NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F009109

Metagenome / Metatranscriptome Family F009109

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F009109
Family Type Metagenome / Metatranscriptome
Number of Sequences 323
Average Sequence Length 43 residues
Representative Sequence MTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGNETTAYY
Number of Associated Samples 183
Number of Associated Scaffolds 323

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 51.70 %
% of genes near scaffold ends (potentially truncated) 93.81 %
% of genes from short scaffolds (< 2000 bps) 94.43 %
Associated GOLD sequencing projects 168
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.762 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(35.294 % of family members)
Environment Ontology (ENVO) Unclassified
(54.180 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(47.988 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 16.42%    β-sheet: 14.93%    Coil/Unstructured: 68.66%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 323 Family Scaffolds
PF12625Arabinose_bd 14.24
PF12833HTH_18 3.72
PF04392ABC_sub_bind 2.79
PF13676TIR_2 1.55
PF14020DUF4236 1.24
PF02627CMD 0.93
PF00589Phage_integrase 0.62
PF00486Trans_reg_C 0.31
PF13924Lipocalin_5 0.31
PF07045DUF1330 0.31
PF01494FAD_binding_3 0.31
PF12770CHAT 0.31
PF01315Ald_Xan_dh_C 0.31
PF10881DUF2726 0.31
PF04241DUF423 0.31
PF00999Na_H_Exchanger 0.31
PF13649Methyltransf_25 0.31
PF09084NMT1 0.31
PF04542Sigma70_r2 0.31
PF14373Imm_superinfect 0.31
PF06411HdeA 0.31
PF08281Sigma70_r4_2 0.31
PF08239SH3_3 0.31
PF03795YCII 0.31
PF00149Metallophos 0.31
PF00196GerE 0.31
PF00072Response_reg 0.31

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 323 Family Scaffolds
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 2.79
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 0.93
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 0.93
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 0.62
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.31
COG5470Uncharacterized conserved protein, DUF1330 familyFunction unknown [S] 0.31
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.31
COG4651Predicted Kef-type K+ transport protein, K+/H+ antiporter domainInorganic ion transport and metabolism [P] 0.31
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.31
COG3263NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domainsEnergy production and conversion [C] 0.31
COG3004Na+/H+ antiporter NhaAEnergy production and conversion [C] 0.31
COG2363Uncharacterized membrane protein YgdD, TMEM256/DUF423 familyFunction unknown [S] 0.31
COG2350YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHisSecondary metabolites biosynthesis, transport and catabolism [Q] 0.31
COG0025NhaP-type Na+/H+ or K+/H+ antiporterInorganic ion transport and metabolism [P] 0.31
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.31
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.31
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 0.31
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 0.31
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.31
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.31
COG0475Kef-type K+ transport system, membrane component KefBInorganic ion transport and metabolism [P] 0.31


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.76 %
UnclassifiedrootN/A1.24 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000597|AF_2010_repII_A1DRAFT_10051312All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1071Open in IMG/M
3300000597|AF_2010_repII_A1DRAFT_10160965All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium537Open in IMG/M
3300000597|AF_2010_repII_A1DRAFT_10164938All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium529Open in IMG/M
3300000793|AF_2010_repII_A001DRAFT_10072031All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium746Open in IMG/M
3300000955|JGI1027J12803_100528340All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium683Open in IMG/M
3300002910|JGI25615J43890_1083458All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium560Open in IMG/M
3300004629|Ga0008092_11278310All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1784Open in IMG/M
3300004633|Ga0066395_10209200All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens1026Open in IMG/M
3300005167|Ga0066672_10527458All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium765Open in IMG/M
3300005332|Ga0066388_104559792All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium705Open in IMG/M
3300005332|Ga0066388_105324543All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium652Open in IMG/M
3300005332|Ga0066388_105801863All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium624Open in IMG/M
3300005332|Ga0066388_106810735All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium575Open in IMG/M
3300005332|Ga0066388_108007812All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium528Open in IMG/M
3300005337|Ga0070682_100966060All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium705Open in IMG/M
3300005356|Ga0070674_100446588All Organisms → cellular organisms → Bacteria → Proteobacteria1066Open in IMG/M
3300005356|Ga0070674_102087925All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium517Open in IMG/M
3300005536|Ga0070697_100176010All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1812Open in IMG/M
3300005713|Ga0066905_100366749All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1156Open in IMG/M
3300005713|Ga0066905_100453052All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1055Open in IMG/M
3300005713|Ga0066905_100663729All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium890Open in IMG/M
3300005713|Ga0066905_102135594All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium521Open in IMG/M
3300005713|Ga0066905_102235319All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium510Open in IMG/M
3300005764|Ga0066903_100412507All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2230Open in IMG/M
3300005764|Ga0066903_100653542All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.1839Open in IMG/M
3300005764|Ga0066903_101532121All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1260Open in IMG/M
3300005764|Ga0066903_102502670All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium999Open in IMG/M
3300005764|Ga0066903_104502169All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria743Open in IMG/M
3300005764|Ga0066903_104727337All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium725Open in IMG/M
3300005764|Ga0066903_106106227All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium630Open in IMG/M
3300005764|Ga0066903_106572198All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium605Open in IMG/M
3300005764|Ga0066903_108635812All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium518Open in IMG/M
3300006028|Ga0070717_11696851All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium572Open in IMG/M
3300006038|Ga0075365_10168421All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1529Open in IMG/M
3300006163|Ga0070715_10105034All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1324Open in IMG/M
3300006175|Ga0070712_100898179All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium764Open in IMG/M
3300006176|Ga0070765_102094072All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium529Open in IMG/M
3300006576|Ga0074047_11800261All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium577Open in IMG/M
3300006581|Ga0074048_13342545All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium670Open in IMG/M
3300006791|Ga0066653_10348940All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium750Open in IMG/M
3300006845|Ga0075421_100162541All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2786Open in IMG/M
3300006904|Ga0075424_102697499All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium519Open in IMG/M
3300009100|Ga0075418_11474644All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium738Open in IMG/M
3300009100|Ga0075418_12762188All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium536Open in IMG/M
3300009137|Ga0066709_100656243All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1503Open in IMG/M
3300009148|Ga0105243_12253272All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium582Open in IMG/M
3300009156|Ga0111538_12762076All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium615Open in IMG/M
3300009162|Ga0075423_10571681All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1190Open in IMG/M
3300009177|Ga0105248_11078885All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium907Open in IMG/M
3300009792|Ga0126374_10679364All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium771Open in IMG/M
3300010043|Ga0126380_10414965All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1005Open in IMG/M
3300010043|Ga0126380_10441452All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium980Open in IMG/M
3300010043|Ga0126380_10884514All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria740Open in IMG/M
3300010043|Ga0126380_11393758All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium615Open in IMG/M
3300010046|Ga0126384_10033076All Organisms → cellular organisms → Bacteria → Proteobacteria3448Open in IMG/M
3300010046|Ga0126384_10472297All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1075Open in IMG/M
3300010046|Ga0126384_10944572All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales782Open in IMG/M
3300010046|Ga0126384_11226175All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium693Open in IMG/M
3300010047|Ga0126382_10215616All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1378Open in IMG/M
3300010047|Ga0126382_12427048All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium510Open in IMG/M
3300010048|Ga0126373_11014062All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium895Open in IMG/M
3300010333|Ga0134080_10319868All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium700Open in IMG/M
3300010359|Ga0126376_12285444All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium586Open in IMG/M
3300010360|Ga0126372_11847866All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium648Open in IMG/M
3300010360|Ga0126372_12692081All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium549Open in IMG/M
3300010361|Ga0126378_10232554All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1931Open in IMG/M
3300010361|Ga0126378_12050983All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium652Open in IMG/M
3300010366|Ga0126379_12066967All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300010366|Ga0126379_12626152All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium601Open in IMG/M
3300010366|Ga0126379_13228973All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria546Open in IMG/M
3300010373|Ga0134128_12822339All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium535Open in IMG/M
3300010375|Ga0105239_10936645All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium995Open in IMG/M
3300010376|Ga0126381_104335165All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium549Open in IMG/M
3300010397|Ga0134124_12501550All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium558Open in IMG/M
3300010398|Ga0126383_10712800All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1082Open in IMG/M
3300010398|Ga0126383_10796219All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1028Open in IMG/M
3300010398|Ga0126383_11998672All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium667Open in IMG/M
3300010398|Ga0126383_13211324All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium534Open in IMG/M
3300010403|Ga0134123_12681295All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium566Open in IMG/M
3300010868|Ga0124844_1013801All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2116Open in IMG/M
3300011107|Ga0151490_1764609All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium510Open in IMG/M
3300012201|Ga0137365_10139625All Organisms → cellular organisms → Bacteria1822Open in IMG/M
3300012201|Ga0137365_10307989All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1173Open in IMG/M
3300012201|Ga0137365_10853980All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium665Open in IMG/M
3300012202|Ga0137363_10113536All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2079Open in IMG/M
3300012208|Ga0137376_11374355All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium597Open in IMG/M
3300012211|Ga0137377_10395271All Organisms → cellular organisms → Bacteria1320Open in IMG/M
3300012211|Ga0137377_11358192All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium640Open in IMG/M
3300012232|Ga0137435_1194744All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium622Open in IMG/M
3300012356|Ga0137371_11268528All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium547Open in IMG/M
3300012582|Ga0137358_10350302All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1000Open in IMG/M
3300012683|Ga0137398_10115211All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1709Open in IMG/M
3300012941|Ga0162652_100028641All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium823Open in IMG/M
3300012948|Ga0126375_10733138All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium774Open in IMG/M
3300012961|Ga0164302_11518023All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium553Open in IMG/M
3300012971|Ga0126369_13373395All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium523Open in IMG/M
3300012984|Ga0164309_11841814All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium519Open in IMG/M
3300012986|Ga0164304_11031130Not Available653Open in IMG/M
3300013102|Ga0157371_10309208All Organisms → cellular organisms → Bacteria → Proteobacteria1145Open in IMG/M
3300015371|Ga0132258_12232442All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1374Open in IMG/M
3300015371|Ga0132258_13063391All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1157Open in IMG/M
3300015372|Ga0132256_100352528All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1566Open in IMG/M
3300015372|Ga0132256_101331706Not Available830Open in IMG/M
3300015373|Ga0132257_101422317All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium883Open in IMG/M
3300015374|Ga0132255_100871397All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1345Open in IMG/M
3300016270|Ga0182036_10383062All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1091Open in IMG/M
3300016270|Ga0182036_10636621All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium858Open in IMG/M
3300016270|Ga0182036_11163508All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium640Open in IMG/M
3300016270|Ga0182036_11834394All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium514Open in IMG/M
3300016294|Ga0182041_10130025All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1907Open in IMG/M
3300016294|Ga0182041_11313098All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium662Open in IMG/M
3300016294|Ga0182041_11725597All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium580Open in IMG/M
3300016294|Ga0182041_11827109All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium564Open in IMG/M
3300016319|Ga0182033_10169901All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. E-0251704Open in IMG/M
3300016319|Ga0182033_10186196All Organisms → cellular organisms → Bacteria → Proteobacteria1639Open in IMG/M
3300016319|Ga0182033_10274942All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1379Open in IMG/M
3300016319|Ga0182033_10407848All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1150Open in IMG/M
3300016319|Ga0182033_10838311All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium812Open in IMG/M
3300016319|Ga0182033_10877271All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium794Open in IMG/M
3300016341|Ga0182035_12092469All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium514Open in IMG/M
3300016357|Ga0182032_10138264All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1784Open in IMG/M
3300016357|Ga0182032_10207093All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1497Open in IMG/M
3300016357|Ga0182032_10532640All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium970Open in IMG/M
3300016357|Ga0182032_10983942All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium720Open in IMG/M
3300016357|Ga0182032_11119523All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium676Open in IMG/M
3300016371|Ga0182034_10260200All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1373Open in IMG/M
3300016371|Ga0182034_10377522All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1157Open in IMG/M
3300016371|Ga0182034_11468194All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium597Open in IMG/M
3300016387|Ga0182040_10931893All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium721Open in IMG/M
3300016404|Ga0182037_11411620All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium616Open in IMG/M
3300016404|Ga0182037_11594552All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium580Open in IMG/M
3300016422|Ga0182039_10180973All Organisms → cellular organisms → Bacteria → Proteobacteria1664Open in IMG/M
3300016422|Ga0182039_11279610All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium664Open in IMG/M
3300016422|Ga0182039_12243314All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium504Open in IMG/M
3300016445|Ga0182038_10118062All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1964Open in IMG/M
3300016445|Ga0182038_10416804All Organisms → cellular organisms → Bacteria1129Open in IMG/M
3300018051|Ga0184620_10059650All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1097Open in IMG/M
3300018054|Ga0184621_10323376All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium543Open in IMG/M
3300018066|Ga0184617_1035095All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1211Open in IMG/M
3300018468|Ga0066662_10577217All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1046Open in IMG/M
3300018469|Ga0190270_13219567All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium517Open in IMG/M
3300021168|Ga0210406_10588119All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium870Open in IMG/M
3300021178|Ga0210408_11200598All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium579Open in IMG/M
3300021363|Ga0193699_10418267All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium554Open in IMG/M
3300021432|Ga0210384_10888534All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium791Open in IMG/M
3300021475|Ga0210392_10778236All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium714Open in IMG/M
3300021560|Ga0126371_10131536All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens2542Open in IMG/M
3300021560|Ga0126371_10638074All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1214Open in IMG/M
3300021560|Ga0126371_11961321All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium704Open in IMG/M
3300021560|Ga0126371_12002389All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium697Open in IMG/M
3300025900|Ga0207710_10341394All Organisms → cellular organisms → Bacteria → Proteobacteria762Open in IMG/M
3300025906|Ga0207699_11038457All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium606Open in IMG/M
3300025915|Ga0207693_10579227All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium874Open in IMG/M
3300025915|Ga0207693_11070698All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium613Open in IMG/M
3300025929|Ga0207664_11492891All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium597Open in IMG/M
3300025932|Ga0207690_10706686All Organisms → cellular organisms → Bacteria → Proteobacteria829Open in IMG/M
3300025986|Ga0207658_11493031All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium618Open in IMG/M
3300027874|Ga0209465_10564866All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium565Open in IMG/M
3300027903|Ga0209488_11220940All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium505Open in IMG/M
3300027909|Ga0209382_10661855All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1129Open in IMG/M
3300027909|Ga0209382_11048378All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium846Open in IMG/M
3300027909|Ga0209382_11905253All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium574Open in IMG/M
3300028708|Ga0307295_10083641All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium849Open in IMG/M
3300028712|Ga0307285_10219107All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium536Open in IMG/M
3300028744|Ga0307318_10148854All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium803Open in IMG/M
3300028768|Ga0307280_10289344All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium596Open in IMG/M
3300028784|Ga0307282_10207724All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium937Open in IMG/M
3300028793|Ga0307299_10008953All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3519Open in IMG/M
3300028796|Ga0307287_10227953All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium706Open in IMG/M
3300028814|Ga0307302_10571077All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium562Open in IMG/M
3300028819|Ga0307296_10724703All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium543Open in IMG/M
3300028828|Ga0307312_10572981All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium746Open in IMG/M
3300028884|Ga0307308_10386542All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium670Open in IMG/M
3300031198|Ga0307500_10214429All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium580Open in IMG/M
3300031226|Ga0307497_10568208All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium569Open in IMG/M
3300031226|Ga0307497_10593284All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium559Open in IMG/M
3300031231|Ga0170824_127982363All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium644Open in IMG/M
3300031474|Ga0170818_105288693All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales622Open in IMG/M
3300031543|Ga0318516_10022304All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium3252Open in IMG/M
3300031543|Ga0318516_10140562All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1384Open in IMG/M
3300031543|Ga0318516_10400888All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria790Open in IMG/M
3300031543|Ga0318516_10701062All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium575Open in IMG/M
3300031545|Ga0318541_10675258All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium577Open in IMG/M
3300031545|Ga0318541_10716712All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium559Open in IMG/M
3300031546|Ga0318538_10244825All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium962Open in IMG/M
3300031546|Ga0318538_10471557All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium680Open in IMG/M
3300031549|Ga0318571_10372270All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium552Open in IMG/M
3300031561|Ga0318528_10085005All Organisms → cellular organisms → Bacteria → Proteobacteria1645Open in IMG/M
3300031561|Ga0318528_10114767All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1421Open in IMG/M
3300031564|Ga0318573_10047445All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2084Open in IMG/M
3300031572|Ga0318515_10261457All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium928Open in IMG/M
3300031572|Ga0318515_10522143All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium633Open in IMG/M
3300031573|Ga0310915_10087880All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. E-0252079Open in IMG/M
3300031573|Ga0310915_10743428All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium691Open in IMG/M
3300031573|Ga0310915_10770451All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium677Open in IMG/M
3300031640|Ga0318555_10414167All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium730Open in IMG/M
3300031668|Ga0318542_10352487All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium757Open in IMG/M
3300031680|Ga0318574_10427051All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium775Open in IMG/M
3300031680|Ga0318574_10601876All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium644Open in IMG/M
3300031680|Ga0318574_10728025All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium581Open in IMG/M
3300031682|Ga0318560_10695376All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium550Open in IMG/M
3300031713|Ga0318496_10377289All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria784Open in IMG/M
3300031713|Ga0318496_10706611All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium556Open in IMG/M
3300031719|Ga0306917_10210782All Organisms → cellular organisms → Bacteria → Proteobacteria1475Open in IMG/M
3300031719|Ga0306917_10687454All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium804Open in IMG/M
3300031719|Ga0306917_10783735All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium748Open in IMG/M
3300031719|Ga0306917_11114289All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium614Open in IMG/M
3300031723|Ga0318493_10010854All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei3767Open in IMG/M
3300031723|Ga0318493_10810876All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium528Open in IMG/M
3300031724|Ga0318500_10740303All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium502Open in IMG/M
3300031736|Ga0318501_10610426All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium599Open in IMG/M
3300031744|Ga0306918_10125266All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1867Open in IMG/M
3300031744|Ga0306918_10958324All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium665Open in IMG/M
3300031747|Ga0318502_10113025All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1517Open in IMG/M
3300031763|Ga0318537_10032538All Organisms → cellular organisms → Bacteria1860Open in IMG/M
3300031763|Ga0318537_10313603All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium580Open in IMG/M
3300031763|Ga0318537_10375371All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium524Open in IMG/M
3300031764|Ga0318535_10540571All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium517Open in IMG/M
3300031764|Ga0318535_10560592All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium506Open in IMG/M
3300031765|Ga0318554_10442941All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium736Open in IMG/M
3300031768|Ga0318509_10171061All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1203Open in IMG/M
3300031768|Ga0318509_10424941All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium743Open in IMG/M
3300031770|Ga0318521_10857967All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium554Open in IMG/M
3300031771|Ga0318546_10168730All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1483Open in IMG/M
3300031771|Ga0318546_11105983All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium557Open in IMG/M
3300031771|Ga0318546_11149941All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium545Open in IMG/M
3300031777|Ga0318543_10069127All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1476Open in IMG/M
3300031777|Ga0318543_10258885All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium776Open in IMG/M
3300031778|Ga0318498_10357536All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium651Open in IMG/M
3300031778|Ga0318498_10522715All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium521Open in IMG/M
3300031781|Ga0318547_10163264All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1316Open in IMG/M
3300031781|Ga0318547_10681973All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium638Open in IMG/M
3300031781|Ga0318547_10960170All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium534Open in IMG/M
3300031792|Ga0318529_10364808All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium672Open in IMG/M
3300031793|Ga0318548_10319242All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium763Open in IMG/M
3300031794|Ga0318503_10028959All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1613Open in IMG/M
3300031794|Ga0318503_10150701All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium750Open in IMG/M
3300031794|Ga0318503_10249053All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium576Open in IMG/M
3300031797|Ga0318550_10092954All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1414Open in IMG/M
3300031798|Ga0318523_10159552All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1123Open in IMG/M
3300031805|Ga0318497_10375481All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium795Open in IMG/M
3300031821|Ga0318567_10827632All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium524Open in IMG/M
3300031833|Ga0310917_10046645All Organisms → cellular organisms → Bacteria → Proteobacteria2643Open in IMG/M
3300031833|Ga0310917_10745219All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium662Open in IMG/M
3300031845|Ga0318511_10213260All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium860Open in IMG/M
3300031859|Ga0318527_10256434All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium743Open in IMG/M
3300031860|Ga0318495_10502720All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium529Open in IMG/M
3300031879|Ga0306919_10089079All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. E-0252146Open in IMG/M
3300031879|Ga0306919_10170885All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1599Open in IMG/M
3300031879|Ga0306919_11510547All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium505Open in IMG/M
3300031880|Ga0318544_10127436All Organisms → cellular organisms → Bacteria969Open in IMG/M
3300031890|Ga0306925_10741229All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1024Open in IMG/M
3300031890|Ga0306925_10854763All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium939Open in IMG/M
3300031890|Ga0306925_11289993All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium726Open in IMG/M
3300031890|Ga0306925_11488247All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium663Open in IMG/M
3300031890|Ga0306925_11590253All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium636Open in IMG/M
3300031893|Ga0318536_10082691All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1594Open in IMG/M
3300031894|Ga0318522_10128953All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium948Open in IMG/M
3300031897|Ga0318520_10127587All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1455Open in IMG/M
3300031910|Ga0306923_11497491All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium706Open in IMG/M
3300031910|Ga0306923_12194165All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium554Open in IMG/M
3300031912|Ga0306921_10185488All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2438Open in IMG/M
3300031912|Ga0306921_10935700All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum982Open in IMG/M
3300031912|Ga0306921_11684750All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium686Open in IMG/M
3300031912|Ga0306921_12009528Not Available615Open in IMG/M
3300031912|Ga0306921_12292324All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium566Open in IMG/M
3300031941|Ga0310912_10040819All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3217Open in IMG/M
3300031941|Ga0310912_10233137All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1413Open in IMG/M
3300031941|Ga0310912_10527629All Organisms → cellular organisms → Bacteria920Open in IMG/M
3300031942|Ga0310916_10188159All Organisms → cellular organisms → Bacteria1722Open in IMG/M
3300031942|Ga0310916_10289205All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1386Open in IMG/M
3300031942|Ga0310916_10504273All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1031Open in IMG/M
3300031942|Ga0310916_10756552All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria820Open in IMG/M
3300031942|Ga0310916_11097224All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium661Open in IMG/M
3300031945|Ga0310913_10085677All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2109Open in IMG/M
3300031945|Ga0310913_10892930All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium625Open in IMG/M
3300031946|Ga0310910_10633273All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium847Open in IMG/M
3300031947|Ga0310909_10317681All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1306Open in IMG/M
3300031954|Ga0306926_10265014All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2128Open in IMG/M
3300031954|Ga0306926_10350680All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1824Open in IMG/M
3300031954|Ga0306926_11672659All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium727Open in IMG/M
3300031954|Ga0306926_12279639All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium600Open in IMG/M
3300031954|Ga0306926_12485544All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium568Open in IMG/M
3300031954|Ga0306926_12789867All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium528Open in IMG/M
3300031981|Ga0318531_10210662All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium876Open in IMG/M
3300031981|Ga0318531_10494141All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium554Open in IMG/M
3300031981|Ga0318531_10588306All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium504Open in IMG/M
3300032035|Ga0310911_10227775All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1064Open in IMG/M
3300032039|Ga0318559_10061986All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1592Open in IMG/M
3300032041|Ga0318549_10042636All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1845Open in IMG/M
3300032042|Ga0318545_10002251All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales5139Open in IMG/M
3300032042|Ga0318545_10227758All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium668Open in IMG/M
3300032042|Ga0318545_10251492All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium634Open in IMG/M
3300032043|Ga0318556_10087995All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1559Open in IMG/M
3300032043|Ga0318556_10199174All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1041Open in IMG/M
3300032044|Ga0318558_10316590All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium772Open in IMG/M
3300032055|Ga0318575_10249548All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium895Open in IMG/M
3300032059|Ga0318533_10999312All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium613Open in IMG/M
3300032064|Ga0318510_10115945All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1033Open in IMG/M
3300032065|Ga0318513_10179572All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1016Open in IMG/M
3300032065|Ga0318513_10427113All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium647Open in IMG/M
3300032068|Ga0318553_10054381All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1978Open in IMG/M
3300032076|Ga0306924_11153231All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium841Open in IMG/M
3300032076|Ga0306924_12383783All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium534Open in IMG/M
3300032091|Ga0318577_10082779All Organisms → cellular organisms → Bacteria1486Open in IMG/M
3300032091|Ga0318577_10097135All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1376Open in IMG/M
3300032091|Ga0318577_10385811All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium669Open in IMG/M
3300032091|Ga0318577_10477794All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium594Open in IMG/M
3300032091|Ga0318577_10538441All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium556Open in IMG/M
3300032094|Ga0318540_10048853All Organisms → cellular organisms → Bacteria1894Open in IMG/M
3300032261|Ga0306920_100615828All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1605Open in IMG/M
3300032261|Ga0306920_101624873All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium918Open in IMG/M
3300032261|Ga0306920_103657558All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium565Open in IMG/M
3300032261|Ga0306920_103984669All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales536Open in IMG/M
3300032261|Ga0306920_103997258All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium535Open in IMG/M
3300033289|Ga0310914_10195664All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1804Open in IMG/M
3300033289|Ga0310914_10215095All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1719Open in IMG/M
3300033289|Ga0310914_10791010All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium846Open in IMG/M
3300033289|Ga0310914_11167510Not Available671Open in IMG/M
3300033290|Ga0318519_10245575All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1034Open in IMG/M
3300033290|Ga0318519_10287802All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium959Open in IMG/M
3300033290|Ga0318519_10531901All Organisms → cellular organisms → Bacteria → Proteobacteria710Open in IMG/M
3300034149|Ga0364929_0150891All Organisms → cellular organisms → Bacteria → Proteobacteria754Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil35.29%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil20.12%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil9.60%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil6.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.88%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.41%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.79%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.17%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.86%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.24%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.93%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.93%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.62%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.62%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.62%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.31%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.31%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.31%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.31%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.31%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.31%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.31%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.31%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.31%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.31%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.31%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.31%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.31%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.31%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000597Forest soil microbial communities from Amazon forest - 2010 replicate II A1EnvironmentalOpen in IMG/M
3300000793Forest soil microbial communities from Amazon forest - 2010 replicate II A001EnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300002910Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cmEnvironmentalOpen in IMG/M
3300004629Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A01 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006038Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5Host-AssociatedOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006576Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006581Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300010868Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction)EnvironmentalOpen in IMG/M
3300011107Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012232Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2EnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012941Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018066Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028708Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152EnvironmentalOpen in IMG/M
3300028712Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139EnvironmentalOpen in IMG/M
3300028744Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300031198Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_SEnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032042Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300034149Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
AF_2010_repII_A1DRAFT_1005131223300000597Forest SoilMTLQKAKSIARHLGLTLRQLDSGNYRVNFRDGNETTAYYTGKLE
AF_2010_repII_A1DRAFT_1016096513300000597Forest SoilMTLQKAKSIARHLGLTLREVCSGDYRVNFRDGNETTAYYTDKLEDAVNTA
AF_2010_repII_A1DRAFT_1016493813300000597Forest SoilMTLQEAKSVARHLGLTLRKVRSGDYRVNFRDGNETTAYYTDNLEDAVN
AF_2010_repII_A001DRAFT_1007203133300000793Forest SoilMTLQAAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAFYTGNLEDAV
JGI1027J12803_10052834013300000955SoilMTLQEAKSIARHLGLTLRQVRSGAYRVNFRDGNETTAYYT
JGI25615J43890_108345813300002910Grasslands SoilMTLQEAKSIARHLGLALRKVRSGDYRVNFRDGNEARALLHG*
Ga0008092_1127831013300004629Tropical Rainforest SoilMTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGNERTAYYTDSLEDAV
Ga0066395_1020920023300004633Tropical Forest SoilMTLQEAKSMARHLGLTLREVRSVDYRVNFRDESETTAYYTDNLEDAVTKKWNRQ*
Ga0066672_1052745833300005167SoilTMTLQEAKSIARHLGLALRKVRSGDYRVNFRDGNEPASLLHG*
Ga0066388_10455979223300005332Tropical Forest SoilMIMTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGNEATAY
Ga0066388_10532454323300005332Tropical Forest SoilMTLQEAKSIARHLGLTLREVRSGKYRVNFRDGNETTAYYTD
Ga0066388_10580186323300005332Tropical Forest SoilMDSAMTLQQAKSIARHLGLTLRKVRSGDYRVNFRDGNEMTAYYT
Ga0066388_10681073523300005332Tropical Forest SoilMTLQKAKSIARHLGLTLREVCSGDYRVNFRDGTEVTAYYTDNLE
Ga0066388_10800781223300005332Tropical Forest SoilMTIQKPITLQEAKSIARHLGLTLRMVRSGEYRVNFRDGNE
Ga0070682_10096606013300005337Corn RhizosphereMTLQEAKSIARHLGLTLRQVRSGAYRVNFRDGNETTAYYTTDLED
Ga0070674_10044658813300005356Miscanthus RhizosphereMTLQEAKSIVRHLGLTLRKVRSGDYCVKSRDGTEATPYYTVDLEDA
Ga0070674_10208792523300005356Miscanthus RhizosphereMTIQKLMTLQEAKSIARHLGLTLRQVRSGKYRVNFRDGDETTA
Ga0070697_10017601013300005536Corn, Switchgrass And Miscanthus RhizosphereMDSAMTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGNEMTAYYT
Ga0066905_10036674923300005713Tropical Forest SoilMTPQEAKSIARHLGLTLRKVRSGDYRVNFRDGTETTAY*
Ga0066905_10045305233300005713Tropical Forest SoilMPSKRRFHKAMTLQKAKSIARRLGLTLREVCSGDYRVNFRDGNET
Ga0066905_10066372953300005713Tropical Forest SoilMTLQQAKSIARHLGLTLRKVRSGDYRVNFRDGNETTAYYTDNLEDAV
Ga0066905_10213559423300005713Tropical Forest SoilMTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGNETTAYYTDN
Ga0066905_10223531913300005713Tropical Forest SoilMTLQKAKSIARHLGLTLRQLDSGNYRVNFRDGNETTAYYT
Ga0066903_10041250733300005764Tropical Forest SoilMTLGKAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAYYTDKL
Ga0066903_10065354213300005764Tropical Forest SoilMDSAMTLQEAKSIARHLGLTLRKVRSGDYRVNFRDG
Ga0066903_10153212113300005764Tropical Forest SoilVLPDAVSKTVTLAQAKSIARHLGLTLRQVRSGGYRVNF
Ga0066903_10250267033300005764Tropical Forest SoilMTLQEAKSIARHLGLTLRKVRSGDYRVSFRDGNETTACYTGTLEDAVCGP*
Ga0066903_10450216923300005764Tropical Forest SoilMTLQEAKSIARHLGLTLRKVRSGDYRLTFQDARETAAYTRTISKTR*
Ga0066903_10472733723300005764Tropical Forest SoilMTLQEAKSIARHLGLTLRQVRSGAYRVNFRDGNETTAYY
Ga0066903_10610622723300005764Tropical Forest SoilMDSAMTLQEARSIARHLGLTLRKVRSGDYRVNFRDGNEMTAYYTDNLEDA
Ga0066903_10657219813300005764Tropical Forest SoilMTIQKPLTLQKAKSIARHLGLTVREVCSGNYRVNFRDGDETTAYYT
Ga0066903_10863581213300005764Tropical Forest SoilMTLQQAKSIARHLGLTLRKVRSGDYRVNFRDGNETTAYYTDNLEDAVN
Ga0070717_1169685123300006028Corn, Switchgrass And Miscanthus RhizosphereMDSAMTLQEAKSIGRHLGLTLRQVRSGDYRVNFLDGNKMTAHYTDNLEDAVN
Ga0075365_1016842113300006038Populus EndosphereMTLQEAKSIARHLGLSLRRVRSGAYRVSFPDENEATAYYTDSLED
Ga0070715_1010503413300006163Corn, Switchgrass And Miscanthus RhizosphereMTLPKAKSIARHLRLTLRQLCSGDYRVNFRDGNETTAYY
Ga0070712_10089817923300006175Corn, Switchgrass And Miscanthus RhizosphereMTLQEAKSIARHLGLILRTMRSGDYRVNFRDGNETTAYY
Ga0070765_10209407213300006176SoilMTIQKPITLQEAKSIARHLGLTLRQERSGHYRVNFRDGG
Ga0074047_1180026123300006576SoilMTLQEAKSIVRHLGLTLRKVRSGDYCVKSRDGTEATPYYTVDLEDAV
Ga0074048_1334254513300006581SoilMTLQEAKSIVRHLGLTLRKVRSGDYCVKSRDGNEAT
Ga0066653_1034894033300006791SoilMTLRKAKSIARHLRLTLRQVCSGDYRVNFRDANETTAYYT
Ga0075421_10016254113300006845Populus RhizosphereMTLQEAKSIARHLGLTLRRVRSGKYRVNFSDGNETTAY
Ga0075424_10269749923300006904Populus RhizosphereMTLQEAKSIARHLGLALLQVRRGHYRLNFRDGNETSTSR*
Ga0075418_1147464413300009100Populus RhizosphereMTHHEAKSIARHLGLTLRKVRSGDYRVNFADADDSAAYYTDNLEDAI
Ga0075418_1276218813300009100Populus RhizosphereMTLQEAKSIARHLGLTLRHVRSGQYRVNFRDGNERAYYTN
Ga0066709_10065624313300009137Grasslands SoilMTLQEAKSIARHLGLALRKVRSDDYRVNFRDGNEPAPYYT
Ga0105243_1225327213300009148Miscanthus RhizosphereMTLQEAKSIVRHLGLTLRKVRSGDYCVKSRDGNEATPYYTDDLE
Ga0111538_1276207613300009156Populus RhizosphereMTLQEAKSIARHLGLTLRKVRSSDYRVNFRDGNETTAYYTDDLEDAVSA
Ga0075423_1057168133300009162Populus RhizosphereMTLQEAKSIARHLGLTLRQVRSGAYRVNFPDGNETTAYYTNNLEEAVN
Ga0105248_1107888513300009177Switchgrass RhizosphereMDSDMTLQEAKSIARHFGLTLRKVRSGEYRVNFRDGNEMT
Ga0126374_1067936423300009792Tropical Forest SoilMTLQKAKSIARHLGLTLRQLRSGNYRVNFRDGNET
Ga0126380_1041496543300010043Tropical Forest SoilMTLQQAKSIARHLRLTLRMVRSGNHRVNFRDGNETTAYYTDKLE
Ga0126380_1044145223300010043Tropical Forest SoilMNGIHPASMAMTLQQAKSIARHLGLTLRKVRSGDYRVNFRDGNETTAYYTDSLE
Ga0126380_1088451433300010043Tropical Forest SoilMTLQEAKSIARHLGLTLRHVRSGDYRVNFRDGNDTTA
Ga0126380_1139375813300010043Tropical Forest SoilMDSAMTLQEAKSIARHLRLTLRQVRSGDYRVNFRDGNETT
Ga0126384_1003307613300010046Tropical Forest SoilMDSAMTLQEAKSVARHLGLTLRKVRSGDYRVNFRDGNETTA
Ga0126384_1047229713300010046Tropical Forest SoilMTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGNETTAYYTDNLEDAVN
Ga0126384_1094457213300010046Tropical Forest SoilMHSAMTLQEAKSIARHLRLTLRKVRSGDYRVNFRDGNETTAYYTDS
Ga0126384_1122617523300010046Tropical Forest SoilMDSAMTIQEAKSIARHLRLTLRKVRSGNYRVNFRDGNETSAYYTDDLEDAV
Ga0126382_1021561613300010047Tropical Forest SoilMTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGNETTA
Ga0126382_1242704813300010047Tropical Forest SoilMTLQEAKSIARHLGLTQRKVRSGEYRVNFRDGNETTAYYTDNLE
Ga0126373_1101406213300010048Tropical Forest SoilMTLQKAKSIARHLGLTLRKVCSGDYRVNFRDGNETTAYY
Ga0134080_1031986823300010333Grasslands SoilMTPQEAKSIARHLGLTLRKVRSGDYRVNFRDGNETTAYYTDNLED
Ga0126376_1228544413300010359Tropical Forest SoilMTLQEAKSIARHLRLTLRMVRSGDYRLNFRDGNETTAYYTDNLEDA
Ga0126372_1184786613300010360Tropical Forest SoilMTLQEAKSIARHLGLTLRKVRSGDYRVSCRDGDETTAYYTQ
Ga0126372_1269208113300010360Tropical Forest SoilMTLQQAKSIARHLGLTLRKVRSGHYRANFRDGNKMTAYYTD
Ga0126378_1023255423300010361Tropical Forest SoilMTLQEAKSIARHLGLTLRMVRSGDYRVNFRDGNETTAY*
Ga0126378_1205098313300010361Tropical Forest SoilMTLQQAKSIARHLGLTLRKVRSGDYRVNFRDGSETTVYYTDSLEDA
Ga0126379_1206696713300010366Tropical Forest SoilMTLPQAKSIARHLGLTLRKVRSGDYRVNFRDGNETTAYYTDSLQDA
Ga0126379_1262615213300010366Tropical Forest SoilMTLQEAKSIARHLGLTLRKVRSGDFRVSCRDGDETTA
Ga0126379_1322897323300010366Tropical Forest SoilMTLQEAKSIARHLGLTLRKMRSGDYRVNFRDGNET
Ga0134128_1282233913300010373Terrestrial SoilVTLQEAKLIARHLGLTLRKVRSGEYRVNSADADDSTAYYTDNLDD
Ga0105239_1093664513300010375Corn RhizosphereMAMTLQEAKSIARHLGLTLRQVGSGAYRVNFRDGHETTAY
Ga0126381_10433516513300010376Tropical Forest SoilMTLQKAKSIVRHLGLTLRQLRSGNYRVTFRDGNETTACYTDNLEDAVKCRGCDDP*
Ga0134124_1250155013300010397Terrestrial SoilMDSAMTLQEAKSIARHLGLTLRQVRSGAYRVNFRD
Ga0126383_1071280023300010398Tropical Forest SoilMTLQEAKSIARHLGFTLRKVRSGDYRVTFRDGDETGSYYTDDLED
Ga0126383_1079621913300010398Tropical Forest SoilMTLRKAKSIARHLGLTLREVCSGDYRVNFRDGNETTAYYTDNLEDAVNTA
Ga0126383_1199867213300010398Tropical Forest SoilMTLQKAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAYYTDKLED
Ga0126383_1321132413300010398Tropical Forest SoilMTIQKPITLQKAKSIARHLGVTLRQVRSGAYRVNFRDGNETTAYYTD
Ga0134123_1268129523300010403Terrestrial SoilMDSAMTLQEAKSVARHLGLTLRKVRSGDYRVNFRDANETTPYYTDS
Ga0124844_101380123300010868Tropical Forest SoilMTLQEAKSIARHLGLTLRTVRSGNYRVNLRDGNETTA*
Ga0151490_176460923300011107SoilMTIQKPMTLQEAKSIARHLGLTLRQVRSGNYRVNFRDGNETT
Ga0137365_1013962543300012201Vadose Zone SoilMTLQQAKSIARQLGLTLHQVRSGDYRVNFRDGNETTAY*
Ga0137365_1030798913300012201Vadose Zone SoilMTLQQAKSIARHLGLTLRQVRSGDYRVNFRDGNEITAYYTDNLEDAVNT
Ga0137365_1085398033300012201Vadose Zone SoilMRLQEAKSIARHLGLTLRQVRSGAYRVNFRDGNETTAYYTDNLEDA
Ga0137363_1011353613300012202Vadose Zone SoilMRFQNTMTLQEAKSIARHLGLTLRRVRSGAYRVNFLDGSETTAYYTDN
Ga0137376_1137435513300012208Vadose Zone SoilMTLQEAKAIARHLGLTLRKVHSGDYRVKFRDGNEMTAYYTDNLE
Ga0137377_1039527113300012211Vadose Zone SoilMTLQEAKSIARHLGLTLRQVRSGAYRVNFRDGNETTAYYTDN
Ga0137377_1135819233300012211Vadose Zone SoilMTIHETMTLRKAKSIARHLRLTLRQVCSGDYRVNFRDGNE
Ga0137435_119474423300012232SoilMTIQKPITLQEAKSIARHLGLTLRKMRSGHYRLNFRD
Ga0137371_1126852833300012356Vadose Zone SoilMRLQEAKSIARHLRLTLRQVRSGDYRVNFRDGNETTAYYPKN
Ga0137358_1035030213300012582Vadose Zone SoilVTLQEAKSIARHLGLTLRKVRSGHYRVNFRDGNENTAYYRDNLEDA
Ga0137398_1011521133300012683Vadose Zone SoilMTIQKPITLQEAKSIARHLGLTLRKVRSGHYRVNFRDGDGSTA
Ga0162652_10002864123300012941SoilMTLQEAKSIARHLGCTLRKVRSGDYCVKFPDGNDCMAYY
Ga0126375_1073313813300012948Tropical Forest SoilMTLQKAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAYYTD
Ga0164302_1151802323300012961SoilMTHQEAKSIARHLGLTLRKVRSGKYCVKFRDGNEAPPYFTD
Ga0126369_1337339523300012971Tropical Forest SoilMTLQEAKSIARHLGLTLRKVRSGDFRVSCRDGDEST
Ga0164309_1184181413300012984SoilVTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGNETT
Ga0164304_1103113023300012986SoilLDSDGFPMTIQKPMTLQEAKSIARHLGLTLRKVRSGDY
Ga0157371_1030920833300013102Corn RhizosphereMTLQEAKSIVRHLGLTLRKVRSGDYCVRFRDGNEATPYYTDDLED
Ga0132258_1223244233300015371Arabidopsis RhizosphereMTLQEAKSIARHLGLTLRRVRSGAYRVNFSDGNET
Ga0132258_1306339113300015371Arabidopsis RhizosphereMTLQEAKSIARHLGCTLRKVRSGDYCVKFPDGNNPMAYYTDNLEDAVNVA
Ga0132256_10035252813300015372Arabidopsis RhizosphereMPLQEAKSIAHHLGLTLRRVRAGAYRVNFSDGNETTA
Ga0132256_10133170613300015372Arabidopsis RhizosphereMTLQKAKSIARHLGLTLRPLRLGNFRVNFRKGDESTAYYTDTLEDA
Ga0132257_10142231713300015373Arabidopsis RhizosphereMTLQEAKSIARHLGLTLRRVRSGDYRVNFPNENEATA
Ga0132255_10087139723300015374Arabidopsis RhizosphereMPLQEAKSIARHLGLTLRRVRSGAYRVNFSDGNETTAYYTDNLEEVALQ*
Ga0182036_1038306213300016270SoilMTLPKAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAYYTDKLEDA
Ga0182036_1063662133300016270SoilMTLQEAKSIARHLGLTLRQVRSGDYRVNFRDGSETTVYYTDSLE
Ga0182036_1116350813300016270SoilMTLQEAKTLARHLGLTLRKVRSGDYRVNFRDGNETSAYYTDN
Ga0182036_1183439413300016270SoilMTLQEAKSIARHLGLTLRMVRSGDYRVSFRDGNETTACYTDNLEDA
Ga0182041_1013002513300016294SoilMTIQKPTLQEAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAYYTDN
Ga0182041_1131309813300016294SoilMTIQKPIKLQKAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAYYTDN
Ga0182041_1172559713300016294SoilMTLQKAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAYYTDKLEDA
Ga0182041_1182710933300016294SoilMTLQQAKSIARHLALTLRMVRSGEYRVNFRDGNETTAYYTDNL
Ga0182033_1016990113300016319SoilMTLQQAKSIARHLGLTLRKVRSGDYRVNFRDGNETTA
Ga0182033_1018619613300016319SoilMTLQEAKSIARHLGLTLRKVRSGDYRVSCRDGDESTA
Ga0182033_1027494243300016319SoilMTLQEAKSIARHLGLTLRKVRSGDYRVSCRDGDEST
Ga0182033_1040784833300016319SoilDSAMTLQQAKSIARHLGLTLRKVRSGDYRVNFRDGNEMTA
Ga0182033_1083831123300016319SoilMDSVMTLQQAKSIARHLRLTLRKVRSGDYRVNFRDGNETTAYYTDNLE
Ga0182033_1087727123300016319SoilMTIQKPMTLQEAKSIARHLGLTLRQLHSGNYRVNFRDGNENTA
Ga0182035_1209246913300016341SoilMTIQKPTLQEAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAYYTDNLED
Ga0182032_1013826443300016357SoilMTLQEAKSIARHLGLTLRKVRSGDYRVSCRDGDETTAYYTQNLEDA
Ga0182032_1020709313300016357SoilMTIQKPITLQEAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAYYTDNLEDA
Ga0182032_1053264033300016357SoilMTIQKPIKLQKAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAYYTDNLE
Ga0182032_1098394213300016357SoilMTLQQAKSIARHLGLTLRKVRSGDYRVNFRDGNEMT
Ga0182032_1111952313300016357SoilMDSAMTLQQAKSIARHLGLTLRKVRSGDYRVNFRDGNEMTAYYTDNLE
Ga0182034_1026020013300016371SoilMTIQKPTLQEAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAYYTDKLEDAVNA
Ga0182034_1037752233300016371SoilPMDSAMTLQQAKSIARHLGLTLRKVRSGDYRVNFRDGNEMTA
Ga0182034_1146819423300016371SoilMDSAMTLQQAKSIARHLGLTLRKVRSGDYRVNFRDGNEM
Ga0182040_1093189333300016387SoilMTIQKPIKLQKAKSIARHLGLTLRQLRSGNYRVNFRDG
Ga0182037_1141162013300016404SoilMTLQQAKSIARHLGLTLRKVRSGDYRVNFRDGNEMTAYYTDSLENA
Ga0182037_1159455213300016404SoilMTLQEAKSIARHLGFTLRKRRSCAYRVNFRDGNETSAYYTDNLEDA
Ga0182039_1018097313300016422SoilMTLQEAKSIARHLGLTLRKVRSGDYRVSCRDGDESTAY
Ga0182039_1127961033300016422SoilMTLQEAKSIARHLGLTLRKVRSGDYRVSCRDGDET
Ga0182039_1224331413300016422SoilMTLQQAKSIARHLGLTLRKVRSGDYRVNFRDGNETTAYYADNLE
Ga0182038_1011806213300016445SoilMTLQEAKSIARHLGLTLRKVRSGDYRVSCRDGDETTAYYTQNL
Ga0182038_1041680413300016445SoilMTLQQAKSIARHLGLTLRMVRSGEYRVNFRDGNETTAYYTDNLEDAVKTAI
Ga0184620_1005965033300018051Groundwater SedimentMTIQKPMTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGDETTAHYTDNLE
Ga0184621_1032337613300018054Groundwater SedimentMTLQEAKSIARHLGLTLRQVRSGAYRVNFRDGNEMTAYYTDNLEDAV
Ga0184617_103509523300018066Groundwater SedimentMTLQEAKSIARHLGCTLRKVRSGDYCVKFPDGNDSLAYYTGSLEDA
Ga0066662_1057721723300018468Grasslands SoilMTPQEAKSIARHLGLTLRKVRSGDYRVNFRDGNETTAYYT
Ga0190270_1321956733300018469SoilMTLQEAKSIARHLGCTLRKVRSGDYCVKFPDGNDCMAYYTDNLE
Ga0210406_1058811913300021168SoilMTLQEAKSIARHLGLTLRKVRSGDYRVSFREGNET
Ga0210408_1120059813300021178SoilWTAHVTLQQAKSIARHLGLTLRKVRSGDYRVNFRG
Ga0193699_1041826723300021363SoilMTLQEAKSIARHLGCTLRKVRSGDYCVKFPAGNDTTAYYTDNLEDA
Ga0210384_1088853413300021432SoilMTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGNETTPYYT
Ga0210392_1077823613300021475SoilMTIQKPITLQEAKSIARHLGLTLRQARSGHYRVNFRDGGESAACYAVDLETPLT
Ga0126371_1013153623300021560Tropical Forest SoilMTLQEAKSMARHLGLTLREVRSVDYRVNFRDESETTAYYTDNLEDAVTKKWNRQ
Ga0126371_1063807413300021560Tropical Forest SoilMDSAMTIQEAKSIARHLGLTLRKVRSGDYRVNFRD
Ga0126371_1196132123300021560Tropical Forest SoilMTLQEAKSIARHLGLTLRMVRSGDYRVNFRDGTESTAYYTDNLE
Ga0126371_1200238913300021560Tropical Forest SoilMTLQKAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAYYTDN
Ga0207710_1034139413300025900Switchgrass RhizosphereMTLQEAKSIVRHLGLTLRKVRSGDYCVKSRDGTEATPYYT
Ga0207699_1103845723300025906Corn, Switchgrass And Miscanthus RhizosphereMAMTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGNETTAY
Ga0207693_1057922713300025915Corn, Switchgrass And Miscanthus RhizosphereMTLRKAKSIARHLGLTLRLLRSGKYRVNFRDGDETTAYYAD
Ga0207693_1107069823300025915Corn, Switchgrass And Miscanthus RhizosphereMDSAMTLQEAKSIARHHGLTLRQVRSGNYRVNFRDGNKMTAHYTDNLEDA
Ga0207664_1149289113300025929Agricultural SoilMTLQEAKSIARHLGLALRKVRSGDYRVNFRDGNEPAP
Ga0207690_1070668623300025932Corn RhizosphereMTLQEAKSIVRHLGLTLRKVRSGDYCVKSRDGNEAAPYYT
Ga0207658_1149303113300025986Switchgrass RhizosphereVTHQEAKLIARHLGLTLRKVRSGDYRVNFLDADDSTAYYTDNLEDA
Ga0209465_1056486613300027874Tropical Forest SoilMTIQKPITLQEAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAYYTDNL
Ga0209488_1122094013300027903Vadose Zone SoilMTLQEAKSIARHLGCTLRKVRSGDYCVKFPDGNDTTAYYTD
Ga0209382_1066185523300027909Populus RhizosphereMTLQEAKSIARHLGLSLRRVRSGAYRVKFPDGNETAAYYTNNLE
Ga0209382_1104837813300027909Populus RhizosphereMTLQEAKSIARHLGLTLRQVRSGAYRVNLRDGNEINFVTNRWIRA
Ga0209382_1190525313300027909Populus RhizosphereMTLQEAKSIARHLGLTLRRVRSGDYRVNFPDENEATAYYTDSLED
Ga0307295_1008364123300028708SoilMTLQEAKSIARHLGCTLRKVRSGDYCVKFPAGNNSMAYYTDNL
Ga0307285_1021910713300028712SoilMTIQKPTTLREAKSIARHLRLTLRKVRSGHYRVNFRDGNETTAYY
Ga0307318_1014885413300028744SoilMTLQEAKSIARHLGCTLRKVRSGDYCVKFPDGNDSTA
Ga0307280_1028934413300028768SoilMAIQKPMTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGDETTAYYTDNLE
Ga0307282_1020772423300028784SoilVTLQEAKSIARHLGLTLRKVRSGEYRVNFPDADDS
Ga0307299_1000895313300028793SoilMTLQEAKSIARHLGCTLRKVRSGDYCVKFPEGNDSTAYYTDNLEDAVNVA
Ga0307287_1022795313300028796SoilMTLQEAKSIARRLGLTLRQVRSGDYRVNFRDGNETTAYYTDNLEDVVT
Ga0307302_1057107713300028814SoilVTLQEAKSIARHLGLTLRKVRSGEYRVNFPDADDSTAYYTDDLEDA
Ga0307296_1072470313300028819SoilVTLQEAKSIARHLGLTLRKVRSGEYRVNFPDADDSTAYYTDDLED
Ga0307312_1057298123300028828SoilMTLQEAKSIARHLGCTLRKVRSGDYCVKFPEGNDSTAYYTDNLEDAVN
Ga0307308_1038654213300028884SoilMTLQEAKSIARHLGCTLRKVRSGDYCVKFPDGNDSTAYY
Ga0307500_1021442923300031198SoilMTIQKPITLQEAKSIARHLGLTLRLLRSGKYRVNFRDGDEST
Ga0307497_1056820823300031226SoilMTLRKAKSIARHLRLTLRQVCSGDYRVNFRDGNETTACYTDSLEDAI
Ga0307497_1059328413300031226SoilMTIQKPMTLQEAKSIARHLGLTLRKVRSGDYRVNFRD
Ga0170824_12798236313300031231Forest SoilMTIHKPITLQEAKSIARHFGLTLRKVRSGHYRVNFRDGDEGT
Ga0170818_10528869313300031474Forest SoilARHLGLTLRKVRSGDYRVNFRDGNEMTAYHTDNFEDAVNTAAD
Ga0318516_1002230443300031543SoilMDSAMTLQQAKSIARHLGLTLRKVRSGDYRVNFRDGNEMTA
Ga0318516_1014056223300031543SoilMTLQEAKSIARHLGLTLRMVRSGDYRVNFRDGNETTAYYTDNLQDAVPPCHWRGR
Ga0318516_1040088823300031543SoilMTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGKEPAPY
Ga0318516_1070106223300031543SoilMTLQEAKSIARHLGLTLRTVRSGKYRVNFRDGNETTAYY
Ga0318541_1067525823300031545SoilMTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGNETSAYYTD
Ga0318541_1071671223300031545SoilMDSAMTLQEAKSIARHLGLTLRQVRSGDYRVNGNETTAYYTDNLEDAV
Ga0318538_1024482523300031546SoilMTLQEAKSIARHLGLTLRKVRSGDFRVSCRDGDETTAYYTQNL
Ga0318538_1047155733300031546SoilMTLQEAKSIARHLGLTLRQVRSGAYRVNFRDGNENTAYYT
Ga0318571_1037227023300031549SoilEPPMDSAMTLQQAKSIARHLGLTLRKVRSGDYRVNFRDGNEMTA
Ga0318528_1008500543300031561SoilMTLQEAKSIARHLGLTLRKVRSGDYRVSCRDGDESTAYY
Ga0318528_1011476713300031561SoilMTIQKPTLQEAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAY
Ga0318573_1004744543300031564SoilMTIQKPITLQEAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAYYTDKLE
Ga0318515_1026145743300031572SoilMTLPKAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAYYTDKLED
Ga0318515_1052214313300031572SoilMTLQKAKSIARHLGLTLRQVRSGNYRVNFRDGNETTAYY
Ga0310915_1008788023300031573SoilMTLQQAKSIARHLGLTLRKVRSGDYRVNFRDGNETTACYTDSLEDAVICRGEMI
Ga0310915_1074342823300031573SoilMTLQQAKSIARHLGLTLRMVRSGDYRVNFRDGNETTAYY
Ga0310915_1077045113300031573SoilMTLQEAKSIARHLGLTLRKVRSGDYRVSCRDGDETTAYYTQNLEDAV
Ga0318555_1041416723300031640SoilMTLQKAKSIARHLGLTLRKVCSGDYRVNFRDGNETTAYYTDNLED
Ga0318542_1035248713300031668SoilMTLQEAKTLARHLGLTLRKVRSGDYRVNFRDGNETSAYY
Ga0318574_1042705123300031680SoilMTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGKEPAPYYTD
Ga0318574_1060187613300031680SoilMTLQKAKSIARHLGLTLRQLRSGNYRVNFRDGNETT
Ga0318574_1072802513300031680SoilMTLQEAKSIARHLGLTLRMVRSGDYRVNFRDGNETTAYYTDNLEDAVNT
Ga0318560_1069537613300031682SoilMTLQEAKSIARHLRLALRVVRSGDYRVNFRDGNETTAYY
Ga0318496_1037728913300031713SoilMTLQEAKSIARHLGLTLRKVRSGDYRVNFRDRNEPAP
Ga0318496_1070661113300031713SoilMTLHKAKSIARHLGLTLRQLRSGNYRVNFRDGTETTAYYTDN
Ga0306917_1021078233300031719SoilMTLQEAKSIARHLGLTLRTVRSGKYRVNFRDGNETTAY
Ga0306917_1068745413300031719SoilMTLQQAKSIARHLGLTLRKVRSGDYRVNFRDGNETTAYYTDD
Ga0306917_1078373523300031719SoilMDSAMTLQEAKSIARHLRLTLRKVRSGDYRVNFRDGNEMTA
Ga0306917_1111428913300031719SoilMTIQKPMTLQEAKSIARHLGLTLRQLRSGNYRVNFRDGNENTA
Ga0318493_1001085413300031723SoilMDSAMTLQQAKSIARHLGLTLRKVRSGDYRVNFRDGNEMT
Ga0318493_1081087613300031723SoilMTLQEAKSIARHLGFTLRKVRSGDYRVTFRDGDETGSY
Ga0318500_1074030323300031724SoilMTLQEAKSIARHLGLTLRKVRSGDFRVSCRDGDETTAYYTQNLEDAV
Ga0318501_1061042633300031736SoilMTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGNETTAYYADNLEDAVHT
Ga0306918_1012526613300031744SoilMTIQKPTLQKAKSIARHLGLTLRQLRSGNYRVNFR
Ga0306918_1095832423300031744SoilMTIQKPIKLQKAKSIARHLGLTLRQLRSGNYRVNFRDGNETTA
Ga0318502_1011302563300031747SoilMTLPKAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAYY
Ga0318537_1003253813300031763SoilMTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGNETSAYY
Ga0318537_1031360313300031763SoilMTLQEAKSIARHLGLTLRKVRSGDYRVSCRDGDETTAYYTQTLED
Ga0318537_1037537113300031763SoilMDSAMTLGEAKSIARHLGLTLRKVRSGDYRVNFRDGNENTAYYTDSLEH
Ga0318535_1054057113300031764SoilMTLQEAKSIARHLGLTLRQVRSGAYRVNFRDGNENT
Ga0318535_1056059213300031764SoilMTIQKPITLQEAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAYYTD
Ga0318554_1044294123300031765SoilMDSAMTLGEAKSIARHLGLTLRKVRSGDYRVNFRDGNEN
Ga0318509_1017106113300031768SoilMTLQEAKSIARHLGLTLRKVRSGDYRVSCRDGDETTAYYTQNLED
Ga0318509_1042494113300031768SoilMTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGNETTAYY
Ga0318521_1085796713300031770SoilMTLQEAKSIARHLGLTLRMVRSGDYRVNFRDGNETTAYYTDNLEDAVN
Ga0318546_1016873013300031771SoilMTLQEAKSIARHLGLTLRTVRSGDFRVNFRDGNETTAYYTDNL
Ga0318546_1110598313300031771SoilMTLQEAKSIARHLGLTLRKVRSGYYRVNFRDGNETSAYY
Ga0318546_1114994113300031771SoilMGLEELMTLQKTKLIARHLGLTLRQLRSGNYRVNFRDGNETTPYY
Ga0318543_1006912713300031777SoilMTLQEAKSIARHLGLTLRKVRSGDYRVSCRDGDETTAYYTQNLE
Ga0318543_1025888513300031777SoilMTLQEAKSIARHLGLTLRKVRSGDFRVSCRDGDETTAYY
Ga0318498_1035753623300031778SoilMDSAMTLQQAKSIARHLGLTLRKVRSGDYRVNFRDGNEMTAYYTDNLEDAVKP
Ga0318498_1052271513300031778SoilMTLQEAKSIARRLGLTLRKVRSGEYRVNFRDGNETTAYY
Ga0318547_1016326413300031781SoilMGLEELMTLQKTKLIARHLGLTLRQLRSGNYRVNFRDGNETTAYYTDKLEDALMPWL
Ga0318547_1068197313300031781SoilMTLQEAKSIARHLGLTLRKVRSGDYRVSCRDGDDTTAYYTQNLED
Ga0318547_1096017013300031781SoilMTLQKAKSIARHLGLTLRMVRSGEYRVNFRDGNETTAYY
Ga0318529_1036480813300031792SoilMTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGNETTAYYTDNLEDA
Ga0318548_1031924213300031793SoilMTLQEAKSIARHLGLTLRKVRSGEYRVNFRDGNETTAYYT
Ga0318503_1002895923300031794SoilMTLQEAKSIARHLGLTLRKVRSGDFRVSCRDGDETTAYYTQ
Ga0318503_1015070113300031794SoilMTLQKAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAYYTDK
Ga0318503_1024905313300031794SoilMRLQKAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAYYTDKLEDAVNA
Ga0318550_1009295413300031797SoilMTLQQAKSIARHLGLTLRIVHSGAYRVNFRDGNETTASYTDN
Ga0318523_1015955233300031798SoilMTLQEAKSIARHLGLTLRLLRSGNYRVNFRDGNETTAYYTDNLE
Ga0318497_1037548113300031805SoilMTIQKPITLQEAKSIARHLGLTLRQLRSGNYRVNFRDGN
Ga0318567_1082763223300031821SoilMTLQEAKSIARHLGLTLRQVRSSAYRVNFRDGNETTAYYTDLLE
Ga0310917_1004664513300031833SoilMTLQEAKSIARHLGLTLRKVRSGDYRVSCRDGDESTAYYTQNL
Ga0310917_1074521913300031833SoilMTTYKPMTLQEAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAYYTDNLE
Ga0318511_1021326023300031845SoilMRLQKAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAYYTD
Ga0318527_1025643413300031859SoilMTLREAKSIARHLGLTLRKVRSGDYRGNFRDGNEAT
Ga0318495_1050272013300031860SoilMTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGNEPAPYY
Ga0306919_1008907933300031879SoilMTLQQAKSIARHLGLTLRKVRSGDYRVNFRDGNETTACYTDSLEDAVICR
Ga0306919_1017088513300031879SoilMTLQEAKSIARHLGLTLRKVRSGDYRVSCRDGDESTAYYTQNLEDAV
Ga0306919_1151054713300031879SoilMTIQKPIKLQKAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAYYTDNLEDA
Ga0318544_1012743613300031880SoilMTLQEAKSIARRLGLTLRKVRSGDYRVNFRDGNETSAYY
Ga0306925_1074122913300031890SoilMTIQKLITLQEAKSITRHLGLTLRQLRSGNYRVNFRDGNET
Ga0306925_1085476313300031890SoilMTIQKPTLQEAKSIARHLGLTLRQLRSGNYRVNFRDG
Ga0306925_1128999323300031890SoilMTIHKPMTLQEAKSIARHLGLILRKVRSGDYRVSSRNGDESTACYAVGVE
Ga0306925_1148824733300031890SoilMTLQEAKSIARHLGLTLRKVRSGDYRVSCRDGDETTA
Ga0306925_1159025333300031890SoilMDSPMTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGNETTAYYTDDLE
Ga0318536_1008269123300031893SoilMTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGNET
Ga0318522_1012895323300031894SoilMTLQQAKSIARHLGLTLRKVRSGDYRVNFRDGNETTASY
Ga0318520_1012758723300031897SoilMTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGNEPAPY
Ga0306923_1149749133300031910SoilMTLQEAKSIARHIGLILRTVRSGNYRVNFRDGNETTAYYTDKLE
Ga0306923_1219416523300031910SoilMTLQEAKSIARVLGLTLRQMRSGDYRVNFRDGGETAACYTDNLEDVVN
Ga0306921_1018548813300031912SoilMTLQEAKSIARHLGLTLRMVRSGEYRVNFRDGDEP
Ga0306921_1093570023300031912SoilQQAKSIARHLGLTLRMVRSGEYRANFRDGNETTAY
Ga0306921_1168475013300031912SoilMDSAMTLQEAKSIARHLGLTLRQVRSGDYRVNGNETTAYYTDNLE
Ga0306921_1200952813300031912SoilMTLLEAKSITHHLGLTRHLLRSGKYRVNLRDGNECTAY
Ga0306921_1229232413300031912SoilMTTYKPMTLQEAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAYY
Ga0310912_1004081963300031941SoilMTLQEAKSIARHLGLTLRMVRSGEYRVNFRDGDEPTAYYT
Ga0310912_1023313713300031941SoilMTIQKPIKLQKAKSIARHLGLTLRQLRSGNYRVNFRD
Ga0310912_1052762933300031941SoilTLQEAKSIARHLGLTLRQLRSGNYRVNFRDGNENTA
Ga0310916_1018815913300031942SoilMTLQEAKSIARHLGLTLRKVRSGEYRVNFRDGNETTAYYTDNLEDAVN
Ga0310916_1028920513300031942SoilMTIQKPMTLQEAKSIARHLGLTLRHLRSGNYRVNFRDGNETTAYYTDKLEDA
Ga0310916_1050427313300031942SoilPMTIQKPIKLQKAKSIARHLGLTLRQVRFGTYRVNFRDWK
Ga0310916_1075655233300031942SoilMTLQQAKSIARHLRLTLRKLRSGDYRVNFRDGNETTAYYTDNLVDAV
Ga0310916_1109722413300031942SoilMNGVAMTLQEAKSIARHLGLTLRQLRSGKYRVNFRDGN
Ga0310913_1008567733300031945SoilMTLQKAKSIARHLGLTLRQLCSGDYRVNFRDGNETTAYYT
Ga0310913_1089293013300031945SoilKPTLQEAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAY
Ga0310910_1063327313300031946SoilMDSAMTLQEAKSIARHLGLTLRQVRSGDYRVNGNETTAYYT
Ga0310909_1031768123300031947SoilMDSAMTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGNEMTAYYTDNLED
Ga0306926_1026501413300031954SoilMTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGNETSAYYTDNLEDAVNT
Ga0306926_1035068023300031954SoilMTLQEAKSIARHLGLTLRQLRSGNYRVNFRDGNENTA
Ga0306926_1167265913300031954SoilMTIQKPTLQEAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAYYTDKLEDA
Ga0306926_1227963933300031954SoilMTLQQAKSIARHLRLTLRMVRSGDYRVNFRDGNETTAYYT
Ga0306926_1248554423300031954SoilMTTYKPMTLQEAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAYYTDNLEDA
Ga0306926_1278986723300031954SoilMTLQEAKSIARVLGLTLRQMRSGDYRVNFRDGGETAACYTDNL
Ga0318531_1021066213300031981SoilMTLQEAKSIARHLGLTLRKVRSGEYRVNFRDGNETTAYYTDKLEYAV
Ga0318531_1049414113300031981SoilMTLHKAKSIARHLGLTLRQLRSGNYRVNFRDGTETTAYYTDNLED
Ga0318531_1058830613300031981SoilMTLQQAKSIARHLGLTLRKVRSGDYRVNFRDGNETTACYTDSLK
Ga0310911_1022777533300032035SoilMTLQEAKSIARHLGLTLRKVRSGEYRVNFRDGNETTAYY
Ga0318559_1006198633300032039SoilMTLQEAKSIARHLGLTLRMVRSGDYRVNFRDGNETTAYYTDN
Ga0318549_1004263613300032041SoilMDSVMTLQQAKSIARHLRLTLRKVRSGDYRVNFRDGNETTAYY
Ga0318545_1000225193300032042SoilMTLQEAKSIARHLGLTLRKVRSGDFRVSCRDGDETTAYYT
Ga0318545_1022775813300032042SoilMTLQEAKSIARHLGLTLRKVRSGDFRVSCRDGDETTAYYTQNLED
Ga0318545_1025149213300032042SoilMTLQQAKSIARHLGLTLRMVRSGEYRVNFRDGNETTAYYTDN
Ga0318556_1008799513300032043SoilMTLQQAKSIARHLRLTLRMVRSGDYRVNFRDGNETTAYYTDNLDDAVKTA
Ga0318556_1019917413300032043SoilMTIQKPITLQEAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAYYTDNLED
Ga0318558_1031659013300032044SoilMTLQEAKSIARHLGLTLRQVRSGAYRVNFRDGNEN
Ga0318575_1024954823300032055SoilMGLEELMTLQKTKLIARHLGLTLRQLRSGNYRVNFRDGNET
Ga0318533_1099931223300032059SoilMTLQKAKSIARYLGLTLRELCSGNYRVNFRDGNETTAYY
Ga0318510_1011594523300032064SoilMTLQEAKSIARHLGLTVRKVRSGDYRVSFRDGNGTTAYYTD
Ga0318513_1017957213300032065SoilMTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGDETTVHY
Ga0318513_1042711313300032065SoilMTLQEAKSIARHLGLTLRKMRSGAYRVNFRDGNETTAYYT
Ga0318553_1005438113300032068SoilAGLPMDSAMTLQQAKSIARHLGLTLRKVRSGDYRVNFRDGNEMTA
Ga0306924_1115323123300032076SoilMDSAMTLQQAKSIARHLGLTLRKVRSGDYRVNFRDGNEATAYY
Ga0306924_1238378313300032076SoilMTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGNETTAGYTDNLE
Ga0318577_1008277913300032091SoilMDSAMTLQQAKSIARHLGLTLRKVRSGDYRVNFRDGNE
Ga0318577_1009713513300032091SoilMTLQEAKSIARHLGLTLRKVRSGDYRVSCRDGDQTTAYYTQNLEDAV
Ga0318577_1038581133300032091SoilMTLQEAKSIARHLGLTLRKVRSGEYRVNFRDGNETTAYYTDN
Ga0318577_1047779423300032091SoilMTLQKAKSIARHLGLTLRKVCSGDYRVNFRDGNETTAYYTD
Ga0318577_1053844113300032091SoilMDSAMTLQEAKSIARHLGLTLRQVRSGDYRVNGNETT
Ga0318540_1004885313300032094SoilMNFHEAMTLQEAKSIARHLGFTLRQLRSGKYRVNFRDGN
Ga0306920_10061582813300032261SoilMDSAMTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGNQM
Ga0306920_10162487343300032261SoilMDSAVTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGNEMTP
Ga0306920_10365755813300032261SoilMTLQQAKSIARHLGLTLRMVRSGDYRVNFRDGNEATA
Ga0306920_10398466923300032261SoilMTLLEAKSITHHLGLTLHLLRSGKYRVNLRDGNEC
Ga0306920_10399725813300032261SoilMTLQEAKSIARHLGLTLRMVRSGDYRVNFRDGNETTAYYTDNLEDA
Ga0310914_1019566423300033289SoilMTLQQAKSIARHLGLTLRMVRSGEYRANFRDGNETTAY
Ga0310914_1021509513300033289SoilTLQEAKSIARHLGLTLRMVRSGDYRVNFRDGNETTAYYTDNLQDAVPPCHWRGR
Ga0310914_1079101013300033289SoilMRLQKAKSIARHLGLTLRQLRSGNYRVNFRDGNETTAYYTDKLEDA
Ga0310914_1116751033300033289SoilMTIQKPITLQEAKSIARHLGLTLRQVRFGNYRVNF
Ga0318519_1024557513300033290SoilMTLQKAKSIARHLGLTLREVCSGDYRVNFRDGNESTAYYTDKF
Ga0318519_1028780213300033290SoilMDSAMTLQQAKSIARHLGLTLRKVRSGDYRVNFRDGNEMTAYYTDN
Ga0318519_1053190113300033290SoilMNFHEAMTLQQAKSVARHLRFTLRRLRSGKYRVNFRDGNESTAYY
Ga0364929_0150891_620_7543300034149SedimentMTLQEAKSIVRHLGLTLRKVRSGDYCVKFRDGNEATPYYTDDLED


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.