| Basic Information | |
|---|---|
| Family ID | F009109 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 323 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGNETTAYY |
| Number of Associated Samples | 183 |
| Number of Associated Scaffolds | 323 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 51.70 % |
| % of genes near scaffold ends (potentially truncated) | 93.81 % |
| % of genes from short scaffolds (< 2000 bps) | 94.43 % |
| Associated GOLD sequencing projects | 168 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.762 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (35.294 % of family members) |
| Environment Ontology (ENVO) | Unclassified (54.180 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.988 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 16.42% β-sheet: 14.93% Coil/Unstructured: 68.66% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 323 Family Scaffolds |
|---|---|---|
| PF12625 | Arabinose_bd | 14.24 |
| PF12833 | HTH_18 | 3.72 |
| PF04392 | ABC_sub_bind | 2.79 |
| PF13676 | TIR_2 | 1.55 |
| PF14020 | DUF4236 | 1.24 |
| PF02627 | CMD | 0.93 |
| PF00589 | Phage_integrase | 0.62 |
| PF00486 | Trans_reg_C | 0.31 |
| PF13924 | Lipocalin_5 | 0.31 |
| PF07045 | DUF1330 | 0.31 |
| PF01494 | FAD_binding_3 | 0.31 |
| PF12770 | CHAT | 0.31 |
| PF01315 | Ald_Xan_dh_C | 0.31 |
| PF10881 | DUF2726 | 0.31 |
| PF04241 | DUF423 | 0.31 |
| PF00999 | Na_H_Exchanger | 0.31 |
| PF13649 | Methyltransf_25 | 0.31 |
| PF09084 | NMT1 | 0.31 |
| PF04542 | Sigma70_r2 | 0.31 |
| PF14373 | Imm_superinfect | 0.31 |
| PF06411 | HdeA | 0.31 |
| PF08281 | Sigma70_r4_2 | 0.31 |
| PF08239 | SH3_3 | 0.31 |
| PF03795 | YCII | 0.31 |
| PF00149 | Metallophos | 0.31 |
| PF00196 | GerE | 0.31 |
| PF00072 | Response_reg | 0.31 |
| COG ID | Name | Functional Category | % Frequency in 323 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 2.79 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.93 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.93 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 0.62 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.31 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.31 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.31 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.31 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.31 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.31 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.31 |
| COG2363 | Uncharacterized membrane protein YgdD, TMEM256/DUF423 family | Function unknown [S] | 0.31 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.31 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.31 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.31 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.31 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.31 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.31 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.31 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.31 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.31 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.76 % |
| Unclassified | root | N/A | 1.24 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000597|AF_2010_repII_A1DRAFT_10051312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1071 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10160965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 537 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10164938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 529 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10072031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 746 | Open in IMG/M |
| 3300000955|JGI1027J12803_100528340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 683 | Open in IMG/M |
| 3300002910|JGI25615J43890_1083458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 560 | Open in IMG/M |
| 3300004629|Ga0008092_11278310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1784 | Open in IMG/M |
| 3300004633|Ga0066395_10209200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens | 1026 | Open in IMG/M |
| 3300005167|Ga0066672_10527458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 765 | Open in IMG/M |
| 3300005332|Ga0066388_104559792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 705 | Open in IMG/M |
| 3300005332|Ga0066388_105324543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 652 | Open in IMG/M |
| 3300005332|Ga0066388_105801863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 624 | Open in IMG/M |
| 3300005332|Ga0066388_106810735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 575 | Open in IMG/M |
| 3300005332|Ga0066388_108007812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 528 | Open in IMG/M |
| 3300005337|Ga0070682_100966060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 705 | Open in IMG/M |
| 3300005356|Ga0070674_100446588 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1066 | Open in IMG/M |
| 3300005356|Ga0070674_102087925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 517 | Open in IMG/M |
| 3300005536|Ga0070697_100176010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1812 | Open in IMG/M |
| 3300005713|Ga0066905_100366749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1156 | Open in IMG/M |
| 3300005713|Ga0066905_100453052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1055 | Open in IMG/M |
| 3300005713|Ga0066905_100663729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 890 | Open in IMG/M |
| 3300005713|Ga0066905_102135594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 521 | Open in IMG/M |
| 3300005713|Ga0066905_102235319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 510 | Open in IMG/M |
| 3300005764|Ga0066903_100412507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2230 | Open in IMG/M |
| 3300005764|Ga0066903_100653542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 1839 | Open in IMG/M |
| 3300005764|Ga0066903_101532121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1260 | Open in IMG/M |
| 3300005764|Ga0066903_102502670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 999 | Open in IMG/M |
| 3300005764|Ga0066903_104502169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 743 | Open in IMG/M |
| 3300005764|Ga0066903_104727337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 725 | Open in IMG/M |
| 3300005764|Ga0066903_106106227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 630 | Open in IMG/M |
| 3300005764|Ga0066903_106572198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 605 | Open in IMG/M |
| 3300005764|Ga0066903_108635812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 518 | Open in IMG/M |
| 3300006028|Ga0070717_11696851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 572 | Open in IMG/M |
| 3300006038|Ga0075365_10168421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1529 | Open in IMG/M |
| 3300006163|Ga0070715_10105034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1324 | Open in IMG/M |
| 3300006175|Ga0070712_100898179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 764 | Open in IMG/M |
| 3300006176|Ga0070765_102094072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 529 | Open in IMG/M |
| 3300006576|Ga0074047_11800261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 577 | Open in IMG/M |
| 3300006581|Ga0074048_13342545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 670 | Open in IMG/M |
| 3300006791|Ga0066653_10348940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 750 | Open in IMG/M |
| 3300006845|Ga0075421_100162541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2786 | Open in IMG/M |
| 3300006904|Ga0075424_102697499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 519 | Open in IMG/M |
| 3300009100|Ga0075418_11474644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 738 | Open in IMG/M |
| 3300009100|Ga0075418_12762188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 536 | Open in IMG/M |
| 3300009137|Ga0066709_100656243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1503 | Open in IMG/M |
| 3300009148|Ga0105243_12253272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 582 | Open in IMG/M |
| 3300009156|Ga0111538_12762076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 615 | Open in IMG/M |
| 3300009162|Ga0075423_10571681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1190 | Open in IMG/M |
| 3300009177|Ga0105248_11078885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 907 | Open in IMG/M |
| 3300009792|Ga0126374_10679364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 771 | Open in IMG/M |
| 3300010043|Ga0126380_10414965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1005 | Open in IMG/M |
| 3300010043|Ga0126380_10441452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 980 | Open in IMG/M |
| 3300010043|Ga0126380_10884514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 740 | Open in IMG/M |
| 3300010043|Ga0126380_11393758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 615 | Open in IMG/M |
| 3300010046|Ga0126384_10033076 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3448 | Open in IMG/M |
| 3300010046|Ga0126384_10472297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1075 | Open in IMG/M |
| 3300010046|Ga0126384_10944572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 782 | Open in IMG/M |
| 3300010046|Ga0126384_11226175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 693 | Open in IMG/M |
| 3300010047|Ga0126382_10215616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1378 | Open in IMG/M |
| 3300010047|Ga0126382_12427048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 510 | Open in IMG/M |
| 3300010048|Ga0126373_11014062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 895 | Open in IMG/M |
| 3300010333|Ga0134080_10319868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 700 | Open in IMG/M |
| 3300010359|Ga0126376_12285444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 586 | Open in IMG/M |
| 3300010360|Ga0126372_11847866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 648 | Open in IMG/M |
| 3300010360|Ga0126372_12692081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 549 | Open in IMG/M |
| 3300010361|Ga0126378_10232554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1931 | Open in IMG/M |
| 3300010361|Ga0126378_12050983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 652 | Open in IMG/M |
| 3300010366|Ga0126379_12066967 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300010366|Ga0126379_12626152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 601 | Open in IMG/M |
| 3300010366|Ga0126379_13228973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 546 | Open in IMG/M |
| 3300010373|Ga0134128_12822339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 535 | Open in IMG/M |
| 3300010375|Ga0105239_10936645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 995 | Open in IMG/M |
| 3300010376|Ga0126381_104335165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 549 | Open in IMG/M |
| 3300010397|Ga0134124_12501550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 558 | Open in IMG/M |
| 3300010398|Ga0126383_10712800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1082 | Open in IMG/M |
| 3300010398|Ga0126383_10796219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1028 | Open in IMG/M |
| 3300010398|Ga0126383_11998672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 667 | Open in IMG/M |
| 3300010398|Ga0126383_13211324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 534 | Open in IMG/M |
| 3300010403|Ga0134123_12681295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 566 | Open in IMG/M |
| 3300010868|Ga0124844_1013801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2116 | Open in IMG/M |
| 3300011107|Ga0151490_1764609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 510 | Open in IMG/M |
| 3300012201|Ga0137365_10139625 | All Organisms → cellular organisms → Bacteria | 1822 | Open in IMG/M |
| 3300012201|Ga0137365_10307989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1173 | Open in IMG/M |
| 3300012201|Ga0137365_10853980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 665 | Open in IMG/M |
| 3300012202|Ga0137363_10113536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2079 | Open in IMG/M |
| 3300012208|Ga0137376_11374355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 597 | Open in IMG/M |
| 3300012211|Ga0137377_10395271 | All Organisms → cellular organisms → Bacteria | 1320 | Open in IMG/M |
| 3300012211|Ga0137377_11358192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 640 | Open in IMG/M |
| 3300012232|Ga0137435_1194744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 622 | Open in IMG/M |
| 3300012356|Ga0137371_11268528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 547 | Open in IMG/M |
| 3300012582|Ga0137358_10350302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1000 | Open in IMG/M |
| 3300012683|Ga0137398_10115211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1709 | Open in IMG/M |
| 3300012941|Ga0162652_100028641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 823 | Open in IMG/M |
| 3300012948|Ga0126375_10733138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 774 | Open in IMG/M |
| 3300012961|Ga0164302_11518023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 553 | Open in IMG/M |
| 3300012971|Ga0126369_13373395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 523 | Open in IMG/M |
| 3300012984|Ga0164309_11841814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 519 | Open in IMG/M |
| 3300012986|Ga0164304_11031130 | Not Available | 653 | Open in IMG/M |
| 3300013102|Ga0157371_10309208 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1145 | Open in IMG/M |
| 3300015371|Ga0132258_12232442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1374 | Open in IMG/M |
| 3300015371|Ga0132258_13063391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1157 | Open in IMG/M |
| 3300015372|Ga0132256_100352528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1566 | Open in IMG/M |
| 3300015372|Ga0132256_101331706 | Not Available | 830 | Open in IMG/M |
| 3300015373|Ga0132257_101422317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 883 | Open in IMG/M |
| 3300015374|Ga0132255_100871397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1345 | Open in IMG/M |
| 3300016270|Ga0182036_10383062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1091 | Open in IMG/M |
| 3300016270|Ga0182036_10636621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 858 | Open in IMG/M |
| 3300016270|Ga0182036_11163508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 640 | Open in IMG/M |
| 3300016270|Ga0182036_11834394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 514 | Open in IMG/M |
| 3300016294|Ga0182041_10130025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1907 | Open in IMG/M |
| 3300016294|Ga0182041_11313098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 662 | Open in IMG/M |
| 3300016294|Ga0182041_11725597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 580 | Open in IMG/M |
| 3300016294|Ga0182041_11827109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 564 | Open in IMG/M |
| 3300016319|Ga0182033_10169901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. E-025 | 1704 | Open in IMG/M |
| 3300016319|Ga0182033_10186196 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1639 | Open in IMG/M |
| 3300016319|Ga0182033_10274942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1379 | Open in IMG/M |
| 3300016319|Ga0182033_10407848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1150 | Open in IMG/M |
| 3300016319|Ga0182033_10838311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 812 | Open in IMG/M |
| 3300016319|Ga0182033_10877271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 794 | Open in IMG/M |
| 3300016341|Ga0182035_12092469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 514 | Open in IMG/M |
| 3300016357|Ga0182032_10138264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1784 | Open in IMG/M |
| 3300016357|Ga0182032_10207093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1497 | Open in IMG/M |
| 3300016357|Ga0182032_10532640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 970 | Open in IMG/M |
| 3300016357|Ga0182032_10983942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 720 | Open in IMG/M |
| 3300016357|Ga0182032_11119523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 676 | Open in IMG/M |
| 3300016371|Ga0182034_10260200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1373 | Open in IMG/M |
| 3300016371|Ga0182034_10377522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1157 | Open in IMG/M |
| 3300016371|Ga0182034_11468194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 597 | Open in IMG/M |
| 3300016387|Ga0182040_10931893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 721 | Open in IMG/M |
| 3300016404|Ga0182037_11411620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 616 | Open in IMG/M |
| 3300016404|Ga0182037_11594552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 580 | Open in IMG/M |
| 3300016422|Ga0182039_10180973 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1664 | Open in IMG/M |
| 3300016422|Ga0182039_11279610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 664 | Open in IMG/M |
| 3300016422|Ga0182039_12243314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 504 | Open in IMG/M |
| 3300016445|Ga0182038_10118062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1964 | Open in IMG/M |
| 3300016445|Ga0182038_10416804 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
| 3300018051|Ga0184620_10059650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1097 | Open in IMG/M |
| 3300018054|Ga0184621_10323376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 543 | Open in IMG/M |
| 3300018066|Ga0184617_1035095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1211 | Open in IMG/M |
| 3300018468|Ga0066662_10577217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1046 | Open in IMG/M |
| 3300018469|Ga0190270_13219567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 517 | Open in IMG/M |
| 3300021168|Ga0210406_10588119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 870 | Open in IMG/M |
| 3300021178|Ga0210408_11200598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 579 | Open in IMG/M |
| 3300021363|Ga0193699_10418267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 554 | Open in IMG/M |
| 3300021432|Ga0210384_10888534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 791 | Open in IMG/M |
| 3300021475|Ga0210392_10778236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 714 | Open in IMG/M |
| 3300021560|Ga0126371_10131536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens | 2542 | Open in IMG/M |
| 3300021560|Ga0126371_10638074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1214 | Open in IMG/M |
| 3300021560|Ga0126371_11961321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 704 | Open in IMG/M |
| 3300021560|Ga0126371_12002389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 697 | Open in IMG/M |
| 3300025900|Ga0207710_10341394 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 762 | Open in IMG/M |
| 3300025906|Ga0207699_11038457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 606 | Open in IMG/M |
| 3300025915|Ga0207693_10579227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 874 | Open in IMG/M |
| 3300025915|Ga0207693_11070698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 613 | Open in IMG/M |
| 3300025929|Ga0207664_11492891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 597 | Open in IMG/M |
| 3300025932|Ga0207690_10706686 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 829 | Open in IMG/M |
| 3300025986|Ga0207658_11493031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 618 | Open in IMG/M |
| 3300027874|Ga0209465_10564866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 565 | Open in IMG/M |
| 3300027903|Ga0209488_11220940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 505 | Open in IMG/M |
| 3300027909|Ga0209382_10661855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1129 | Open in IMG/M |
| 3300027909|Ga0209382_11048378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 846 | Open in IMG/M |
| 3300027909|Ga0209382_11905253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 574 | Open in IMG/M |
| 3300028708|Ga0307295_10083641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 849 | Open in IMG/M |
| 3300028712|Ga0307285_10219107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 536 | Open in IMG/M |
| 3300028744|Ga0307318_10148854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 803 | Open in IMG/M |
| 3300028768|Ga0307280_10289344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 596 | Open in IMG/M |
| 3300028784|Ga0307282_10207724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 937 | Open in IMG/M |
| 3300028793|Ga0307299_10008953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3519 | Open in IMG/M |
| 3300028796|Ga0307287_10227953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 706 | Open in IMG/M |
| 3300028814|Ga0307302_10571077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 562 | Open in IMG/M |
| 3300028819|Ga0307296_10724703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 543 | Open in IMG/M |
| 3300028828|Ga0307312_10572981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 746 | Open in IMG/M |
| 3300028884|Ga0307308_10386542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 670 | Open in IMG/M |
| 3300031198|Ga0307500_10214429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 580 | Open in IMG/M |
| 3300031226|Ga0307497_10568208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 569 | Open in IMG/M |
| 3300031226|Ga0307497_10593284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 559 | Open in IMG/M |
| 3300031231|Ga0170824_127982363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 644 | Open in IMG/M |
| 3300031474|Ga0170818_105288693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 622 | Open in IMG/M |
| 3300031543|Ga0318516_10022304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3252 | Open in IMG/M |
| 3300031543|Ga0318516_10140562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1384 | Open in IMG/M |
| 3300031543|Ga0318516_10400888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 790 | Open in IMG/M |
| 3300031543|Ga0318516_10701062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 575 | Open in IMG/M |
| 3300031545|Ga0318541_10675258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 577 | Open in IMG/M |
| 3300031545|Ga0318541_10716712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 559 | Open in IMG/M |
| 3300031546|Ga0318538_10244825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 962 | Open in IMG/M |
| 3300031546|Ga0318538_10471557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 680 | Open in IMG/M |
| 3300031549|Ga0318571_10372270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 552 | Open in IMG/M |
| 3300031561|Ga0318528_10085005 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1645 | Open in IMG/M |
| 3300031561|Ga0318528_10114767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1421 | Open in IMG/M |
| 3300031564|Ga0318573_10047445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2084 | Open in IMG/M |
| 3300031572|Ga0318515_10261457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 928 | Open in IMG/M |
| 3300031572|Ga0318515_10522143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 633 | Open in IMG/M |
| 3300031573|Ga0310915_10087880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. E-025 | 2079 | Open in IMG/M |
| 3300031573|Ga0310915_10743428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 691 | Open in IMG/M |
| 3300031573|Ga0310915_10770451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 677 | Open in IMG/M |
| 3300031640|Ga0318555_10414167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 730 | Open in IMG/M |
| 3300031668|Ga0318542_10352487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 757 | Open in IMG/M |
| 3300031680|Ga0318574_10427051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 775 | Open in IMG/M |
| 3300031680|Ga0318574_10601876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 644 | Open in IMG/M |
| 3300031680|Ga0318574_10728025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 581 | Open in IMG/M |
| 3300031682|Ga0318560_10695376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 550 | Open in IMG/M |
| 3300031713|Ga0318496_10377289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 784 | Open in IMG/M |
| 3300031713|Ga0318496_10706611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 556 | Open in IMG/M |
| 3300031719|Ga0306917_10210782 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1475 | Open in IMG/M |
| 3300031719|Ga0306917_10687454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 804 | Open in IMG/M |
| 3300031719|Ga0306917_10783735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 748 | Open in IMG/M |
| 3300031719|Ga0306917_11114289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 614 | Open in IMG/M |
| 3300031723|Ga0318493_10010854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 3767 | Open in IMG/M |
| 3300031723|Ga0318493_10810876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 528 | Open in IMG/M |
| 3300031724|Ga0318500_10740303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300031736|Ga0318501_10610426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 599 | Open in IMG/M |
| 3300031744|Ga0306918_10125266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1867 | Open in IMG/M |
| 3300031744|Ga0306918_10958324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 665 | Open in IMG/M |
| 3300031747|Ga0318502_10113025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1517 | Open in IMG/M |
| 3300031763|Ga0318537_10032538 | All Organisms → cellular organisms → Bacteria | 1860 | Open in IMG/M |
| 3300031763|Ga0318537_10313603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 580 | Open in IMG/M |
| 3300031763|Ga0318537_10375371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 524 | Open in IMG/M |
| 3300031764|Ga0318535_10540571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 517 | Open in IMG/M |
| 3300031764|Ga0318535_10560592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 506 | Open in IMG/M |
| 3300031765|Ga0318554_10442941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 736 | Open in IMG/M |
| 3300031768|Ga0318509_10171061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1203 | Open in IMG/M |
| 3300031768|Ga0318509_10424941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 743 | Open in IMG/M |
| 3300031770|Ga0318521_10857967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 554 | Open in IMG/M |
| 3300031771|Ga0318546_10168730 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1483 | Open in IMG/M |
| 3300031771|Ga0318546_11105983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 557 | Open in IMG/M |
| 3300031771|Ga0318546_11149941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 545 | Open in IMG/M |
| 3300031777|Ga0318543_10069127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1476 | Open in IMG/M |
| 3300031777|Ga0318543_10258885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 776 | Open in IMG/M |
| 3300031778|Ga0318498_10357536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 651 | Open in IMG/M |
| 3300031778|Ga0318498_10522715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 521 | Open in IMG/M |
| 3300031781|Ga0318547_10163264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1316 | Open in IMG/M |
| 3300031781|Ga0318547_10681973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 638 | Open in IMG/M |
| 3300031781|Ga0318547_10960170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 534 | Open in IMG/M |
| 3300031792|Ga0318529_10364808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 672 | Open in IMG/M |
| 3300031793|Ga0318548_10319242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 763 | Open in IMG/M |
| 3300031794|Ga0318503_10028959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1613 | Open in IMG/M |
| 3300031794|Ga0318503_10150701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 750 | Open in IMG/M |
| 3300031794|Ga0318503_10249053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 576 | Open in IMG/M |
| 3300031797|Ga0318550_10092954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1414 | Open in IMG/M |
| 3300031798|Ga0318523_10159552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1123 | Open in IMG/M |
| 3300031805|Ga0318497_10375481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 795 | Open in IMG/M |
| 3300031821|Ga0318567_10827632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 524 | Open in IMG/M |
| 3300031833|Ga0310917_10046645 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2643 | Open in IMG/M |
| 3300031833|Ga0310917_10745219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 662 | Open in IMG/M |
| 3300031845|Ga0318511_10213260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 860 | Open in IMG/M |
| 3300031859|Ga0318527_10256434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 743 | Open in IMG/M |
| 3300031860|Ga0318495_10502720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 529 | Open in IMG/M |
| 3300031879|Ga0306919_10089079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. E-025 | 2146 | Open in IMG/M |
| 3300031879|Ga0306919_10170885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1599 | Open in IMG/M |
| 3300031879|Ga0306919_11510547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 505 | Open in IMG/M |
| 3300031880|Ga0318544_10127436 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300031890|Ga0306925_10741229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1024 | Open in IMG/M |
| 3300031890|Ga0306925_10854763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 939 | Open in IMG/M |
| 3300031890|Ga0306925_11289993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 726 | Open in IMG/M |
| 3300031890|Ga0306925_11488247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 663 | Open in IMG/M |
| 3300031890|Ga0306925_11590253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 636 | Open in IMG/M |
| 3300031893|Ga0318536_10082691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1594 | Open in IMG/M |
| 3300031894|Ga0318522_10128953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 948 | Open in IMG/M |
| 3300031897|Ga0318520_10127587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1455 | Open in IMG/M |
| 3300031910|Ga0306923_11497491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 706 | Open in IMG/M |
| 3300031910|Ga0306923_12194165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 554 | Open in IMG/M |
| 3300031912|Ga0306921_10185488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2438 | Open in IMG/M |
| 3300031912|Ga0306921_10935700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum | 982 | Open in IMG/M |
| 3300031912|Ga0306921_11684750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 686 | Open in IMG/M |
| 3300031912|Ga0306921_12009528 | Not Available | 615 | Open in IMG/M |
| 3300031912|Ga0306921_12292324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 566 | Open in IMG/M |
| 3300031941|Ga0310912_10040819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3217 | Open in IMG/M |
| 3300031941|Ga0310912_10233137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1413 | Open in IMG/M |
| 3300031941|Ga0310912_10527629 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300031942|Ga0310916_10188159 | All Organisms → cellular organisms → Bacteria | 1722 | Open in IMG/M |
| 3300031942|Ga0310916_10289205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1386 | Open in IMG/M |
| 3300031942|Ga0310916_10504273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1031 | Open in IMG/M |
| 3300031942|Ga0310916_10756552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 820 | Open in IMG/M |
| 3300031942|Ga0310916_11097224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 661 | Open in IMG/M |
| 3300031945|Ga0310913_10085677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2109 | Open in IMG/M |
| 3300031945|Ga0310913_10892930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 625 | Open in IMG/M |
| 3300031946|Ga0310910_10633273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 847 | Open in IMG/M |
| 3300031947|Ga0310909_10317681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1306 | Open in IMG/M |
| 3300031954|Ga0306926_10265014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2128 | Open in IMG/M |
| 3300031954|Ga0306926_10350680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1824 | Open in IMG/M |
| 3300031954|Ga0306926_11672659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 727 | Open in IMG/M |
| 3300031954|Ga0306926_12279639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 600 | Open in IMG/M |
| 3300031954|Ga0306926_12485544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 568 | Open in IMG/M |
| 3300031954|Ga0306926_12789867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 528 | Open in IMG/M |
| 3300031981|Ga0318531_10210662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 876 | Open in IMG/M |
| 3300031981|Ga0318531_10494141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 554 | Open in IMG/M |
| 3300031981|Ga0318531_10588306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 504 | Open in IMG/M |
| 3300032035|Ga0310911_10227775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1064 | Open in IMG/M |
| 3300032039|Ga0318559_10061986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1592 | Open in IMG/M |
| 3300032041|Ga0318549_10042636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1845 | Open in IMG/M |
| 3300032042|Ga0318545_10002251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5139 | Open in IMG/M |
| 3300032042|Ga0318545_10227758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 668 | Open in IMG/M |
| 3300032042|Ga0318545_10251492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 634 | Open in IMG/M |
| 3300032043|Ga0318556_10087995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1559 | Open in IMG/M |
| 3300032043|Ga0318556_10199174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1041 | Open in IMG/M |
| 3300032044|Ga0318558_10316590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 772 | Open in IMG/M |
| 3300032055|Ga0318575_10249548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 895 | Open in IMG/M |
| 3300032059|Ga0318533_10999312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 613 | Open in IMG/M |
| 3300032064|Ga0318510_10115945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1033 | Open in IMG/M |
| 3300032065|Ga0318513_10179572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1016 | Open in IMG/M |
| 3300032065|Ga0318513_10427113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 647 | Open in IMG/M |
| 3300032068|Ga0318553_10054381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1978 | Open in IMG/M |
| 3300032076|Ga0306924_11153231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 841 | Open in IMG/M |
| 3300032076|Ga0306924_12383783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 534 | Open in IMG/M |
| 3300032091|Ga0318577_10082779 | All Organisms → cellular organisms → Bacteria | 1486 | Open in IMG/M |
| 3300032091|Ga0318577_10097135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1376 | Open in IMG/M |
| 3300032091|Ga0318577_10385811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 669 | Open in IMG/M |
| 3300032091|Ga0318577_10477794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 594 | Open in IMG/M |
| 3300032091|Ga0318577_10538441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 556 | Open in IMG/M |
| 3300032094|Ga0318540_10048853 | All Organisms → cellular organisms → Bacteria | 1894 | Open in IMG/M |
| 3300032261|Ga0306920_100615828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1605 | Open in IMG/M |
| 3300032261|Ga0306920_101624873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 918 | Open in IMG/M |
| 3300032261|Ga0306920_103657558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 565 | Open in IMG/M |
| 3300032261|Ga0306920_103984669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 536 | Open in IMG/M |
| 3300032261|Ga0306920_103997258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 535 | Open in IMG/M |
| 3300033289|Ga0310914_10195664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1804 | Open in IMG/M |
| 3300033289|Ga0310914_10215095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1719 | Open in IMG/M |
| 3300033289|Ga0310914_10791010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 846 | Open in IMG/M |
| 3300033289|Ga0310914_11167510 | Not Available | 671 | Open in IMG/M |
| 3300033290|Ga0318519_10245575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1034 | Open in IMG/M |
| 3300033290|Ga0318519_10287802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 959 | Open in IMG/M |
| 3300033290|Ga0318519_10531901 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 710 | Open in IMG/M |
| 3300034149|Ga0364929_0150891 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 754 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 35.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.12% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.60% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.88% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.41% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.79% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.17% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.86% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.24% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.93% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.62% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.62% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.62% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.31% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.31% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.31% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.31% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.31% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.31% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.31% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.31% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.31% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.31% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.31% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.31% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.31% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.31% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002910 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm | Environmental | Open in IMG/M |
| 3300004629 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A01 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006576 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012232 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2 | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012941 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300034149 | Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A1DRAFT_100513122 | 3300000597 | Forest Soil | MTLQKAKSIARHLGLTLRQLDSGNYRVNFRDGNETTAYYTGKLE |
| AF_2010_repII_A1DRAFT_101609651 | 3300000597 | Forest Soil | MTLQKAKSIARHLGLTLREVCSGDYRVNFRDGNETTAYYTDKLEDAVNTA |
| AF_2010_repII_A1DRAFT_101649381 | 3300000597 | Forest Soil | MTLQEAKSVARHLGLTLRKVRSGDYRVNFRDGNETTAYYTDNLEDAVN |
| AF_2010_repII_A001DRAFT_100720313 | 3300000793 | Forest Soil | MTLQAAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAFYTGNLEDAV |
| JGI1027J12803_1005283401 | 3300000955 | Soil | MTLQEAKSIARHLGLTLRQVRSGAYRVNFRDGNETTAYYT |
| JGI25615J43890_10834581 | 3300002910 | Grasslands Soil | MTLQEAKSIARHLGLALRKVRSGDYRVNFRDGNEARALLHG* |
| Ga0008092_112783101 | 3300004629 | Tropical Rainforest Soil | MTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGNERTAYYTDSLEDAV |
| Ga0066395_102092002 | 3300004633 | Tropical Forest Soil | MTLQEAKSMARHLGLTLREVRSVDYRVNFRDESETTAYYTDNLEDAVTKKWNRQ* |
| Ga0066672_105274583 | 3300005167 | Soil | TMTLQEAKSIARHLGLALRKVRSGDYRVNFRDGNEPASLLHG* |
| Ga0066388_1045597922 | 3300005332 | Tropical Forest Soil | MIMTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGNEATAY |
| Ga0066388_1053245432 | 3300005332 | Tropical Forest Soil | MTLQEAKSIARHLGLTLREVRSGKYRVNFRDGNETTAYYTD |
| Ga0066388_1058018632 | 3300005332 | Tropical Forest Soil | MDSAMTLQQAKSIARHLGLTLRKVRSGDYRVNFRDGNEMTAYYT |
| Ga0066388_1068107352 | 3300005332 | Tropical Forest Soil | MTLQKAKSIARHLGLTLREVCSGDYRVNFRDGTEVTAYYTDNLE |
| Ga0066388_1080078122 | 3300005332 | Tropical Forest Soil | MTIQKPITLQEAKSIARHLGLTLRMVRSGEYRVNFRDGNE |
| Ga0070682_1009660601 | 3300005337 | Corn Rhizosphere | MTLQEAKSIARHLGLTLRQVRSGAYRVNFRDGNETTAYYTTDLED |
| Ga0070674_1004465881 | 3300005356 | Miscanthus Rhizosphere | MTLQEAKSIVRHLGLTLRKVRSGDYCVKSRDGTEATPYYTVDLEDA |
| Ga0070674_1020879252 | 3300005356 | Miscanthus Rhizosphere | MTIQKLMTLQEAKSIARHLGLTLRQVRSGKYRVNFRDGDETTA |
| Ga0070697_1001760101 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MDSAMTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGNEMTAYYT |
| Ga0066905_1003667492 | 3300005713 | Tropical Forest Soil | MTPQEAKSIARHLGLTLRKVRSGDYRVNFRDGTETTAY* |
| Ga0066905_1004530523 | 3300005713 | Tropical Forest Soil | MPSKRRFHKAMTLQKAKSIARRLGLTLREVCSGDYRVNFRDGNET |
| Ga0066905_1006637295 | 3300005713 | Tropical Forest Soil | MTLQQAKSIARHLGLTLRKVRSGDYRVNFRDGNETTAYYTDNLEDAV |
| Ga0066905_1021355942 | 3300005713 | Tropical Forest Soil | MTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGNETTAYYTDN |
| Ga0066905_1022353191 | 3300005713 | Tropical Forest Soil | MTLQKAKSIARHLGLTLRQLDSGNYRVNFRDGNETTAYYT |
| Ga0066903_1004125073 | 3300005764 | Tropical Forest Soil | MTLGKAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAYYTDKL |
| Ga0066903_1006535421 | 3300005764 | Tropical Forest Soil | MDSAMTLQEAKSIARHLGLTLRKVRSGDYRVNFRDG |
| Ga0066903_1015321211 | 3300005764 | Tropical Forest Soil | VLPDAVSKTVTLAQAKSIARHLGLTLRQVRSGGYRVNF |
| Ga0066903_1025026703 | 3300005764 | Tropical Forest Soil | MTLQEAKSIARHLGLTLRKVRSGDYRVSFRDGNETTACYTGTLEDAVCGP* |
| Ga0066903_1045021692 | 3300005764 | Tropical Forest Soil | MTLQEAKSIARHLGLTLRKVRSGDYRLTFQDARETAAYTRTISKTR* |
| Ga0066903_1047273372 | 3300005764 | Tropical Forest Soil | MTLQEAKSIARHLGLTLRQVRSGAYRVNFRDGNETTAYY |
| Ga0066903_1061062272 | 3300005764 | Tropical Forest Soil | MDSAMTLQEARSIARHLGLTLRKVRSGDYRVNFRDGNEMTAYYTDNLEDA |
| Ga0066903_1065721981 | 3300005764 | Tropical Forest Soil | MTIQKPLTLQKAKSIARHLGLTVREVCSGNYRVNFRDGDETTAYYT |
| Ga0066903_1086358121 | 3300005764 | Tropical Forest Soil | MTLQQAKSIARHLGLTLRKVRSGDYRVNFRDGNETTAYYTDNLEDAVN |
| Ga0070717_116968512 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MDSAMTLQEAKSIGRHLGLTLRQVRSGDYRVNFLDGNKMTAHYTDNLEDAVN |
| Ga0075365_101684211 | 3300006038 | Populus Endosphere | MTLQEAKSIARHLGLSLRRVRSGAYRVSFPDENEATAYYTDSLED |
| Ga0070715_101050341 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLPKAKSIARHLRLTLRQLCSGDYRVNFRDGNETTAYY |
| Ga0070712_1008981792 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLQEAKSIARHLGLILRTMRSGDYRVNFRDGNETTAYY |
| Ga0070765_1020940721 | 3300006176 | Soil | MTIQKPITLQEAKSIARHLGLTLRQERSGHYRVNFRDGG |
| Ga0074047_118002612 | 3300006576 | Soil | MTLQEAKSIVRHLGLTLRKVRSGDYCVKSRDGTEATPYYTVDLEDAV |
| Ga0074048_133425451 | 3300006581 | Soil | MTLQEAKSIVRHLGLTLRKVRSGDYCVKSRDGNEAT |
| Ga0066653_103489403 | 3300006791 | Soil | MTLRKAKSIARHLRLTLRQVCSGDYRVNFRDANETTAYYT |
| Ga0075421_1001625411 | 3300006845 | Populus Rhizosphere | MTLQEAKSIARHLGLTLRRVRSGKYRVNFSDGNETTAY |
| Ga0075424_1026974992 | 3300006904 | Populus Rhizosphere | MTLQEAKSIARHLGLALLQVRRGHYRLNFRDGNETSTSR* |
| Ga0075418_114746441 | 3300009100 | Populus Rhizosphere | MTHHEAKSIARHLGLTLRKVRSGDYRVNFADADDSAAYYTDNLEDAI |
| Ga0075418_127621881 | 3300009100 | Populus Rhizosphere | MTLQEAKSIARHLGLTLRHVRSGQYRVNFRDGNERAYYTN |
| Ga0066709_1006562431 | 3300009137 | Grasslands Soil | MTLQEAKSIARHLGLALRKVRSDDYRVNFRDGNEPAPYYT |
| Ga0105243_122532721 | 3300009148 | Miscanthus Rhizosphere | MTLQEAKSIVRHLGLTLRKVRSGDYCVKSRDGNEATPYYTDDLE |
| Ga0111538_127620761 | 3300009156 | Populus Rhizosphere | MTLQEAKSIARHLGLTLRKVRSSDYRVNFRDGNETTAYYTDDLEDAVSA |
| Ga0075423_105716813 | 3300009162 | Populus Rhizosphere | MTLQEAKSIARHLGLTLRQVRSGAYRVNFPDGNETTAYYTNNLEEAVN |
| Ga0105248_110788851 | 3300009177 | Switchgrass Rhizosphere | MDSDMTLQEAKSIARHFGLTLRKVRSGEYRVNFRDGNEMT |
| Ga0126374_106793642 | 3300009792 | Tropical Forest Soil | MTLQKAKSIARHLGLTLRQLRSGNYRVNFRDGNET |
| Ga0126380_104149654 | 3300010043 | Tropical Forest Soil | MTLQQAKSIARHLRLTLRMVRSGNHRVNFRDGNETTAYYTDKLE |
| Ga0126380_104414522 | 3300010043 | Tropical Forest Soil | MNGIHPASMAMTLQQAKSIARHLGLTLRKVRSGDYRVNFRDGNETTAYYTDSLE |
| Ga0126380_108845143 | 3300010043 | Tropical Forest Soil | MTLQEAKSIARHLGLTLRHVRSGDYRVNFRDGNDTTA |
| Ga0126380_113937581 | 3300010043 | Tropical Forest Soil | MDSAMTLQEAKSIARHLRLTLRQVRSGDYRVNFRDGNETT |
| Ga0126384_100330761 | 3300010046 | Tropical Forest Soil | MDSAMTLQEAKSVARHLGLTLRKVRSGDYRVNFRDGNETTA |
| Ga0126384_104722971 | 3300010046 | Tropical Forest Soil | MTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGNETTAYYTDNLEDAVN |
| Ga0126384_109445721 | 3300010046 | Tropical Forest Soil | MHSAMTLQEAKSIARHLRLTLRKVRSGDYRVNFRDGNETTAYYTDS |
| Ga0126384_112261752 | 3300010046 | Tropical Forest Soil | MDSAMTIQEAKSIARHLRLTLRKVRSGNYRVNFRDGNETSAYYTDDLEDAV |
| Ga0126382_102156161 | 3300010047 | Tropical Forest Soil | MTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGNETTA |
| Ga0126382_124270481 | 3300010047 | Tropical Forest Soil | MTLQEAKSIARHLGLTQRKVRSGEYRVNFRDGNETTAYYTDNLE |
| Ga0126373_110140621 | 3300010048 | Tropical Forest Soil | MTLQKAKSIARHLGLTLRKVCSGDYRVNFRDGNETTAYY |
| Ga0134080_103198682 | 3300010333 | Grasslands Soil | MTPQEAKSIARHLGLTLRKVRSGDYRVNFRDGNETTAYYTDNLED |
| Ga0126376_122854441 | 3300010359 | Tropical Forest Soil | MTLQEAKSIARHLRLTLRMVRSGDYRLNFRDGNETTAYYTDNLEDA |
| Ga0126372_118478661 | 3300010360 | Tropical Forest Soil | MTLQEAKSIARHLGLTLRKVRSGDYRVSCRDGDETTAYYTQ |
| Ga0126372_126920811 | 3300010360 | Tropical Forest Soil | MTLQQAKSIARHLGLTLRKVRSGHYRANFRDGNKMTAYYTD |
| Ga0126378_102325542 | 3300010361 | Tropical Forest Soil | MTLQEAKSIARHLGLTLRMVRSGDYRVNFRDGNETTAY* |
| Ga0126378_120509831 | 3300010361 | Tropical Forest Soil | MTLQQAKSIARHLGLTLRKVRSGDYRVNFRDGSETTVYYTDSLEDA |
| Ga0126379_120669671 | 3300010366 | Tropical Forest Soil | MTLPQAKSIARHLGLTLRKVRSGDYRVNFRDGNETTAYYTDSLQDA |
| Ga0126379_126261521 | 3300010366 | Tropical Forest Soil | MTLQEAKSIARHLGLTLRKVRSGDFRVSCRDGDETTA |
| Ga0126379_132289732 | 3300010366 | Tropical Forest Soil | MTLQEAKSIARHLGLTLRKMRSGDYRVNFRDGNET |
| Ga0134128_128223391 | 3300010373 | Terrestrial Soil | VTLQEAKLIARHLGLTLRKVRSGEYRVNSADADDSTAYYTDNLDD |
| Ga0105239_109366451 | 3300010375 | Corn Rhizosphere | MAMTLQEAKSIARHLGLTLRQVGSGAYRVNFRDGHETTAY |
| Ga0126381_1043351651 | 3300010376 | Tropical Forest Soil | MTLQKAKSIVRHLGLTLRQLRSGNYRVTFRDGNETTACYTDNLEDAVKCRGCDDP* |
| Ga0134124_125015501 | 3300010397 | Terrestrial Soil | MDSAMTLQEAKSIARHLGLTLRQVRSGAYRVNFRD |
| Ga0126383_107128002 | 3300010398 | Tropical Forest Soil | MTLQEAKSIARHLGFTLRKVRSGDYRVTFRDGDETGSYYTDDLED |
| Ga0126383_107962191 | 3300010398 | Tropical Forest Soil | MTLRKAKSIARHLGLTLREVCSGDYRVNFRDGNETTAYYTDNLEDAVNTA |
| Ga0126383_119986721 | 3300010398 | Tropical Forest Soil | MTLQKAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAYYTDKLED |
| Ga0126383_132113241 | 3300010398 | Tropical Forest Soil | MTIQKPITLQKAKSIARHLGVTLRQVRSGAYRVNFRDGNETTAYYTD |
| Ga0134123_126812952 | 3300010403 | Terrestrial Soil | MDSAMTLQEAKSVARHLGLTLRKVRSGDYRVNFRDANETTPYYTDS |
| Ga0124844_10138012 | 3300010868 | Tropical Forest Soil | MTLQEAKSIARHLGLTLRTVRSGNYRVNLRDGNETTA* |
| Ga0151490_17646092 | 3300011107 | Soil | MTIQKPMTLQEAKSIARHLGLTLRQVRSGNYRVNFRDGNETT |
| Ga0137365_101396254 | 3300012201 | Vadose Zone Soil | MTLQQAKSIARQLGLTLHQVRSGDYRVNFRDGNETTAY* |
| Ga0137365_103079891 | 3300012201 | Vadose Zone Soil | MTLQQAKSIARHLGLTLRQVRSGDYRVNFRDGNEITAYYTDNLEDAVNT |
| Ga0137365_108539803 | 3300012201 | Vadose Zone Soil | MRLQEAKSIARHLGLTLRQVRSGAYRVNFRDGNETTAYYTDNLEDA |
| Ga0137363_101135361 | 3300012202 | Vadose Zone Soil | MRFQNTMTLQEAKSIARHLGLTLRRVRSGAYRVNFLDGSETTAYYTDN |
| Ga0137376_113743551 | 3300012208 | Vadose Zone Soil | MTLQEAKAIARHLGLTLRKVHSGDYRVKFRDGNEMTAYYTDNLE |
| Ga0137377_103952711 | 3300012211 | Vadose Zone Soil | MTLQEAKSIARHLGLTLRQVRSGAYRVNFRDGNETTAYYTDN |
| Ga0137377_113581923 | 3300012211 | Vadose Zone Soil | MTIHETMTLRKAKSIARHLRLTLRQVCSGDYRVNFRDGNE |
| Ga0137435_11947442 | 3300012232 | Soil | MTIQKPITLQEAKSIARHLGLTLRKMRSGHYRLNFRD |
| Ga0137371_112685283 | 3300012356 | Vadose Zone Soil | MRLQEAKSIARHLRLTLRQVRSGDYRVNFRDGNETTAYYPKN |
| Ga0137358_103503021 | 3300012582 | Vadose Zone Soil | VTLQEAKSIARHLGLTLRKVRSGHYRVNFRDGNENTAYYRDNLEDA |
| Ga0137398_101152113 | 3300012683 | Vadose Zone Soil | MTIQKPITLQEAKSIARHLGLTLRKVRSGHYRVNFRDGDGSTA |
| Ga0162652_1000286412 | 3300012941 | Soil | MTLQEAKSIARHLGCTLRKVRSGDYCVKFPDGNDCMAYY |
| Ga0126375_107331381 | 3300012948 | Tropical Forest Soil | MTLQKAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAYYTD |
| Ga0164302_115180232 | 3300012961 | Soil | MTHQEAKSIARHLGLTLRKVRSGKYCVKFRDGNEAPPYFTD |
| Ga0126369_133733952 | 3300012971 | Tropical Forest Soil | MTLQEAKSIARHLGLTLRKVRSGDFRVSCRDGDEST |
| Ga0164309_118418141 | 3300012984 | Soil | VTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGNETT |
| Ga0164304_110311302 | 3300012986 | Soil | LDSDGFPMTIQKPMTLQEAKSIARHLGLTLRKVRSGDY |
| Ga0157371_103092083 | 3300013102 | Corn Rhizosphere | MTLQEAKSIVRHLGLTLRKVRSGDYCVRFRDGNEATPYYTDDLED |
| Ga0132258_122324423 | 3300015371 | Arabidopsis Rhizosphere | MTLQEAKSIARHLGLTLRRVRSGAYRVNFSDGNET |
| Ga0132258_130633911 | 3300015371 | Arabidopsis Rhizosphere | MTLQEAKSIARHLGCTLRKVRSGDYCVKFPDGNNPMAYYTDNLEDAVNVA |
| Ga0132256_1003525281 | 3300015372 | Arabidopsis Rhizosphere | MPLQEAKSIAHHLGLTLRRVRAGAYRVNFSDGNETTA |
| Ga0132256_1013317061 | 3300015372 | Arabidopsis Rhizosphere | MTLQKAKSIARHLGLTLRPLRLGNFRVNFRKGDESTAYYTDTLEDA |
| Ga0132257_1014223171 | 3300015373 | Arabidopsis Rhizosphere | MTLQEAKSIARHLGLTLRRVRSGDYRVNFPNENEATA |
| Ga0132255_1008713972 | 3300015374 | Arabidopsis Rhizosphere | MPLQEAKSIARHLGLTLRRVRSGAYRVNFSDGNETTAYYTDNLEEVALQ* |
| Ga0182036_103830621 | 3300016270 | Soil | MTLPKAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAYYTDKLEDA |
| Ga0182036_106366213 | 3300016270 | Soil | MTLQEAKSIARHLGLTLRQVRSGDYRVNFRDGSETTVYYTDSLE |
| Ga0182036_111635081 | 3300016270 | Soil | MTLQEAKTLARHLGLTLRKVRSGDYRVNFRDGNETSAYYTDN |
| Ga0182036_118343941 | 3300016270 | Soil | MTLQEAKSIARHLGLTLRMVRSGDYRVSFRDGNETTACYTDNLEDA |
| Ga0182041_101300251 | 3300016294 | Soil | MTIQKPTLQEAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAYYTDN |
| Ga0182041_113130981 | 3300016294 | Soil | MTIQKPIKLQKAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAYYTDN |
| Ga0182041_117255971 | 3300016294 | Soil | MTLQKAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAYYTDKLEDA |
| Ga0182041_118271093 | 3300016294 | Soil | MTLQQAKSIARHLALTLRMVRSGEYRVNFRDGNETTAYYTDNL |
| Ga0182033_101699011 | 3300016319 | Soil | MTLQQAKSIARHLGLTLRKVRSGDYRVNFRDGNETTA |
| Ga0182033_101861961 | 3300016319 | Soil | MTLQEAKSIARHLGLTLRKVRSGDYRVSCRDGDESTA |
| Ga0182033_102749424 | 3300016319 | Soil | MTLQEAKSIARHLGLTLRKVRSGDYRVSCRDGDEST |
| Ga0182033_104078483 | 3300016319 | Soil | DSAMTLQQAKSIARHLGLTLRKVRSGDYRVNFRDGNEMTA |
| Ga0182033_108383112 | 3300016319 | Soil | MDSVMTLQQAKSIARHLRLTLRKVRSGDYRVNFRDGNETTAYYTDNLE |
| Ga0182033_108772712 | 3300016319 | Soil | MTIQKPMTLQEAKSIARHLGLTLRQLHSGNYRVNFRDGNENTA |
| Ga0182035_120924691 | 3300016341 | Soil | MTIQKPTLQEAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAYYTDNLED |
| Ga0182032_101382644 | 3300016357 | Soil | MTLQEAKSIARHLGLTLRKVRSGDYRVSCRDGDETTAYYTQNLEDA |
| Ga0182032_102070931 | 3300016357 | Soil | MTIQKPITLQEAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAYYTDNLEDA |
| Ga0182032_105326403 | 3300016357 | Soil | MTIQKPIKLQKAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAYYTDNLE |
| Ga0182032_109839421 | 3300016357 | Soil | MTLQQAKSIARHLGLTLRKVRSGDYRVNFRDGNEMT |
| Ga0182032_111195231 | 3300016357 | Soil | MDSAMTLQQAKSIARHLGLTLRKVRSGDYRVNFRDGNEMTAYYTDNLE |
| Ga0182034_102602001 | 3300016371 | Soil | MTIQKPTLQEAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAYYTDKLEDAVNA |
| Ga0182034_103775223 | 3300016371 | Soil | PMDSAMTLQQAKSIARHLGLTLRKVRSGDYRVNFRDGNEMTA |
| Ga0182034_114681942 | 3300016371 | Soil | MDSAMTLQQAKSIARHLGLTLRKVRSGDYRVNFRDGNEM |
| Ga0182040_109318933 | 3300016387 | Soil | MTIQKPIKLQKAKSIARHLGLTLRQLRSGNYRVNFRDG |
| Ga0182037_114116201 | 3300016404 | Soil | MTLQQAKSIARHLGLTLRKVRSGDYRVNFRDGNEMTAYYTDSLENA |
| Ga0182037_115945521 | 3300016404 | Soil | MTLQEAKSIARHLGFTLRKRRSCAYRVNFRDGNETSAYYTDNLEDA |
| Ga0182039_101809731 | 3300016422 | Soil | MTLQEAKSIARHLGLTLRKVRSGDYRVSCRDGDESTAY |
| Ga0182039_112796103 | 3300016422 | Soil | MTLQEAKSIARHLGLTLRKVRSGDYRVSCRDGDET |
| Ga0182039_122433141 | 3300016422 | Soil | MTLQQAKSIARHLGLTLRKVRSGDYRVNFRDGNETTAYYADNLE |
| Ga0182038_101180621 | 3300016445 | Soil | MTLQEAKSIARHLGLTLRKVRSGDYRVSCRDGDETTAYYTQNL |
| Ga0182038_104168041 | 3300016445 | Soil | MTLQQAKSIARHLGLTLRMVRSGEYRVNFRDGNETTAYYTDNLEDAVKTAI |
| Ga0184620_100596503 | 3300018051 | Groundwater Sediment | MTIQKPMTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGDETTAHYTDNLE |
| Ga0184621_103233761 | 3300018054 | Groundwater Sediment | MTLQEAKSIARHLGLTLRQVRSGAYRVNFRDGNEMTAYYTDNLEDAV |
| Ga0184617_10350952 | 3300018066 | Groundwater Sediment | MTLQEAKSIARHLGCTLRKVRSGDYCVKFPDGNDSLAYYTGSLEDA |
| Ga0066662_105772172 | 3300018468 | Grasslands Soil | MTPQEAKSIARHLGLTLRKVRSGDYRVNFRDGNETTAYYT |
| Ga0190270_132195673 | 3300018469 | Soil | MTLQEAKSIARHLGCTLRKVRSGDYCVKFPDGNDCMAYYTDNLE |
| Ga0210406_105881191 | 3300021168 | Soil | MTLQEAKSIARHLGLTLRKVRSGDYRVSFREGNET |
| Ga0210408_112005981 | 3300021178 | Soil | WTAHVTLQQAKSIARHLGLTLRKVRSGDYRVNFRG |
| Ga0193699_104182672 | 3300021363 | Soil | MTLQEAKSIARHLGCTLRKVRSGDYCVKFPAGNDTTAYYTDNLEDA |
| Ga0210384_108885341 | 3300021432 | Soil | MTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGNETTPYYT |
| Ga0210392_107782361 | 3300021475 | Soil | MTIQKPITLQEAKSIARHLGLTLRQARSGHYRVNFRDGGESAACYAVDLETPLT |
| Ga0126371_101315362 | 3300021560 | Tropical Forest Soil | MTLQEAKSMARHLGLTLREVRSVDYRVNFRDESETTAYYTDNLEDAVTKKWNRQ |
| Ga0126371_106380741 | 3300021560 | Tropical Forest Soil | MDSAMTIQEAKSIARHLGLTLRKVRSGDYRVNFRD |
| Ga0126371_119613212 | 3300021560 | Tropical Forest Soil | MTLQEAKSIARHLGLTLRMVRSGDYRVNFRDGTESTAYYTDNLE |
| Ga0126371_120023891 | 3300021560 | Tropical Forest Soil | MTLQKAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAYYTDN |
| Ga0207710_103413941 | 3300025900 | Switchgrass Rhizosphere | MTLQEAKSIVRHLGLTLRKVRSGDYCVKSRDGTEATPYYT |
| Ga0207699_110384572 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MAMTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGNETTAY |
| Ga0207693_105792271 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLRKAKSIARHLGLTLRLLRSGKYRVNFRDGDETTAYYAD |
| Ga0207693_110706982 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MDSAMTLQEAKSIARHHGLTLRQVRSGNYRVNFRDGNKMTAHYTDNLEDA |
| Ga0207664_114928911 | 3300025929 | Agricultural Soil | MTLQEAKSIARHLGLALRKVRSGDYRVNFRDGNEPAP |
| Ga0207690_107066862 | 3300025932 | Corn Rhizosphere | MTLQEAKSIVRHLGLTLRKVRSGDYCVKSRDGNEAAPYYT |
| Ga0207658_114930311 | 3300025986 | Switchgrass Rhizosphere | VTHQEAKLIARHLGLTLRKVRSGDYRVNFLDADDSTAYYTDNLEDA |
| Ga0209465_105648661 | 3300027874 | Tropical Forest Soil | MTIQKPITLQEAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAYYTDNL |
| Ga0209488_112209401 | 3300027903 | Vadose Zone Soil | MTLQEAKSIARHLGCTLRKVRSGDYCVKFPDGNDTTAYYTD |
| Ga0209382_106618552 | 3300027909 | Populus Rhizosphere | MTLQEAKSIARHLGLSLRRVRSGAYRVKFPDGNETAAYYTNNLE |
| Ga0209382_110483781 | 3300027909 | Populus Rhizosphere | MTLQEAKSIARHLGLTLRQVRSGAYRVNLRDGNEINFVTNRWIRA |
| Ga0209382_119052531 | 3300027909 | Populus Rhizosphere | MTLQEAKSIARHLGLTLRRVRSGDYRVNFPDENEATAYYTDSLED |
| Ga0307295_100836412 | 3300028708 | Soil | MTLQEAKSIARHLGCTLRKVRSGDYCVKFPAGNNSMAYYTDNL |
| Ga0307285_102191071 | 3300028712 | Soil | MTIQKPTTLREAKSIARHLRLTLRKVRSGHYRVNFRDGNETTAYY |
| Ga0307318_101488541 | 3300028744 | Soil | MTLQEAKSIARHLGCTLRKVRSGDYCVKFPDGNDSTA |
| Ga0307280_102893441 | 3300028768 | Soil | MAIQKPMTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGDETTAYYTDNLE |
| Ga0307282_102077242 | 3300028784 | Soil | VTLQEAKSIARHLGLTLRKVRSGEYRVNFPDADDS |
| Ga0307299_100089531 | 3300028793 | Soil | MTLQEAKSIARHLGCTLRKVRSGDYCVKFPEGNDSTAYYTDNLEDAVNVA |
| Ga0307287_102279531 | 3300028796 | Soil | MTLQEAKSIARRLGLTLRQVRSGDYRVNFRDGNETTAYYTDNLEDVVT |
| Ga0307302_105710771 | 3300028814 | Soil | VTLQEAKSIARHLGLTLRKVRSGEYRVNFPDADDSTAYYTDDLEDA |
| Ga0307296_107247031 | 3300028819 | Soil | VTLQEAKSIARHLGLTLRKVRSGEYRVNFPDADDSTAYYTDDLED |
| Ga0307312_105729812 | 3300028828 | Soil | MTLQEAKSIARHLGCTLRKVRSGDYCVKFPEGNDSTAYYTDNLEDAVN |
| Ga0307308_103865421 | 3300028884 | Soil | MTLQEAKSIARHLGCTLRKVRSGDYCVKFPDGNDSTAYY |
| Ga0307500_102144292 | 3300031198 | Soil | MTIQKPITLQEAKSIARHLGLTLRLLRSGKYRVNFRDGDEST |
| Ga0307497_105682082 | 3300031226 | Soil | MTLRKAKSIARHLRLTLRQVCSGDYRVNFRDGNETTACYTDSLEDAI |
| Ga0307497_105932841 | 3300031226 | Soil | MTIQKPMTLQEAKSIARHLGLTLRKVRSGDYRVNFRD |
| Ga0170824_1279823631 | 3300031231 | Forest Soil | MTIHKPITLQEAKSIARHFGLTLRKVRSGHYRVNFRDGDEGT |
| Ga0170818_1052886931 | 3300031474 | Forest Soil | ARHLGLTLRKVRSGDYRVNFRDGNEMTAYHTDNFEDAVNTAAD |
| Ga0318516_100223044 | 3300031543 | Soil | MDSAMTLQQAKSIARHLGLTLRKVRSGDYRVNFRDGNEMTA |
| Ga0318516_101405622 | 3300031543 | Soil | MTLQEAKSIARHLGLTLRMVRSGDYRVNFRDGNETTAYYTDNLQDAVPPCHWRGR |
| Ga0318516_104008882 | 3300031543 | Soil | MTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGKEPAPY |
| Ga0318516_107010622 | 3300031543 | Soil | MTLQEAKSIARHLGLTLRTVRSGKYRVNFRDGNETTAYY |
| Ga0318541_106752582 | 3300031545 | Soil | MTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGNETSAYYTD |
| Ga0318541_107167122 | 3300031545 | Soil | MDSAMTLQEAKSIARHLGLTLRQVRSGDYRVNGNETTAYYTDNLEDAV |
| Ga0318538_102448252 | 3300031546 | Soil | MTLQEAKSIARHLGLTLRKVRSGDFRVSCRDGDETTAYYTQNL |
| Ga0318538_104715573 | 3300031546 | Soil | MTLQEAKSIARHLGLTLRQVRSGAYRVNFRDGNENTAYYT |
| Ga0318571_103722702 | 3300031549 | Soil | EPPMDSAMTLQQAKSIARHLGLTLRKVRSGDYRVNFRDGNEMTA |
| Ga0318528_100850054 | 3300031561 | Soil | MTLQEAKSIARHLGLTLRKVRSGDYRVSCRDGDESTAYY |
| Ga0318528_101147671 | 3300031561 | Soil | MTIQKPTLQEAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAY |
| Ga0318573_100474454 | 3300031564 | Soil | MTIQKPITLQEAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAYYTDKLE |
| Ga0318515_102614574 | 3300031572 | Soil | MTLPKAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAYYTDKLED |
| Ga0318515_105221431 | 3300031572 | Soil | MTLQKAKSIARHLGLTLRQVRSGNYRVNFRDGNETTAYY |
| Ga0310915_100878802 | 3300031573 | Soil | MTLQQAKSIARHLGLTLRKVRSGDYRVNFRDGNETTACYTDSLEDAVICRGEMI |
| Ga0310915_107434282 | 3300031573 | Soil | MTLQQAKSIARHLGLTLRMVRSGDYRVNFRDGNETTAYY |
| Ga0310915_107704511 | 3300031573 | Soil | MTLQEAKSIARHLGLTLRKVRSGDYRVSCRDGDETTAYYTQNLEDAV |
| Ga0318555_104141672 | 3300031640 | Soil | MTLQKAKSIARHLGLTLRKVCSGDYRVNFRDGNETTAYYTDNLED |
| Ga0318542_103524871 | 3300031668 | Soil | MTLQEAKTLARHLGLTLRKVRSGDYRVNFRDGNETSAYY |
| Ga0318574_104270512 | 3300031680 | Soil | MTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGKEPAPYYTD |
| Ga0318574_106018761 | 3300031680 | Soil | MTLQKAKSIARHLGLTLRQLRSGNYRVNFRDGNETT |
| Ga0318574_107280251 | 3300031680 | Soil | MTLQEAKSIARHLGLTLRMVRSGDYRVNFRDGNETTAYYTDNLEDAVNT |
| Ga0318560_106953761 | 3300031682 | Soil | MTLQEAKSIARHLRLALRVVRSGDYRVNFRDGNETTAYY |
| Ga0318496_103772891 | 3300031713 | Soil | MTLQEAKSIARHLGLTLRKVRSGDYRVNFRDRNEPAP |
| Ga0318496_107066111 | 3300031713 | Soil | MTLHKAKSIARHLGLTLRQLRSGNYRVNFRDGTETTAYYTDN |
| Ga0306917_102107823 | 3300031719 | Soil | MTLQEAKSIARHLGLTLRTVRSGKYRVNFRDGNETTAY |
| Ga0306917_106874541 | 3300031719 | Soil | MTLQQAKSIARHLGLTLRKVRSGDYRVNFRDGNETTAYYTDD |
| Ga0306917_107837352 | 3300031719 | Soil | MDSAMTLQEAKSIARHLRLTLRKVRSGDYRVNFRDGNEMTA |
| Ga0306917_111142891 | 3300031719 | Soil | MTIQKPMTLQEAKSIARHLGLTLRQLRSGNYRVNFRDGNENTA |
| Ga0318493_100108541 | 3300031723 | Soil | MDSAMTLQQAKSIARHLGLTLRKVRSGDYRVNFRDGNEMT |
| Ga0318493_108108761 | 3300031723 | Soil | MTLQEAKSIARHLGFTLRKVRSGDYRVTFRDGDETGSY |
| Ga0318500_107403032 | 3300031724 | Soil | MTLQEAKSIARHLGLTLRKVRSGDFRVSCRDGDETTAYYTQNLEDAV |
| Ga0318501_106104263 | 3300031736 | Soil | MTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGNETTAYYADNLEDAVHT |
| Ga0306918_101252661 | 3300031744 | Soil | MTIQKPTLQKAKSIARHLGLTLRQLRSGNYRVNFR |
| Ga0306918_109583242 | 3300031744 | Soil | MTIQKPIKLQKAKSIARHLGLTLRQLRSGNYRVNFRDGNETTA |
| Ga0318502_101130256 | 3300031747 | Soil | MTLPKAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAYY |
| Ga0318537_100325381 | 3300031763 | Soil | MTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGNETSAYY |
| Ga0318537_103136031 | 3300031763 | Soil | MTLQEAKSIARHLGLTLRKVRSGDYRVSCRDGDETTAYYTQTLED |
| Ga0318537_103753711 | 3300031763 | Soil | MDSAMTLGEAKSIARHLGLTLRKVRSGDYRVNFRDGNENTAYYTDSLEH |
| Ga0318535_105405711 | 3300031764 | Soil | MTLQEAKSIARHLGLTLRQVRSGAYRVNFRDGNENT |
| Ga0318535_105605921 | 3300031764 | Soil | MTIQKPITLQEAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAYYTD |
| Ga0318554_104429412 | 3300031765 | Soil | MDSAMTLGEAKSIARHLGLTLRKVRSGDYRVNFRDGNEN |
| Ga0318509_101710611 | 3300031768 | Soil | MTLQEAKSIARHLGLTLRKVRSGDYRVSCRDGDETTAYYTQNLED |
| Ga0318509_104249411 | 3300031768 | Soil | MTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGNETTAYY |
| Ga0318521_108579671 | 3300031770 | Soil | MTLQEAKSIARHLGLTLRMVRSGDYRVNFRDGNETTAYYTDNLEDAVN |
| Ga0318546_101687301 | 3300031771 | Soil | MTLQEAKSIARHLGLTLRTVRSGDFRVNFRDGNETTAYYTDNL |
| Ga0318546_111059831 | 3300031771 | Soil | MTLQEAKSIARHLGLTLRKVRSGYYRVNFRDGNETSAYY |
| Ga0318546_111499411 | 3300031771 | Soil | MGLEELMTLQKTKLIARHLGLTLRQLRSGNYRVNFRDGNETTPYY |
| Ga0318543_100691271 | 3300031777 | Soil | MTLQEAKSIARHLGLTLRKVRSGDYRVSCRDGDETTAYYTQNLE |
| Ga0318543_102588851 | 3300031777 | Soil | MTLQEAKSIARHLGLTLRKVRSGDFRVSCRDGDETTAYY |
| Ga0318498_103575362 | 3300031778 | Soil | MDSAMTLQQAKSIARHLGLTLRKVRSGDYRVNFRDGNEMTAYYTDNLEDAVKP |
| Ga0318498_105227151 | 3300031778 | Soil | MTLQEAKSIARRLGLTLRKVRSGEYRVNFRDGNETTAYY |
| Ga0318547_101632641 | 3300031781 | Soil | MGLEELMTLQKTKLIARHLGLTLRQLRSGNYRVNFRDGNETTAYYTDKLEDALMPWL |
| Ga0318547_106819731 | 3300031781 | Soil | MTLQEAKSIARHLGLTLRKVRSGDYRVSCRDGDDTTAYYTQNLED |
| Ga0318547_109601701 | 3300031781 | Soil | MTLQKAKSIARHLGLTLRMVRSGEYRVNFRDGNETTAYY |
| Ga0318529_103648081 | 3300031792 | Soil | MTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGNETTAYYTDNLEDA |
| Ga0318548_103192421 | 3300031793 | Soil | MTLQEAKSIARHLGLTLRKVRSGEYRVNFRDGNETTAYYT |
| Ga0318503_100289592 | 3300031794 | Soil | MTLQEAKSIARHLGLTLRKVRSGDFRVSCRDGDETTAYYTQ |
| Ga0318503_101507011 | 3300031794 | Soil | MTLQKAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAYYTDK |
| Ga0318503_102490531 | 3300031794 | Soil | MRLQKAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAYYTDKLEDAVNA |
| Ga0318550_100929541 | 3300031797 | Soil | MTLQQAKSIARHLGLTLRIVHSGAYRVNFRDGNETTASYTDN |
| Ga0318523_101595523 | 3300031798 | Soil | MTLQEAKSIARHLGLTLRLLRSGNYRVNFRDGNETTAYYTDNLE |
| Ga0318497_103754811 | 3300031805 | Soil | MTIQKPITLQEAKSIARHLGLTLRQLRSGNYRVNFRDGN |
| Ga0318567_108276322 | 3300031821 | Soil | MTLQEAKSIARHLGLTLRQVRSSAYRVNFRDGNETTAYYTDLLE |
| Ga0310917_100466451 | 3300031833 | Soil | MTLQEAKSIARHLGLTLRKVRSGDYRVSCRDGDESTAYYTQNL |
| Ga0310917_107452191 | 3300031833 | Soil | MTTYKPMTLQEAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAYYTDNLE |
| Ga0318511_102132602 | 3300031845 | Soil | MRLQKAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAYYTD |
| Ga0318527_102564341 | 3300031859 | Soil | MTLREAKSIARHLGLTLRKVRSGDYRGNFRDGNEAT |
| Ga0318495_105027201 | 3300031860 | Soil | MTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGNEPAPYY |
| Ga0306919_100890793 | 3300031879 | Soil | MTLQQAKSIARHLGLTLRKVRSGDYRVNFRDGNETTACYTDSLEDAVICR |
| Ga0306919_101708851 | 3300031879 | Soil | MTLQEAKSIARHLGLTLRKVRSGDYRVSCRDGDESTAYYTQNLEDAV |
| Ga0306919_115105471 | 3300031879 | Soil | MTIQKPIKLQKAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAYYTDNLEDA |
| Ga0318544_101274361 | 3300031880 | Soil | MTLQEAKSIARRLGLTLRKVRSGDYRVNFRDGNETSAYY |
| Ga0306925_107412291 | 3300031890 | Soil | MTIQKLITLQEAKSITRHLGLTLRQLRSGNYRVNFRDGNET |
| Ga0306925_108547631 | 3300031890 | Soil | MTIQKPTLQEAKSIARHLGLTLRQLRSGNYRVNFRDG |
| Ga0306925_112899932 | 3300031890 | Soil | MTIHKPMTLQEAKSIARHLGLILRKVRSGDYRVSSRNGDESTACYAVGVE |
| Ga0306925_114882473 | 3300031890 | Soil | MTLQEAKSIARHLGLTLRKVRSGDYRVSCRDGDETTA |
| Ga0306925_115902533 | 3300031890 | Soil | MDSPMTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGNETTAYYTDDLE |
| Ga0318536_100826912 | 3300031893 | Soil | MTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGNET |
| Ga0318522_101289532 | 3300031894 | Soil | MTLQQAKSIARHLGLTLRKVRSGDYRVNFRDGNETTASY |
| Ga0318520_101275872 | 3300031897 | Soil | MTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGNEPAPY |
| Ga0306923_114974913 | 3300031910 | Soil | MTLQEAKSIARHIGLILRTVRSGNYRVNFRDGNETTAYYTDKLE |
| Ga0306923_121941652 | 3300031910 | Soil | MTLQEAKSIARVLGLTLRQMRSGDYRVNFRDGGETAACYTDNLEDVVN |
| Ga0306921_101854881 | 3300031912 | Soil | MTLQEAKSIARHLGLTLRMVRSGEYRVNFRDGDEP |
| Ga0306921_109357002 | 3300031912 | Soil | QQAKSIARHLGLTLRMVRSGEYRANFRDGNETTAY |
| Ga0306921_116847501 | 3300031912 | Soil | MDSAMTLQEAKSIARHLGLTLRQVRSGDYRVNGNETTAYYTDNLE |
| Ga0306921_120095281 | 3300031912 | Soil | MTLLEAKSITHHLGLTRHLLRSGKYRVNLRDGNECTAY |
| Ga0306921_122923241 | 3300031912 | Soil | MTTYKPMTLQEAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAYY |
| Ga0310912_100408196 | 3300031941 | Soil | MTLQEAKSIARHLGLTLRMVRSGEYRVNFRDGDEPTAYYT |
| Ga0310912_102331371 | 3300031941 | Soil | MTIQKPIKLQKAKSIARHLGLTLRQLRSGNYRVNFRD |
| Ga0310912_105276293 | 3300031941 | Soil | TLQEAKSIARHLGLTLRQLRSGNYRVNFRDGNENTA |
| Ga0310916_101881591 | 3300031942 | Soil | MTLQEAKSIARHLGLTLRKVRSGEYRVNFRDGNETTAYYTDNLEDAVN |
| Ga0310916_102892051 | 3300031942 | Soil | MTIQKPMTLQEAKSIARHLGLTLRHLRSGNYRVNFRDGNETTAYYTDKLEDA |
| Ga0310916_105042731 | 3300031942 | Soil | PMTIQKPIKLQKAKSIARHLGLTLRQVRFGTYRVNFRDWK |
| Ga0310916_107565523 | 3300031942 | Soil | MTLQQAKSIARHLRLTLRKLRSGDYRVNFRDGNETTAYYTDNLVDAV |
| Ga0310916_110972241 | 3300031942 | Soil | MNGVAMTLQEAKSIARHLGLTLRQLRSGKYRVNFRDGN |
| Ga0310913_100856773 | 3300031945 | Soil | MTLQKAKSIARHLGLTLRQLCSGDYRVNFRDGNETTAYYT |
| Ga0310913_108929301 | 3300031945 | Soil | KPTLQEAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAY |
| Ga0310910_106332731 | 3300031946 | Soil | MDSAMTLQEAKSIARHLGLTLRQVRSGDYRVNGNETTAYYT |
| Ga0310909_103176812 | 3300031947 | Soil | MDSAMTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGNEMTAYYTDNLED |
| Ga0306926_102650141 | 3300031954 | Soil | MTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGNETSAYYTDNLEDAVNT |
| Ga0306926_103506802 | 3300031954 | Soil | MTLQEAKSIARHLGLTLRQLRSGNYRVNFRDGNENTA |
| Ga0306926_116726591 | 3300031954 | Soil | MTIQKPTLQEAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAYYTDKLEDA |
| Ga0306926_122796393 | 3300031954 | Soil | MTLQQAKSIARHLRLTLRMVRSGDYRVNFRDGNETTAYYT |
| Ga0306926_124855442 | 3300031954 | Soil | MTTYKPMTLQEAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAYYTDNLEDA |
| Ga0306926_127898672 | 3300031954 | Soil | MTLQEAKSIARVLGLTLRQMRSGDYRVNFRDGGETAACYTDNL |
| Ga0318531_102106621 | 3300031981 | Soil | MTLQEAKSIARHLGLTLRKVRSGEYRVNFRDGNETTAYYTDKLEYAV |
| Ga0318531_104941411 | 3300031981 | Soil | MTLHKAKSIARHLGLTLRQLRSGNYRVNFRDGTETTAYYTDNLED |
| Ga0318531_105883061 | 3300031981 | Soil | MTLQQAKSIARHLGLTLRKVRSGDYRVNFRDGNETTACYTDSLK |
| Ga0310911_102277753 | 3300032035 | Soil | MTLQEAKSIARHLGLTLRKVRSGEYRVNFRDGNETTAYY |
| Ga0318559_100619863 | 3300032039 | Soil | MTLQEAKSIARHLGLTLRMVRSGDYRVNFRDGNETTAYYTDN |
| Ga0318549_100426361 | 3300032041 | Soil | MDSVMTLQQAKSIARHLRLTLRKVRSGDYRVNFRDGNETTAYY |
| Ga0318545_100022519 | 3300032042 | Soil | MTLQEAKSIARHLGLTLRKVRSGDFRVSCRDGDETTAYYT |
| Ga0318545_102277581 | 3300032042 | Soil | MTLQEAKSIARHLGLTLRKVRSGDFRVSCRDGDETTAYYTQNLED |
| Ga0318545_102514921 | 3300032042 | Soil | MTLQQAKSIARHLGLTLRMVRSGEYRVNFRDGNETTAYYTDN |
| Ga0318556_100879951 | 3300032043 | Soil | MTLQQAKSIARHLRLTLRMVRSGDYRVNFRDGNETTAYYTDNLDDAVKTA |
| Ga0318556_101991741 | 3300032043 | Soil | MTIQKPITLQEAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAYYTDNLED |
| Ga0318558_103165901 | 3300032044 | Soil | MTLQEAKSIARHLGLTLRQVRSGAYRVNFRDGNEN |
| Ga0318575_102495482 | 3300032055 | Soil | MGLEELMTLQKTKLIARHLGLTLRQLRSGNYRVNFRDGNET |
| Ga0318533_109993122 | 3300032059 | Soil | MTLQKAKSIARYLGLTLRELCSGNYRVNFRDGNETTAYY |
| Ga0318510_101159452 | 3300032064 | Soil | MTLQEAKSIARHLGLTVRKVRSGDYRVSFRDGNGTTAYYTD |
| Ga0318513_101795721 | 3300032065 | Soil | MTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGDETTVHY |
| Ga0318513_104271131 | 3300032065 | Soil | MTLQEAKSIARHLGLTLRKMRSGAYRVNFRDGNETTAYYT |
| Ga0318553_100543811 | 3300032068 | Soil | AGLPMDSAMTLQQAKSIARHLGLTLRKVRSGDYRVNFRDGNEMTA |
| Ga0306924_111532312 | 3300032076 | Soil | MDSAMTLQQAKSIARHLGLTLRKVRSGDYRVNFRDGNEATAYY |
| Ga0306924_123837831 | 3300032076 | Soil | MTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGNETTAGYTDNLE |
| Ga0318577_100827791 | 3300032091 | Soil | MDSAMTLQQAKSIARHLGLTLRKVRSGDYRVNFRDGNE |
| Ga0318577_100971351 | 3300032091 | Soil | MTLQEAKSIARHLGLTLRKVRSGDYRVSCRDGDQTTAYYTQNLEDAV |
| Ga0318577_103858113 | 3300032091 | Soil | MTLQEAKSIARHLGLTLRKVRSGEYRVNFRDGNETTAYYTDN |
| Ga0318577_104777942 | 3300032091 | Soil | MTLQKAKSIARHLGLTLRKVCSGDYRVNFRDGNETTAYYTD |
| Ga0318577_105384411 | 3300032091 | Soil | MDSAMTLQEAKSIARHLGLTLRQVRSGDYRVNGNETT |
| Ga0318540_100488531 | 3300032094 | Soil | MNFHEAMTLQEAKSIARHLGFTLRQLRSGKYRVNFRDGN |
| Ga0306920_1006158281 | 3300032261 | Soil | MDSAMTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGNQM |
| Ga0306920_1016248734 | 3300032261 | Soil | MDSAVTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGNEMTP |
| Ga0306920_1036575581 | 3300032261 | Soil | MTLQQAKSIARHLGLTLRMVRSGDYRVNFRDGNEATA |
| Ga0306920_1039846692 | 3300032261 | Soil | MTLLEAKSITHHLGLTLHLLRSGKYRVNLRDGNEC |
| Ga0306920_1039972581 | 3300032261 | Soil | MTLQEAKSIARHLGLTLRMVRSGDYRVNFRDGNETTAYYTDNLEDA |
| Ga0310914_101956642 | 3300033289 | Soil | MTLQQAKSIARHLGLTLRMVRSGEYRANFRDGNETTAY |
| Ga0310914_102150951 | 3300033289 | Soil | TLQEAKSIARHLGLTLRMVRSGDYRVNFRDGNETTAYYTDNLQDAVPPCHWRGR |
| Ga0310914_107910101 | 3300033289 | Soil | MRLQKAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAYYTDKLEDA |
| Ga0310914_111675103 | 3300033289 | Soil | MTIQKPITLQEAKSIARHLGLTLRQVRFGNYRVNF |
| Ga0318519_102455751 | 3300033290 | Soil | MTLQKAKSIARHLGLTLREVCSGDYRVNFRDGNESTAYYTDKF |
| Ga0318519_102878021 | 3300033290 | Soil | MDSAMTLQQAKSIARHLGLTLRKVRSGDYRVNFRDGNEMTAYYTDN |
| Ga0318519_105319011 | 3300033290 | Soil | MNFHEAMTLQQAKSVARHLRFTLRRLRSGKYRVNFRDGNESTAYY |
| Ga0364929_0150891_620_754 | 3300034149 | Sediment | MTLQEAKSIVRHLGLTLRKVRSGDYCVKFRDGNEATPYYTDDLED |
| ⦗Top⦘ |