805	Lake	MATAAKKKRPMRSRKSGIKTLSLVKSNLALLAKTK*
Ga0007881_11631673	3300006072	Freshwater	MGSAAPKPRPMRSRRSGIKKLKLVNANLAILKKLK
Ga0007862_10147713	3300006108	Freshwater	MGTAAPKPRPIRSRRSGIKKLVLVQKNLEILKRLKG*
Ga0070744_100031043	3300006484	Estuarine	MGTAAKKPRAMRSVRSGRKKMEIYKKNQEILKKYLKLAKG*
Ga0070744_100970802	3300006484	Estuarine	MAHAKPKKRAMRSRRSGVKKVEQLKANLAVLSKLK*
Ga0070744_101539411	3300006484	Estuarine	MGTKSNKPRAMRSRRSGVKSLNIVKKNLEILKKLKG*
Ga0070749_106972401	3300006802	Aqueous	MGSKAKKPRAMRSRRSGVKKMKLIKQNLEVLKRLENDKIK*
Ga0102875_12297302	3300007547	Estuarine	MGTAPKKKRAMRSRRSGVKKTEQMKKNLAILQKLK*
Ga0102877_12159452	3300007548	Estuarine	MGTKPKKPRAMRSVRSGRKSLNLLKKNLEILKRLKG*
Ga0102879_11375302	3300007549	Estuarine	MGTAPKKKRAMRSRRSGVKKAEQMKKNLAILQKLK*
Ga0102817_10153163	3300007555	Estuarine	MGTRPKKPRAMRSRRSGVKSLNIVKKNLEILKKLKG*
Ga0102913_11297612	3300007560	Estuarine	MGTAPKKKRAMRSRRSGVKKAEQMKKNLAILQKIK*
Ga0102915_12988332	3300007562	Estuarine	MGTASKKPRAKRSVRSGRKKMEIFQKNQEIINRLIKELKK*
Ga0102903_10926693	3300007630	Estuarine	MAAAPKKKRAMRSRRSGVKKAEQIKKNLAILQKLK*
Ga0102865_11225162	3300007639	Estuarine	MGTAPKKKRAMRSRRSGVKKLTLIKSNLEILNKVKC*
Ga0102899_10887991	3300007706	Estuarine	ASKKPRAKRSVRSGRKKMEIFQKNQEIINRLIKELKK*
Ga0105747_10244013	3300007974	Estuary Water	MGTRPKKPRAMRSRRSGVKSLNIVKNNLEVLKKLKG*
Ga0105748_105540821	3300007992	Estuary Water	MSLPWYLLETKNMGTAAPKPRAMRSRRSGVKSLNIVKKNLEILKKLQG*
Ga0102922_12600871	3300008021	Estuarine	EMGTAPKKKRAMRSRRSGVKKAEQMKKNLAILQKLK*
Ga0114340_10337352	3300008107	Freshwater, Plankton	MGTKAKKKRAMRSRKSGLKTVAQISKNLAILSKLK*
Ga0114340_10371171	3300008107	Freshwater, Plankton	MGSKAKKPRAMRSRRSGVKKKELVDANLVILKKLQNDKVK*
Ga0114340_107244911	3300008107	Freshwater, Plankton	MGTKAKKKRAMRSRKSGLKTVAQINKNLLILSKLK*
Ga0114340_10856724	3300008107	Freshwater, Plankton	MGTKAKKKRAMRSRKSGLKSVAQINKNLAILSKLK*
Ga0114340_10898453	3300008107	Freshwater, Plankton	MGSAAKKKRPMRSRRSGVKKLTLVKSNLEILNKAR*
Ga0114340_10976542	3300008107	Freshwater, Plankton	MGSKAKKPRAMRSRRSGIKKLELVKANLAILKKLESDKTN*
Ga0114340_11244741	3300008107	Freshwater, Plankton	MGSKAKKPRAMRSRRSGVKKAELVKKNNEILKKLINDKVK*
Ga0114340_11647964	3300008107	Freshwater, Plankton	KKPRAMRSRRSGVKKKELVDANLVILKKLQNDKVK*
Ga0114341_104782372	3300008108	Freshwater, Plankton	MGSKAKKPRAMRSRRSGVKKKELVDANLVILKKLQND
Ga0114343_10702102	3300008110	Freshwater, Plankton	MGTAAKKPRPMRSRRSGIKSKTIVDNNLTVLKKYTKK*
Ga0114343_10756912	3300008110	Freshwater, Plankton	MGSAAKKKKPMRSKRSGVKKLTLVKSNLEILNKAR*
Ga0114343_11049342	3300008110	Freshwater, Plankton	MGSAAKKPRAMRSRRSGVKKKELVDANLVILKKLQNDKVK*
Ga0114344_10250351	3300008111	Freshwater, Plankton	MGSKAKKPRAMRSRRSGVKKAELVRKNNEILKKLINDKVK*
Ga0114346_10027958	3300008113	Freshwater, Plankton	MGTAAKKKRPMRSRRSGIKKAEQLKKNLVILSKLK*
Ga0114346_10241817	3300008113	Freshwater, Plankton	MGTAAKKKRPMRSKRSGVKKAEQLKKNLAILSKLK*
Ga0114346_11459091	3300008113	Freshwater, Plankton	MGTKAKKKRAMRSRKSGLKTVAQINKNLAILSKLK*
Ga0114346_11849362	3300008113	Freshwater, Plankton	MGTAAKKPRPMRSRRSGIKSKSIVDSNLTVLKKYIKK*
Ga0114350_10274263	3300008116	Freshwater, Plankton	MGTAAKKKRAMRSRRSGVKKMELIKNNLRILQKLK*
Ga0114350_10543262	3300008116	Freshwater, Plankton	MGTAAKKKRAMRSRRSGVKKMELVKNNLRILQNLK*
Ga0114350_10756092	3300008116	Freshwater, Plankton	MGSKAKKPRAMRSRRSGVKKKELVDANLVILKKLQNDKAK*
Ga0114351_12596351	3300008117	Freshwater, Plankton	MGSKAKKPRAMRSRRSGLKKKKLVDANLVILNKLINDKTK*
Ga0114336_11277822	3300008261	Freshwater, Plankton	MGSKAKKPKAMRSRRSGVKKAEQMKKNLAILNKLK*
Ga0114337_11275023	3300008262	Freshwater, Plankton	MGRAAKKPRAMRSRRSGLKKKKLVDANLVILNKLINDKTK*
Ga0114363_10372324	3300008266	Freshwater, Plankton	MGTASKKPRPMRSRRSGIKSKTLIDNNLSILKKYIKK*
Ga0114364_10003049	3300008267	Freshwater, Plankton	MGTAAPKKRPMRSRRSGIKKLELVKKNLDILKKLKG*
Ga0114364_10006062	3300008267	Freshwater, Plankton	MGTAAKKKRPMRSKRSGVKKLEQVKKNLAILSKLK*
Ga0114364_11149692	3300008267	Freshwater, Plankton	MGTAEKKKRPMRSRRSGIKKFELVKANQEVLQKAK*
Ga0114876_10835873	3300008448	Freshwater Lake	MGSAAKKKRPMRSRRSGIKKLTLVKSNLEILNKSR*
Ga0114876_10891192	3300008448	Freshwater Lake	MGTAAKKKRPMRSRRSGLKTIAQVNKNLAILSKLK*
Ga0114876_11028782	3300008448	Freshwater Lake	MGSAAKKKRPMRSRRSGIKKAELVKANQELLKKAK*
Ga0114876_11991061	3300008448	Freshwater Lake	KIMGTAAKKKRPMRSKRSGVKKLEQVKKNLLILQKLK*
Ga0102831_10099494	3300008996	Estuarine	MGTSPKKPRAMRSRRSGIKSLNIVKKNLEILKKLKG*
Ga0102831_11604371	3300008996	Estuarine	MGTAVKKKRAMRSRRSGVKKVEQLKANLAVLSKLK*
Ga0102816_10811452	3300008999	Estuarine	MGTAPKKKRAMRSRRSGVKKSEQMKKNLVILQKIK*
Ga0102829_10213641	3300009026	Estuarine	KYMGTRPKKPRAMRSRRSGVKSLNIVKKNLEILKKLKG*
Ga0102829_12328551	3300009026	Estuarine	MGTAPKKPRAMRSRRSGIKSLNIVKKNLEILKKLKG*
Ga0102829_13004032	3300009026	Estuarine	MGTAPKKPRAMRSVRSGRKKMEIYKKNQEILKKYLKLAKG*
Ga0102909_11418741	3300009050	Estuarine	KYMGTRPKKPRAMRSRRSGVKSLNIVKKNLEILKKLQG*
Ga0102864_11218931	3300009051	Estuarine	KHMGTRPKKPRAMRSRRSGVKSLNIVKKNLEILKKLKG*
Ga0102830_10336852	3300009059	Estuarine	MGTAAKKPRAMRSRRSGVKSLNIVKKNLEILKKLQG*
Ga0114973_100512903	3300009068	Freshwater Lake	MYLQKIKTKYMGTASKKPRAMRSRRSGVKSLNIVKNNLEVLKKLKG*
Ga0114973_101087512	3300009068	Freshwater Lake	MGTAPKKPRAMRSVRSGRKKMELFKKNQEILKKVTKDTTK*
Ga0114973_104196442	3300009068	Freshwater Lake	MGTAAPKPRAMRSRRSGVKKLELIKKNLEILKKLKGN*
Ga0114973_105140642	3300009068	Freshwater Lake	MGTAPKKKRAMRSRRSGVKKAELVKANQVLLNKIKA*
Ga0102812_105112832	3300009086	Estuarine	MGTSPKKPRAMRSRRSGVKSLNIVKKNLEILKKLKG*
Ga0114962_100130489	3300009151	Freshwater Lake	MGTAPKKKRAMRSVRSGVKKLALVKSNLEILNKIKA*
Ga0114962_100633776	3300009151	Freshwater Lake	MGTAAPKKRAMRSVRSGRKKMELFKKNQEIIKKVTKDTTK*
Ga0114962_100676812	3300009151	Freshwater Lake	MGTAPKKPRAMRSRRSGVKSLDIVKKNLEVLKKLKG*
Ga0114962_100828763	3300009151	Freshwater Lake	MGTATKKKRPMRSKKSGAKKLALVKNNQEILNKIK*
Ga0114962_101769893	3300009151	Freshwater Lake	MGTAPKKPRAMRSRRSGIKSLNIVKNNLEVLKKLKG*
Ga0114962_102994742	3300009151	Freshwater Lake	MGTAAKKKRPMKSKRSGVKKLELVKNNLRVLQNLK*
Ga0114962_106829031	3300009151	Freshwater Lake	MGTAPKKKRSMRSKKSGVKKLALVKSNLEILNKIKA*
Ga0114980_101379372	3300009152	Freshwater Lake	MGTAAKKPRAMRSRRSGVKSLNIVKKNLEVLKKLKG*
Ga0114977_100022828	3300009158	Freshwater Lake	MGTAPKKKRAMRSRRSGVKKLNLVKSNLEILNKVKC*
Ga0114977_100050379	3300009158	Freshwater Lake	MGTAAPKPRAMRSRRSGIKKLILIQKNLEILKKLKGN*
Ga0114977_100378166	3300009158	Freshwater Lake	MGTAPKKPRAMRSVRSGRKSLNLLKKNLEILKRLKG*
Ga0114977_106492142	3300009158	Freshwater Lake	TRPKKPRAMRSRRSGVKSLNIVKNNLEILKKLKG*
Ga0114978_1000289513	3300009159	Freshwater Lake	MGTAPKKKRSMRSKKSGVKKAELVKANQVILNKIKA*
Ga0114978_100109379	3300009159	Freshwater Lake	MAHAKPKKRAMRSRRSGVKKLEQLKANLVVLSKLK*
Ga0114978_100115735	3300009159	Freshwater Lake	MGTRPKKPRAMRSRRSGVKSLNIVKKNLEILKKLQG*
Ga0114978_102531381	3300009159	Freshwater Lake	TKTKYMGTRPKKPRAMRSRRSGVKSLNIVKKNLEILKKLKG*
Ga0114978_103579582	3300009159	Freshwater Lake	MGTTSKKPRAMRSVRSGRKKMEQYKKNQEILKRLIKQA
Ga0114981_104075282	3300009160	Freshwater Lake	MGTRPKKPRAMRSRRSGVKSLNIVKKNLEVLKKLKG*
Ga0114966_106837132	3300009161	Freshwater Lake	MAHAKQKKRAMRSRRSGVKKLEQLKANLVVLSKLK*
Ga0114966_106916202	3300009161	Freshwater Lake	MGTAPKKPRAMRSRRSGVKSLNIVKNNLEVLKKIKG*
Ga0114975_100166688	3300009164	Freshwater Lake	MGTASKKPRAMRSRRSGVKSLNIVKNNLEILKKLKG*
Ga0105102_102425082	3300009165	Freshwater Sediment	MGTAAKKKRPMRSRRSGVKKLNLVKSNLEILNKIK*
Ga0105097_100882461	3300009169	Freshwater Sediment	MGTAAKKKRPMRSRRSGVKKAELVKANQIVLNKIK*
Ga0105096_105614622	3300009170	Freshwater Sediment	MGTKVKKKRAIRSRKSGLKTVAQISKNLAILSKLK*
Ga0114979_103291772	3300009180	Freshwater Lake	MGTTSKKPRAMRSVRSGRKKMEIYKKNQEILKKYLKLAKG*
Ga0114969_103220993	3300009181	Freshwater Lake	MGTAAKKPRAMRSRRSGVKSLNIVKNNLEVLKKLKG*
Ga0114959_106099412	3300009182	Freshwater Lake	IFIINNLIMGTAPKKPRAMRSRRSGVKSLDIVKKNLEVLKKLKG*
Ga0114974_1000010541	3300009183	Freshwater Lake	MGTAAPKKRAMRSRRSGVKKLTLVKKNLEILNKVK*
Ga0114972_108330491	3300009187	Freshwater Lake	KIKTKYMGTAPKKPRAMRSRRSGVKSLNIVKNNLEVLKKLKG*
Ga0114982_10073853	3300009419	Deep Subsurface	MGTALKKKRAMRSRRSGVKKMELIKNNLRILQKLK*
Ga0114982_10162894	3300009419	Deep Subsurface	MGSKAKKPRAMRSRRSGVKKAEQIKKNLAVLNKLK*
Ga0114982_10767422	3300009419	Deep Subsurface	MGTAPKKKRAMRSRRSGVKKTEQIKKNLAILQKLK*
Ga0114982_10966872	3300009419	Deep Subsurface	MGTAAKKPRAMRSRRSGVKSLNIVKKNLEILKKLKG*
Ga0114960_100574025	3300010158	Freshwater Lake	MGTAAPKKRAMRSRRSGIKKFELVKTNLDILKKIKGN*
Ga0129333_1002531811	3300010354	Freshwater To Marine Saline Gradient	MGTAAKKPRPMRSRRSGIKKLELVKKNNEILKKFLEYSKK*
Ga0129333_101006325	3300010354	Freshwater To Marine Saline Gradient	MGSAAKKKRPMRSRRSGVKKLTLVKSNLEILNKVR*
Ga0129333_102101744	3300010354	Freshwater To Marine Saline Gradient	MGTAAKKPRPMRSRRSGIKSKTLIDKNLSILKKYIKK*
Ga0129333_105036981	3300010354	Freshwater To Marine Saline Gradient	TNIMGSAQKKPRAMRSKRSGVKKMEQVKRNLEILKKFLTKKG*
Ga0133913_100030157	3300010885	Freshwater Lake	MGTTSKKPRAMRSVRSGRKKMEQYKKNQEILKRLIKQATK*
Ga0133913_102150201	3300010885	Freshwater Lake	MGTAAKKPRAMRSRRSGIKSLNIVKNNLEVLKKLKG*
Ga0133913_107713894	3300010885	Freshwater Lake	MGTAAPKPRAMRSRRSGIKKLTLVKKNLEILKKLKDN*
Ga0133913_107990531	3300010885	Freshwater Lake	MGRAAKKPRAMRSVRSGRKKMEQYKKNQEILKRLLKETTK*
Ga0133913_108215612	3300010885	Freshwater Lake	LLKIKIMGTAPKKKRAMRSRRSGVKKLTQVKNNLAILSKLK*
Ga0133913_114287524	3300010885	Freshwater Lake	MGTAASKPRAMRSRRSGIKKLELIKKNLEILKKLKGN*
Ga0133913_117704463	3300010885	Freshwater Lake	MGTAPKKKRAMRSRRSGVKKLTLVKSNLEILNKVKC*
Ga0153800_10199462	3300011995	Freshwater	MRKNNNMANTAPKKRPMRSRRSGIKKAEQVKKNLAILSKLK*
Ga0153801_10008624	3300012017	Freshwater	MGTASKKPRAMRSRRSGVKSLNIVKNNLEVLKKLKG*
Ga0157138_10003286	3300012352	Freshwater	MGTKAKKPRAMRSVRSGRKKMELFKRNLAILKKLLKK*
Ga0157138_10038754	3300012352	Freshwater	MGTKAKKPRAMRSVRSGRKKMELYKSNLAILKKLLKK*
Ga0157210_10202892	3300012665	Freshwater	MGSKAKKPRAMRSRRSGVKKAELVRKNNEILNKLINDKVK*
Ga0164293_100159062	3300013004	Freshwater	MGTKAKKKRPMRSRKSGLKSVAQINKNLAILSKLK*
Ga0164293_100277074	3300013004	Freshwater	MGTSAKKPRAMRSRRSGIKSLNIVKKNLEILKKLKK*
Ga0164293_100368044	3300013004	Freshwater	MGTAPKKKRAMRSRRSGVKKLTQVKSNLEILNKVKC*
Ga0164293_100956633	3300013004	Freshwater	MGSKAKKQKAMRSRRSGVKKAEQIKKNLAILNKLK*
Ga0164293_102913632	3300013004	Freshwater	MGTAPKKKKPMRSRRSGVKKLTLVKSNLEILNIVKC*
Ga0164293_103447462	3300013004	Freshwater	MGTAAKKPRAMRSVRSGKKKMEQFKKNLEIINRLIKGFKK*
Ga0164292_100636281	3300013005	Freshwater	LYNIKKNNMGTRAKKPRAMRSRRSGIKSLNIVKKNLEI
Ga0164292_100953183	3300013005	Freshwater	MGSKAKKPKAMRSRRSGVKKAEQIKKNLAILNKLK*
Ga0164292_101750982	3300013005	Freshwater	MGSAAKKKRPMRSKRSGVKKLTQINKNLAILSKLK*
Ga0164292_110129742	3300013005	Freshwater	MGTAAKKKRPMRSKRSGVKKLEQVKKNLAILNKVK*
Ga0164296_11007663	3300013093	Freshwater	MGTAAKKPRPKRSRRSGIKTKKLVDNNLKVLSKLKTS*
Ga0136642_10860872	3300013285	Freshwater	MGTAAPKPRAMRSRRSGIKKLTLVQKNLDVLKKLKGN*
Ga0136641_10045526	3300013286	Freshwater	MGTAIKKKRPMKSKRSGVKKLNLVKANLTVLNKIK*
Ga0170791_121311451	3300013295	Freshwater	MATAKKKPVAMRSRRSGVKKLELVKHNLEVLKKYK*
Ga0177922_102769721	3300013372	Freshwater	MGTAAKKKRPMRSRRSGVKKLTLIKSNQEILNKIK*
Ga0181343_11319592	3300017766	Freshwater Lake	MGTRAKKPRAMRSRRSGIKSLNIVKKNLEILKKLKG
Ga0181359_10924323	3300019784	Freshwater Lake	MGIAAKKKRAMRSRRSGVKKAELVKANQVILTKCK
Ga0181359_11210492	3300019784	Freshwater Lake	MGTAAKKKRAMRSRRSGVKKAELVKANQVILTKCK
Ga0181359_12156841	3300019784	Freshwater Lake	MAHAKPKKRAMRSRRSGVKKLEQLKANLAVLSKLK
Ga0211732_12414909	3300020141	Freshwater	MGTSPKKPRAKRSVRSGRKKMELFKKNQDILKKVTKGL
Ga0211732_13360382	3300020141	Freshwater	MGSKAKKPRAMRSRRSGVKKAEQMKKNLAILNKLK
Ga0211732_13759492	3300020141	Freshwater	MGTAAKKPRAMRSRRSGVKSLNIVKNNLEVLKKLKG
Ga0211732_13807512	3300020141	Freshwater	MGTAAKKPRAMRSRRSGVKSLNIVKKNLEILKKLKG
Ga0211732_148454121	3300020141	Freshwater	MGTAAKKKRPMRSKRSGVKKAELVKANQVILAKCR
Ga0211736_103100992	3300020151	Freshwater	MGTRPKKPRAMRSRRSGVKSLNIVKKNLEILKKLKG
Ga0211736_104293203	3300020151	Freshwater	MGTAAKKKRPMRSRKSGVKKLTLVKSNQEILNKIK
Ga0211736_105792332	3300020151	Freshwater	VYLKINQMGTKPKKKRSMRSKRSGVKKVEQINKNLAILSKLK
Ga0211734_100807831	3300020159	Freshwater	MGTAPKKKRAMRSRRSGVKKAEQMKKNLAILQKIK
Ga0211734_100893552	3300020159	Freshwater	MGTKPKKPRAMRSVRSGRKKMELFKNNLAVLKKFLKK
Ga0211734_101237183	3300020159	Freshwater	MGTAPKKKRSMRSRRSGVKKLNLVKSNQEILNKIK
Ga0211734_102356981	3300020159	Freshwater	MGTAPKKPRAMRSVRSGRKKMEIYKKNQEILKKYLKL
Ga0211734_102358811	3300020159	Freshwater	MGTAAKKPRAMRSVRSGRKKMEIYKKNQEILKKYLKL
Ga0211734_105318182	3300020159	Freshwater	MGSAAKKKRPMRSKRSGVKKAELVKANQVILAKYR
Ga0211734_105504861	3300020159	Freshwater	MGTAPKKPRAMRSRRSGIKSLNIVKKNLEILKKLKG
Ga0211734_107597102	3300020159	Freshwater	MAHAKQKKRAMRSRRSGVKKLEQLKANLAVLSKLK
Ga0211734_112490781	3300020159	Freshwater	KKPRAMRSVRSGRKKMEIYKKNQEILKKYLKLAKG
Ga0211733_108378312	3300020160	Freshwater	MGTAAKKPRAMRSKRSGRKKQEIFKANQAIIKKLIKEATA
Ga0211733_109974772	3300020160	Freshwater	MGTAAKKPRAMRSVRSGRKKMEIYKKNQEILKKYLK
Ga0211733_111762941	3300020160	Freshwater	AAKKPRAMRSVRSGRKKMEIYKKNQEILKKYLKLAKG
Ga0211726_107884542	3300020161	Freshwater	MGTAAKKPRAMRSVRSGRKKMEIYKKNQEILKKYLKLTKG
Ga0211726_108014404	3300020161	Freshwater	MGSKAKKPRAMRSRRSGIKKAEQMKKNLAILNKLK
Ga0211735_109263382	3300020162	Freshwater	MGTAAKKPRAMRSKRSGRKKQEIFKANQAIIKKLVKEATA
Ga0211735_111411713	3300020162	Freshwater	MGTAPKKKRAMRSRRSGVKKLSLVKSNLEILNKVKC
Ga0211729_105680964	3300020172	Freshwater	MGTAAKKKRPMRSKRSGVKKLEQVKKNLAILSKLK
Ga0211729_106001961	3300020172	Freshwater	MGSKAKKPRAMRSRRSGVKKAEQIKKNLAILNKLK
Ga0211729_108145002	3300020172	Freshwater	MGTAAKKKRPMRSRRSGVKKLTLVKSNQEILNKIK
Ga0211731_105167472	3300020205	Freshwater	MGTAPKKKRAMRSVRSGVKKLTLVKSNLEILNKVKC
Ga0211731_108549521	3300020205	Freshwater	MGTSPKKPRAKRSVRSGRKKMELFKKNQDILKKVTKG
Ga0211731_108551343	3300020205	Freshwater	MGTAPKKPRAKRSVRSGRKKMELFKKNQDILKKVTKG
Ga0211731_113288881	3300020205	Freshwater	MGTAAPKKRAMRSVRSGRKKMEIYKKNQEILKKYLKLAKG
Ga0211731_117114182	3300020205	Freshwater	MAHAKPKKRAMRSRRSGVKKLEQLKANFAVLSKLK
Ga0208052_1211472	3300020490	Freshwater	MGSKAKKPRAMRSRRSGVKKMELVKNNLRILQNLK
Ga0208091_10115602	3300020506	Freshwater	MGTKAKKKRAMRSRKSGLKTVAQINKNLAILSKLK
Ga0208232_10138723	3300020527	Freshwater	MGSKAKKPRAMRSRRSGIKKAEQIKKNLAILNKLK
Ga0208232_10231922	3300020527	Freshwater	MGTKPKKPRAMRSVRSGRKSLNLLKKNLEILKRLKG
Ga0207941_10176521	3300020539	Freshwater	MGTAAPKPRAMRSRRSGIKKLEIVKKNLEILKKLKGN
Ga0208856_10282402	3300020548	Freshwater	MGTRAKKPRAMRSRRSGVKSFNIVKKNLEILKKLKG
Ga0208362_10432112	3300020558	Freshwater	MGTKPKKKRAMRSRRSGVKKAEQIKKNLAILQNLK
Ga0208719_10193572	3300020564	Freshwater	MGTAAKKPRAMRSVRSGRKKMEIYKKNQEILKKYLKLVKE
Ga0214249_10350282	3300020723	Freshwater	MGTAAKKKRPMRSRRSGVKKTELVKNNLEILKKLSTFVLVV
Ga0214163_10135464	3300021141	Freshwater	LYNIKKKNNMGTRAKKPRAMRSRRSGIKSLNIVKKNLEILKKLKG
Ga0214163_10350073	3300021141	Freshwater	MGTKAKKKRAMRSKKSGLKTVAQINKNLAILSKLK
Ga0194047_100458592	3300021354	Anoxic Zone Freshwater	MGTRAKKPRAMRSRKSGVKTADLIKKNHEVLKKLKS
Ga0194048_100995952	3300021519	Anoxic Zone Freshwater	MGTAPKKPRAMRSRRSGIKSLNIVKNNLEVLKKLKG
Ga0194048_101218673	3300021519	Anoxic Zone Freshwater	MGTAPKKKRAMRSKRSGVKTAEQIKKNLAILQKIK
Ga0194060_100500854	3300021602	Anoxic Zone Freshwater	MGTAAPKKRAMRSRRSGVKKLTLVKKNQEILNKVKC
Ga0213922_11257821	3300021956	Freshwater	MGTAAKKKRPMRSRRSGVKKLELVKSNLEILNKIKA
Ga0222714_100306265	3300021961	Estuarine Water	MGTASKKPRAKRSVRSGRKKMEIFQKNQEIINRLIKELKK
Ga0222714_100346984	3300021961	Estuarine Water	MGTAAKKKRPMRSRKSGLKTVAQINKNLAILSKLK
Ga0222714_100876112	3300021961	Estuarine Water	MGTAAKKKRPMRSKRSGVKKLEQVKKNLLILQKLK
Ga0222714_103847353	3300021961	Estuarine Water	MGSAAKKPRAMRSRRSGVKKKKLVDANLAILNKLINDKTK
Ga0222713_101416571	3300021962	Estuarine Water	MGTAAKKPRAMRSRRSGVKKAELVRKNQEILKKLI
Ga0222713_101682323	3300021962	Estuarine Water	MGTAAKKPRAMRSKRSGRKKQEIFKANQAILKKLMKEATA
Ga0222713_102161242	3300021962	Estuarine Water	MGTAAKKPRAKRSVRSGRKKMEIFQKNQEIINRLIKELKK
Ga0222713_103375142	3300021962	Estuarine Water	MGTAAKKPRAMRSRRSGIKSLKIVKNNLEILKKLKG
Ga0222713_104267723	3300021962	Estuarine Water	KKPRAKRSVRSGRKKMEIFQKNQEIINRLIKELKK
Ga0222713_107972702	3300021962	Estuarine Water	MGTAAKKPRAMRSRRSGVKKLELIKKNIGILKKYLEYYKK
Ga0222712_100440645	3300021963	Estuarine Water	MGTAAKKPRAMRSKRSGLKNFIRTHKNLTIINRLIKELKSK
Ga0222712_100546244	3300021963	Estuarine Water	MGTAAKKKRPMRSRRSGVKKAELVKKNQEILNKIK
Ga0222712_101846623	3300021963	Estuarine Water	MGSKAKKPRAMRSRRSGVKKKRLLDANLAILNKLAK
Ga0222712_107265952	3300021963	Estuarine Water	MGTRAKKPRPMRSKRSGVKKANLVKSNLEILKKLK
Ga0181353_10424721	3300022179	Freshwater Lake	LIKMGTAAKKKRPMRSRKSGLKTVAQINKNLAILSKLK
Ga0181353_11642981	3300022179	Freshwater Lake	MGSAAKKKRPMRSKRSGVKKLEQVKKNLLILQKLK
Ga0181354_11620312	3300022190	Freshwater Lake	MAAAKPKKRAMRSRRSGVKKLEQLKANLAVLSKLK
Ga0236342_10141442	3300022592	Freshwater	MGTAAKKKRPMRSRRSGVKKLNLVKSNLEILSKLK
Ga0214921_100111235	3300023174	Freshwater	MGTRPKKPRAMRSVKSGVKSLNIVKKNLEILKKLKV
Ga0214921_103368502	3300023174	Freshwater	MGSAPAKPRAMRSRRSGIKKLELVKKNIEVLKRLKGN
Ga0214919_1000067257	3300023184	Freshwater	MGTAAKKPRAMRSRRSGVKSLNIVKKNLEILKRLKG
Ga0214919_101269423	3300023184	Freshwater	MGTAAKKPRAMRSRRSGVKKKELVDANLVILKKLQNDKAK
Ga0214919_101445012	3300023184	Freshwater	MGTAPKKPRAMRSVRSGRKKMELFKKNQEIIKKVTKDTTK
Ga0214919_102895282	3300023184	Freshwater	MGTAASKPRAMRSRRSGIKKLELVKKNLEILKKLKGN
Ga0214919_103326242	3300023184	Freshwater	MGTAPKKKRAMRSRKSGVKKLELVKNNLRILQNLK
Ga0214919_104217542	3300023184	Freshwater	MAAAPKKKRAMRSRRSGVKKAEQMKKNLVILQNLK
Ga0214919_104705434	3300023184	Freshwater	MGTAAKKKRAMRSRRSGIKKKELVDANLAILKKLQNDKAK
Ga0255147_100046911	3300024289	Freshwater	MGSAAKKPRAMRSRRSGVKKKKLIDANLAILKKLENDKTK
Ga0255147_11060232	3300024289	Freshwater	MGSAAKKPRPMRSRRSGVKKKQLVDANLAILKKCTTK
Ga0244777_105377232	3300024343	Estuarine	MGTAPKKKRAMRSRRSGVKKAEQMKKNLAILQKLK
Ga0244777_107077492	3300024343	Estuarine	MGTSSKKPRAMRSRRSGIKSLNVVKKNLEILKKLKG
Ga0244775_100251806	3300024346	Estuarine	MGTKPKKPRAMRSRRSGVKSLNIVKKNLEILKKLKG
Ga0244775_100889302	3300024346	Estuarine	MGTRPKKPRSMRSRRSGIKSLDIVKKNLEILKKLKG
Ga0244775_101004573	3300024346	Estuarine	MGSKAKKPKAMRSRRSGVKKAEQMKKNLAILNKLK
Ga0244775_104980911	3300024346	Estuarine	MGTAPKKKRAMRSRRSGVKKSEQMKKNLAILQKIK
Ga0244775_105859313	3300024346	Estuarine	MGTKPQKPRAMRSRRSGVKSLNIVKKNLEILKKLKG
Ga0244775_109739042	3300024346	Estuarine	MGTKSNKPRAMRSRRSGVKSLNIVKKNLEILKKLKG
Ga0244776_100701472	3300024348	Estuarine	MGTRPKKPRAMRSVRSGRKSLNLLKKNLEILKRLKG
Ga0244776_106602091	3300024348	Estuarine	MGTAAPKPRAMRSRRSGVKKLELIKKNLEILKKLKGN
Ga0255176_10943601	3300024507	Freshwater	MGTAAKKPKAMRSRRSGVKKKKLVDANLAILNKLINDKTK
Ga0208383_10041641	3300025357	Freshwater	MGTAAPKPRPIRSRRSGIKKLVLVQKNLEILKRLKG
Ga0207957_10086782	3300025372	Freshwater	MGTAAPKPRPMRSRRSGIKKLVLVQKNLEILKRLKG
Ga0208257_10005626	3300025389	Freshwater	MGTAAKKPRAMRSRRSGVKKLKLVNKNLEILRSLRG
Ga0208739_10757553	3300025426	Freshwater	MGSAAPKPRPMRSRRSGIKKLKLVNANLAILKKLKA
Ga0255156_10764753	3300026478	Freshwater	MGTAAKKPRPMRSRRSGVKKKQLVDANLAILKKCTTK
Ga0208800_10406442	3300027193	Estuarine	LKRYLHKIKFIQMGTAPKKKRAMRSRRSGVKKSEQMKKNLAILQKIK
Ga0208800_10511491	3300027193	Estuarine	MGTAPKKPRAMRSVRSGRKKMEIYKKNQEILKKYLKLAKG
Ga0208311_11440211	3300027387	Estuarine	MGTSSKKPRAMRSRRSGIKSLNVVKKNLEILKKLK
Ga0255146_11002973	3300027396	Freshwater	MGSAAKKPRAMRSRRSGVKKKKLVDANLAILKKLESDKIK
Ga0255146_11003321	3300027396	Freshwater	MGTAAKKPRAMRSRRSGVKKLRLIKQNLEILKKIEKGS
Ga0255158_11128413	3300027541	Freshwater	MGSAAKKPRPMKSRRSGVKKKQLVDANLAILKKCTTK
Ga0209704_12003402	3300027693	Freshwater Sediment	MGSAAKKKRPMRSRRSGIKKLTLVKSNLEILNKSR
Ga0209599_100016898	3300027710	Deep Subsurface	MGTALKKKRAMRSRRSGVKKMELIKNNLRILQKLK
Ga0209599_100092373	3300027710	Deep Subsurface	MGSKAKKPRAMRSRRSGVKKAEQIKKNLAVLNKLK
Ga0209599_101541022	3300027710	Deep Subsurface	MGTAPKKKRAMRSRRSGVKKTEQIKKNLAILQKLK
Ga0209492_12441682	3300027721	Freshwater Sediment	MGTAAKKKRPMRSRRSGVKKAELVKANQIVLNKIK
Ga0209297_10137447	3300027733	Freshwater Lake	MGTAPKKKRAMRSRRSGVKKLNLVKSNLEILNKVKC
Ga0209297_10337155	3300027733	Freshwater Lake	MGTAPKKPRAMRSVRSGRKSLNLLKKNLEILKRLKG
Ga0209297_10549583	3300027733	Freshwater Lake	MGTAAPKPRAMRSRRSGIKKLILIQKNLEILKKLKGN
Ga0209597_13690342	3300027746	Freshwater Lake	MGTAPKKPRAMRSVRSGRKKMELFKKNQEILKKVTKDTTK
Ga0209084_10156652	3300027749	Freshwater Lake	MGTAPKKKRSMRSKKSGVKKLALVKSNLEILNKIKA
Ga0209084_10670243	3300027749	Freshwater Lake	MGTAPKKPRAMRSRRSGVKSLDIVKKNLEVLKKLKG
Ga0209084_13137693	3300027749	Freshwater Lake	DKKKYIYKIMGTAAKKKRPMKSKRSGVKKLELVKNNLRVLQNLK
Ga0209296_10301642	3300027759	Freshwater Lake	MGTASKKPRAMRSRRSGVKSLNIVKNNLEILKKLKG
Ga0209353_101253034	3300027798	Freshwater Lake	MGTKPKKKRAMKSRRSGVKSATQIKKNLAILEKLK
Ga0209358_101548642	3300027804	Freshwater Lake	MGTAAKKPRAMRSRRSGVKKAELVRKNQEILKKLINDKTK
Ga0209358_104744211	3300027804	Freshwater Lake	MGTKATKPKAMRSRRSGVKKAELVKKNQEILKKLINDKVK
Ga0209298_102377432	3300027973	Freshwater Lake	MGTAAKKPRAMRSRRSGVKSLNIVKKNLEVLKKLKG
Ga0247723_10081082	3300028025	Deep Subsurface Sediment	MGTAPKKPRAMRSRRSGRKKQEIFKANQAILKKLMKEATA
Ga0247723_10343394	3300028025	Deep Subsurface Sediment	MGTAPKKKRAMRSRRSGVKKTEQIKKNLAILEKLK
Ga0304728_10722162	3300028393	Freshwater Lake	MGTAAPKKRAMRSRRSGIKKFELVKTNLDILKKIKGN
Ga0315907_102007441	3300031758	Freshwater	MGSKAKKPRAMRSRRSGVKKAELVKKNNEILKKLINDKVK
Ga0315907_102121192	3300031758	Freshwater	MGTAAKKKRPMRSRRSGIKKAEQLKKNLVILSKLK
Ga0315907_102621183	3300031758	Freshwater	MGTAAKKKRAMRSRRSGVKKMELIKNNLRILQKLK
Ga0316219_100848210	3300031759	Freshwater	MGTAAKKPRPKRSRRSGIKTKKLVDNNLKVLSKLKTS
Ga0315899_107868251	3300031784	Freshwater	MGSKAKKPRAMRSRRSGVKKAELVRKNNEILKKLINDKVK
Ga0315899_113539262	3300031784	Freshwater	MGSKAKKPRAMRSRRSGVKKKELVDANLVILKKLQNDKVK
Ga0315900_104508882	3300031787	Freshwater	MGTKAKKKRAMRSRKSGLKTVAQINKNLLILSKLK
Ga0315900_105504862	3300031787	Freshwater	MGTKAKKPRPMRSKRSGVKKLNLVKSNLAILSKLK
Ga0315900_106676024	3300031787	Freshwater	MGTAAKKPRAMRSRRSGVKKKKLIDANLAILKKLESGKVK
Ga0315909_1000116175	3300031857	Freshwater	MGTAAKKKRPMRSRRSGIKKAEQLKKNLLILSKLK
Ga0315909_100369953	3300031857	Freshwater	MGTAAKKKRAMRSRRSGVKKMELVKNNLRILQNLK
Ga0315909_102004352	3300031857	Freshwater	MGTAAKKPRPMRSRRSGIKSKTLIDNNLSILKKYIKK
Ga0315909_105126723	3300031857	Freshwater	MGTAAKKPRAMRSRRSGVKKKKLVDANLAILKKLESGKVK
Ga0315904_104091511	3300031951	Freshwater	MGSAAKKPRAMRSRRSGLKKKKLVDANLVILNKLINDKTK
Ga0315903_100526131	3300032116	Freshwater	KNKIMGTAAKKKRPMRSRRSGIKKAEQLKKNLVILSKLK
Ga0316221_10403134	3300032665	Freshwater	KKAYSLNNMGTAAKKPRPKRSRRSGIKTKKLVDNNLKVLSKLKTS
Ga0334977_0242064_35_142	3300033978	Freshwater	MAAAPKKKRAMRSRRSGVKKSEQMKKNLAILQKIK
Ga0334989_0515647_483_590	3300033984	Freshwater	PKKRAMRSVRSGRKKMEIYKKNQEILKKYLKLVKE
Ga0334992_0326619_235_357	3300033992	Freshwater	MGTAAPKKRAMRSVRSGRKKMEIYKKNQEILKKYLKLVKE
Ga0334996_0215271_855_962	3300033994	Freshwater	MGTKAKKKRPMRSKRSGLKTVAQVNKNLAILSKLK
Ga0334979_0030591_2100_2207	3300033996	Freshwater	MGSKAKKPKAMRSRRSGVKKAEQIKKNLAILNKLK
Ga0334986_0030513_3133_3243	3300034012	Freshwater	MGSAAKKPRPMRSRRSGVKKDKLIKNNTLILSKYTK
Ga0334991_0023515_3254_3364	3300034013	Freshwater	MGTKAKKPHAMRSRRSGVKSLNIVKKNLEILKKLKG
Ga0334991_0028370_684_803	3300034013	Freshwater	MGSAPKKPRAMRSKRSGVKKMEQIKRNLEILKKFLTKKG
Ga0334987_0535407_599_706	3300034061	Freshwater	GTAPKKKKPMRSRRSGVKKLTLVKSNLEILNKVKC
Ga0334987_0650788_211_318	3300034061	Freshwater	MGTAAKKKRPMRSRRSGLKTIAQINKNLVILSKLK
Ga0335025_0003466_9734_9844	3300034096	Freshwater	MGTSAKKPRAMRSRRSGIKSLNIVKKNLEILKKLKK
Ga0335027_0424936_490_597	3300034101	Freshwater	MGTAPKKKRAMRSRRSGVKKLTLVKKNQEILSKLK
Ga0335027_0427056_428_538	3300034101	Freshwater	MGSAAKKKRPMRSRRSGVKKLTLVKSNLEILNKVKC
Ga0335027_0851346_276_386	3300034101	Freshwater	MGTAAKKPRAMRSRRSGIKSLNIVKNNLEILKKLKG
Ga0335029_0406326_317_439	3300034102	Freshwater	MGTATPKKRAMRSVRSGRKKMEIYKKNQEILKKYLKLVKE
Ga0335031_0096977_1683_1805	3300034104	Freshwater	MGTAPKKTRAMRSVRSGRKKMEIYKKNQEILKKYLKLAKG
Ga0335031_0430955_578_685	3300034104	Freshwater	MAHAKPKKRAMRSRRSGVKKVEQLKANLAVLSKLK
Ga0335031_0455989_494_601	3300034104	Freshwater	MGTAPKKKRPMRSRRSGVKKLTLVKKNQEILSKLK
Ga0335031_0790990_135_248	3300034104	Freshwater	MGTAAKKKRAMRSRRSGVKKMELVKNNLRILQKCSAK
Ga0335036_0853958_210_317	3300034106	Freshwater	MANATKKPKPMRSRRSGIKTQTQINKNLAILSKLK
Ga0335050_0093139_1654_1758	3300034108	Freshwater	MGSAPKKPRAMRSKRSGVKKMEQIKRNLEILKKFL
Ga0335013_0756660_350_472	3300034284	Freshwater	MGTAAKKPRAMRSVRSGKKKMEQFKKNLEIINRLIKGFKK

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F009145

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences