| Basic Information | |
|---|---|
| Family ID | F009056 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 323 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MKPVVKKATPAAIAVLRQATALFPKRKKASDGLLPSAAHI |
| Number of Associated Samples | 175 |
| Number of Associated Scaffolds | 323 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 93.50 % |
| % of genes near scaffold ends (potentially truncated) | 99.69 % |
| % of genes from short scaffolds (< 2000 bps) | 85.45 % |
| Associated GOLD sequencing projects | 165 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (50.464 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (20.124 % of family members) |
| Environment Ontology (ENVO) | Unclassified (50.155 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (53.560 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.53% β-sheet: 0.00% Coil/Unstructured: 76.47% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 323 Family Scaffolds |
|---|---|---|
| PF13578 | Methyltransf_24 | 5.26 |
| PF13392 | HNH_3 | 2.48 |
| PF13884 | Peptidase_S74 | 1.55 |
| PF00462 | Glutaredoxin | 1.55 |
| PF00535 | Glycos_transf_2 | 0.62 |
| PF01755 | Glyco_transf_25 | 0.62 |
| PF11397 | GlcNAc | 0.62 |
| PF13692 | Glyco_trans_1_4 | 0.31 |
| PF00041 | fn3 | 0.31 |
| PF02467 | Whib | 0.31 |
| PF09834 | DUF2061 | 0.31 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.31 |
| COG ID | Name | Functional Category | % Frequency in 323 Family Scaffolds |
|---|---|---|---|
| COG3306 | Glycosyltransferase involved in LPS biosynthesis, GR25 family | Cell wall/membrane/envelope biogenesis [M] | 0.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 50.46 % |
| All Organisms | root | All Organisms | 49.54 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000206|M3P_c10011985 | All Organisms → Viruses → Predicted Viral | 1146 | Open in IMG/M |
| 3300000558|Draft_11442603 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 545 | Open in IMG/M |
| 3300000756|JGI12421J11937_10155965 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 560 | Open in IMG/M |
| 3300001839|RCM40_1079008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 644 | Open in IMG/M |
| 3300002201|metazooDRAFT_1261356 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300002408|B570J29032_109914721 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2499 | Open in IMG/M |
| 3300002835|B570J40625_100923318 | Not Available | 753 | Open in IMG/M |
| 3300003394|JGI25907J50239_1052322 | Not Available | 830 | Open in IMG/M |
| 3300004096|Ga0066177_10389514 | Not Available | 604 | Open in IMG/M |
| 3300005525|Ga0068877_10735775 | Not Available | 525 | Open in IMG/M |
| 3300005527|Ga0068876_10016669 | All Organisms → Viruses → Predicted Viral | 4692 | Open in IMG/M |
| 3300005527|Ga0068876_10607673 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 591 | Open in IMG/M |
| 3300005527|Ga0068876_10631937 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 577 | Open in IMG/M |
| 3300005581|Ga0049081_10066809 | Not Available | 1353 | Open in IMG/M |
| 3300005581|Ga0049081_10125416 | Not Available | 948 | Open in IMG/M |
| 3300005582|Ga0049080_10107756 | Not Available | 945 | Open in IMG/M |
| 3300005583|Ga0049085_10201019 | Not Available | 662 | Open in IMG/M |
| 3300005585|Ga0049084_10187339 | Not Available | 711 | Open in IMG/M |
| 3300005662|Ga0078894_10489209 | All Organisms → Viruses → Predicted Viral | 1106 | Open in IMG/M |
| 3300005940|Ga0073913_10082537 | Not Available | 544 | Open in IMG/M |
| 3300006805|Ga0075464_10350683 | Not Available | 893 | Open in IMG/M |
| 3300006805|Ga0075464_10945724 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 539 | Open in IMG/M |
| 3300006875|Ga0075473_10073577 | Not Available | 1337 | Open in IMG/M |
| 3300006875|Ga0075473_10346857 | Not Available | 600 | Open in IMG/M |
| 3300007216|Ga0103961_1251675 | Not Available | 1403 | Open in IMG/M |
| 3300007346|Ga0070753_1055949 | All Organisms → Viruses → Predicted Viral | 1609 | Open in IMG/M |
| 3300007542|Ga0099846_1020877 | All Organisms → Viruses → Predicted Viral | 2546 | Open in IMG/M |
| 3300007542|Ga0099846_1057734 | All Organisms → Viruses → Predicted Viral | 1464 | Open in IMG/M |
| 3300007542|Ga0099846_1192105 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 723 | Open in IMG/M |
| 3300007542|Ga0099846_1200843 | Not Available | 703 | Open in IMG/M |
| 3300007973|Ga0105746_1216553 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 656 | Open in IMG/M |
| 3300007974|Ga0105747_1310267 | Not Available | 535 | Open in IMG/M |
| 3300008055|Ga0108970_11365937 | Not Available | 1019 | Open in IMG/M |
| 3300008107|Ga0114340_1003949 | Not Available | 13204 | Open in IMG/M |
| 3300008107|Ga0114340_1038603 | All Organisms → Viruses → Predicted Viral | 2147 | Open in IMG/M |
| 3300008107|Ga0114340_1045383 | All Organisms → Viruses → Predicted Viral | 1947 | Open in IMG/M |
| 3300008107|Ga0114340_1067059 | Not Available | 1522 | Open in IMG/M |
| 3300008107|Ga0114340_1069975 | All Organisms → Viruses → Predicted Viral | 1880 | Open in IMG/M |
| 3300008107|Ga0114340_1097331 | Not Available | 1183 | Open in IMG/M |
| 3300008107|Ga0114340_1113278 | All Organisms → Viruses → Predicted Viral | 1459 | Open in IMG/M |
| 3300008108|Ga0114341_10245113 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 969 | Open in IMG/M |
| 3300008108|Ga0114341_10511308 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 540 | Open in IMG/M |
| 3300008110|Ga0114343_1061811 | All Organisms → Viruses → Predicted Viral | 2642 | Open in IMG/M |
| 3300008113|Ga0114346_1179521 | Not Available | 869 | Open in IMG/M |
| 3300008114|Ga0114347_1263966 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 517 | Open in IMG/M |
| 3300008116|Ga0114350_1011033 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6773 | Open in IMG/M |
| 3300008116|Ga0114350_1064622 | All Organisms → Viruses → Predicted Viral | 1272 | Open in IMG/M |
| 3300008116|Ga0114350_1109035 | Not Available | 857 | Open in IMG/M |
| 3300008120|Ga0114355_1010137 | Not Available | 5364 | Open in IMG/M |
| 3300008120|Ga0114355_1046298 | Not Available | 2014 | Open in IMG/M |
| 3300008120|Ga0114355_1050421 | All Organisms → Viruses → Predicted Viral | 1900 | Open in IMG/M |
| 3300008120|Ga0114355_1165590 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 763 | Open in IMG/M |
| 3300008262|Ga0114337_1267730 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 639 | Open in IMG/M |
| 3300008265|Ga0114361_1149495 | Not Available | 729 | Open in IMG/M |
| 3300008266|Ga0114363_1024217 | All Organisms → Viruses → Predicted Viral | 2635 | Open in IMG/M |
| 3300008266|Ga0114363_1028849 | All Organisms → Viruses → Predicted Viral | 2361 | Open in IMG/M |
| 3300008266|Ga0114363_1059236 | All Organisms → Viruses → Predicted Viral | 1494 | Open in IMG/M |
| 3300008266|Ga0114363_1085080 | All Organisms → Viruses → Predicted Viral | 1169 | Open in IMG/M |
| 3300008448|Ga0114876_1055092 | All Organisms → Viruses → Predicted Viral | 1771 | Open in IMG/M |
| 3300008448|Ga0114876_1058984 | Not Available | 1689 | Open in IMG/M |
| 3300008448|Ga0114876_1114534 | Not Available | 1046 | Open in IMG/M |
| 3300008448|Ga0114876_1140264 | Not Available | 897 | Open in IMG/M |
| 3300008448|Ga0114876_1236962 | Not Available | 580 | Open in IMG/M |
| 3300008450|Ga0114880_1085786 | All Organisms → Viruses → Predicted Viral | 1247 | Open in IMG/M |
| 3300009081|Ga0105098_10136103 | Not Available | 1092 | Open in IMG/M |
| 3300009155|Ga0114968_10363086 | Not Available | 797 | Open in IMG/M |
| 3300009159|Ga0114978_10319013 | Not Available | 947 | Open in IMG/M |
| 3300009160|Ga0114981_10248921 | Not Available | 969 | Open in IMG/M |
| 3300009160|Ga0114981_10283757 | Not Available | 900 | Open in IMG/M |
| 3300009160|Ga0114981_10748018 | Not Available | 516 | Open in IMG/M |
| 3300009170|Ga0105096_10581159 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 587 | Open in IMG/M |
| 3300009183|Ga0114974_10205879 | Not Available | 1199 | Open in IMG/M |
| 3300009183|Ga0114974_10353042 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 852 | Open in IMG/M |
| 3300009419|Ga0114982_1252829 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 549 | Open in IMG/M |
| 3300010156|Ga0068873_1036466 | Not Available | 520 | Open in IMG/M |
| 3300010354|Ga0129333_10484112 | All Organisms → Viruses → Predicted Viral | 1086 | Open in IMG/M |
| 3300010354|Ga0129333_10608795 | Not Available | 947 | Open in IMG/M |
| 3300010354|Ga0129333_11004430 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 701 | Open in IMG/M |
| 3300010354|Ga0129333_11267467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus → Streptococcus pseudopneumoniae | 610 | Open in IMG/M |
| 3300010354|Ga0129333_11375309 | Not Available | 581 | Open in IMG/M |
| 3300010354|Ga0129333_11441020 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 565 | Open in IMG/M |
| 3300010354|Ga0129333_11523780 | Not Available | 547 | Open in IMG/M |
| 3300010370|Ga0129336_10234596 | Not Available | 1035 | Open in IMG/M |
| 3300010370|Ga0129336_10495341 | Not Available | 659 | Open in IMG/M |
| 3300010370|Ga0129336_10539965 | Not Available | 626 | Open in IMG/M |
| 3300010370|Ga0129336_10573030 | Not Available | 604 | Open in IMG/M |
| 3300010370|Ga0129336_10660754 | Not Available | 555 | Open in IMG/M |
| 3300010370|Ga0129336_10749650 | Not Available | 516 | Open in IMG/M |
| 3300011009|Ga0129318_10055402 | All Organisms → Viruses → Predicted Viral | 1033 | Open in IMG/M |
| 3300011116|Ga0151516_11187 | Not Available | 10884 | Open in IMG/M |
| 3300011381|Ga0102688_1684528 | All Organisms → Viruses → Predicted Viral | 3262 | Open in IMG/M |
| 3300012017|Ga0153801_1065798 | Not Available | 637 | Open in IMG/M |
| 3300012666|Ga0157498_1037874 | Not Available | 742 | Open in IMG/M |
| 3300012734|Ga0157615_1239686 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 655 | Open in IMG/M |
| 3300013004|Ga0164293_10377142 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 961 | Open in IMG/M |
| 3300013004|Ga0164293_10453990 | Not Available | 853 | Open in IMG/M |
| 3300013004|Ga0164293_10609936 | Not Available | 708 | Open in IMG/M |
| 3300013005|Ga0164292_10267352 | Not Available | 1183 | Open in IMG/M |
| 3300013005|Ga0164292_11032180 | Not Available | 512 | Open in IMG/M |
| (restricted) 3300013122|Ga0172374_1031614 | All Organisms → Viruses → Predicted Viral | 2304 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10100293 | All Organisms → Viruses → Predicted Viral | 2040 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10660732 | Not Available | 620 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10126927 | All Organisms → Viruses → Predicted Viral | 2076 | Open in IMG/M |
| (restricted) 3300013137|Ga0172375_10926644 | Not Available | 525 | Open in IMG/M |
| 3300013295|Ga0170791_11300224 | Not Available | 697 | Open in IMG/M |
| 3300013372|Ga0177922_10835279 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
| 3300013372|Ga0177922_11147599 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 780 | Open in IMG/M |
| 3300013372|Ga0177922_11165223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus → Streptococcus pseudopneumoniae | 625 | Open in IMG/M |
| 3300017707|Ga0181363_1027563 | All Organisms → Viruses → Predicted Viral | 1084 | Open in IMG/M |
| 3300017722|Ga0181347_1097044 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 844 | Open in IMG/M |
| 3300017722|Ga0181347_1119960 | Not Available | 736 | Open in IMG/M |
| 3300017722|Ga0181347_1213813 | Not Available | 503 | Open in IMG/M |
| 3300017723|Ga0181362_1009830 | Not Available | 2054 | Open in IMG/M |
| 3300017736|Ga0181365_1001822 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5126 | Open in IMG/M |
| 3300017736|Ga0181365_1162631 | Not Available | 526 | Open in IMG/M |
| 3300017747|Ga0181352_1013503 | All Organisms → Viruses → Predicted Viral | 2610 | Open in IMG/M |
| 3300017747|Ga0181352_1198611 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 516 | Open in IMG/M |
| 3300017754|Ga0181344_1143546 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 682 | Open in IMG/M |
| 3300017761|Ga0181356_1077999 | Not Available | 1103 | Open in IMG/M |
| 3300017761|Ga0181356_1125936 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 813 | Open in IMG/M |
| 3300017766|Ga0181343_1196449 | Not Available | 553 | Open in IMG/M |
| 3300017774|Ga0181358_1020647 | Not Available | 2633 | Open in IMG/M |
| 3300017774|Ga0181358_1099729 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1042 | Open in IMG/M |
| 3300017774|Ga0181358_1191991 | Not Available | 673 | Open in IMG/M |
| 3300017774|Ga0181358_1235784 | Not Available | 582 | Open in IMG/M |
| 3300017777|Ga0181357_1054663 | All Organisms → Viruses → Predicted Viral | 1552 | Open in IMG/M |
| 3300017777|Ga0181357_1200616 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 712 | Open in IMG/M |
| 3300017777|Ga0181357_1252642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus → Streptococcus pseudopneumoniae | 612 | Open in IMG/M |
| 3300017777|Ga0181357_1297378 | Not Available | 549 | Open in IMG/M |
| 3300017780|Ga0181346_1268664 | Not Available | 589 | Open in IMG/M |
| 3300017780|Ga0181346_1276075 | Not Available | 578 | Open in IMG/M |
| 3300017780|Ga0181346_1287082 | Not Available | 562 | Open in IMG/M |
| 3300017784|Ga0181348_1284318 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 559 | Open in IMG/M |
| 3300017784|Ga0181348_1297320 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 542 | Open in IMG/M |
| 3300017785|Ga0181355_1037621 | All Organisms → Viruses → Predicted Viral | 2078 | Open in IMG/M |
| 3300017785|Ga0181355_1116018 | Not Available | 1099 | Open in IMG/M |
| 3300017785|Ga0181355_1198787 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 789 | Open in IMG/M |
| 3300017785|Ga0181355_1393245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus → Streptococcus pseudopneumoniae | 502 | Open in IMG/M |
| 3300018420|Ga0181563_10568317 | Not Available | 632 | Open in IMG/M |
| 3300019784|Ga0181359_1091945 | All Organisms → Viruses → Predicted Viral | 1123 | Open in IMG/M |
| 3300019784|Ga0181359_1118904 | Not Available | 947 | Open in IMG/M |
| 3300019784|Ga0181359_1147862 | Not Available | 809 | Open in IMG/M |
| 3300020048|Ga0207193_1554780 | Not Available | 763 | Open in IMG/M |
| 3300020205|Ga0211731_10610131 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1170 | Open in IMG/M |
| 3300020506|Ga0208091_1017901 | Not Available | 835 | Open in IMG/M |
| 3300020557|Ga0208231_1051683 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 639 | Open in IMG/M |
| 3300020570|Ga0208465_1037388 | Not Available | 621 | Open in IMG/M |
| 3300020570|Ga0208465_1043262 | Not Available | 572 | Open in IMG/M |
| 3300020603|Ga0194126_10307569 | Not Available | 1054 | Open in IMG/M |
| 3300021093|Ga0194123_10193672 | Not Available | 1047 | Open in IMG/M |
| 3300021376|Ga0194130_10575731 | Not Available | 563 | Open in IMG/M |
| 3300021424|Ga0194117_10425089 | Not Available | 605 | Open in IMG/M |
| 3300021961|Ga0222714_10352696 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 790 | Open in IMG/M |
| 3300021962|Ga0222713_10524735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus → Streptococcus pseudopneumoniae | 704 | Open in IMG/M |
| 3300021963|Ga0222712_10191583 | All Organisms → Viruses → Predicted Viral | 1346 | Open in IMG/M |
| 3300021963|Ga0222712_10525301 | Not Available | 696 | Open in IMG/M |
| 3300022179|Ga0181353_1120028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus → Streptococcus pseudopneumoniae | 630 | Open in IMG/M |
| 3300022190|Ga0181354_1229318 | Not Available | 539 | Open in IMG/M |
| 3300022190|Ga0181354_1243164 | Not Available | 516 | Open in IMG/M |
| 3300022190|Ga0181354_1252839 | Not Available | 501 | Open in IMG/M |
| 3300022200|Ga0196901_1008267 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4502 | Open in IMG/M |
| 3300022407|Ga0181351_1168113 | Not Available | 769 | Open in IMG/M |
| 3300022407|Ga0181351_1264744 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 526 | Open in IMG/M |
| 3300022752|Ga0214917_10238816 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300023184|Ga0214919_10371179 | Not Available | 943 | Open in IMG/M |
| 3300023184|Ga0214919_10584118 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 663 | Open in IMG/M |
| 3300023184|Ga0214919_10615128 | Not Available | 637 | Open in IMG/M |
| 3300024351|Ga0255141_1068988 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus → Streptococcus pseudopneumoniae | 513 | Open in IMG/M |
| 3300024355|Ga0255157_1012194 | Not Available | 1549 | Open in IMG/M |
| 3300024513|Ga0255144_1072914 | Not Available | 567 | Open in IMG/M |
| 3300024550|Ga0255266_1051281 | Not Available | 998 | Open in IMG/M |
| 3300024572|Ga0255268_1160776 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus → Streptococcus pseudopneumoniae | 557 | Open in IMG/M |
| 3300025445|Ga0208424_1009306 | All Organisms → Viruses → Predicted Viral | 1103 | Open in IMG/M |
| 3300025646|Ga0208161_1117705 | Not Available | 706 | Open in IMG/M |
| 3300025655|Ga0208795_1051324 | All Organisms → Viruses → Predicted Viral | 1218 | Open in IMG/M |
| 3300025896|Ga0208916_10033559 | All Organisms → Viruses → Predicted Viral | 2070 | Open in IMG/M |
| 3300026415|Ga0256298_1039244 | Not Available | 642 | Open in IMG/M |
| 3300026993|Ga0209975_1003566 | All Organisms → Viruses → Predicted Viral | 1485 | Open in IMG/M |
| 3300027121|Ga0255074_1038984 | Not Available | 590 | Open in IMG/M |
| 3300027337|Ga0255087_1067691 | Not Available | 648 | Open in IMG/M |
| 3300027393|Ga0209867_1034759 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 740 | Open in IMG/M |
| 3300027491|Ga0255097_1006574 | Not Available | 2987 | Open in IMG/M |
| 3300027529|Ga0255077_1008409 | Not Available | 1832 | Open in IMG/M |
| 3300027529|Ga0255077_1022209 | All Organisms → Viruses → Predicted Viral | 1150 | Open in IMG/M |
| 3300027538|Ga0255085_1079223 | Not Available | 692 | Open in IMG/M |
| 3300027538|Ga0255085_1098948 | Not Available | 604 | Open in IMG/M |
| 3300027608|Ga0208974_1067615 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 996 | Open in IMG/M |
| 3300027608|Ga0208974_1109204 | Not Available | 731 | Open in IMG/M |
| 3300027659|Ga0208975_1072482 | Not Available | 1028 | Open in IMG/M |
| 3300027659|Ga0208975_1085311 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 930 | Open in IMG/M |
| 3300027679|Ga0209769_1191768 | Not Available | 636 | Open in IMG/M |
| 3300027679|Ga0209769_1193076 | Not Available | 633 | Open in IMG/M |
| 3300027688|Ga0209553_1065329 | Not Available | 1386 | Open in IMG/M |
| 3300027721|Ga0209492_1282254 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
| 3300027744|Ga0209355_1033678 | All Organisms → Viruses → Predicted Viral | 2568 | Open in IMG/M |
| 3300027744|Ga0209355_1359820 | Not Available | 531 | Open in IMG/M |
| 3300027749|Ga0209084_1375519 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 515 | Open in IMG/M |
| 3300027754|Ga0209596_1054891 | All Organisms → Viruses → Predicted Viral | 2060 | Open in IMG/M |
| 3300027759|Ga0209296_1107279 | Not Available | 1322 | Open in IMG/M |
| 3300027759|Ga0209296_1124329 | Not Available | 1196 | Open in IMG/M |
| 3300027785|Ga0209246_10237967 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 706 | Open in IMG/M |
| 3300027792|Ga0209287_10202457 | Not Available | 757 | Open in IMG/M |
| 3300027793|Ga0209972_10454370 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 534 | Open in IMG/M |
| 3300027805|Ga0209229_10099263 | All Organisms → Viruses → Predicted Viral | 1311 | Open in IMG/M |
| 3300027805|Ga0209229_10520782 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 506 | Open in IMG/M |
| 3300027806|Ga0209985_10221869 | Not Available | 889 | Open in IMG/M |
| 3300027808|Ga0209354_10022385 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2518 | Open in IMG/M |
| 3300027808|Ga0209354_10065101 | Not Available | 1475 | Open in IMG/M |
| 3300027816|Ga0209990_10027551 | All Organisms → Viruses → Predicted Viral | 3094 | Open in IMG/M |
| 3300027816|Ga0209990_10121003 | Not Available | 1257 | Open in IMG/M |
| 3300027816|Ga0209990_10485429 | Not Available | 524 | Open in IMG/M |
| 3300027892|Ga0209550_10328316 | Not Available | 972 | Open in IMG/M |
| 3300027892|Ga0209550_10455346 | Not Available | 778 | Open in IMG/M |
| 3300027892|Ga0209550_10593456 | Not Available | 651 | Open in IMG/M |
| 3300027956|Ga0209820_1180804 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 587 | Open in IMG/M |
| 3300027972|Ga0209079_10266994 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 582 | Open in IMG/M |
| 3300027972|Ga0209079_10278782 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 568 | Open in IMG/M |
| 3300027973|Ga0209298_10138994 | All Organisms → Viruses → Predicted Viral | 1030 | Open in IMG/M |
| 3300028025|Ga0247723_1000536 | Not Available | 25897 | Open in IMG/M |
| 3300028025|Ga0247723_1005733 | Not Available | 5543 | Open in IMG/M |
| 3300028083|Ga0255190_1056801 | Not Available | 584 | Open in IMG/M |
| (restricted) 3300028553|Ga0247839_1044134 | All Organisms → Viruses → Predicted Viral | 2649 | Open in IMG/M |
| 3300029697|Ga0256301_1080697 | Not Available | 561 | Open in IMG/M |
| 3300029930|Ga0119944_1018150 | Not Available | 978 | Open in IMG/M |
| 3300029933|Ga0119945_1009788 | All Organisms → Viruses → Predicted Viral | 1254 | Open in IMG/M |
| 3300031673|Ga0307377_10408874 | All Organisms → Viruses → Predicted Viral | 1006 | Open in IMG/M |
| 3300031707|Ga0315291_10179220 | All Organisms → Viruses → Predicted Viral | 2183 | Open in IMG/M |
| 3300031758|Ga0315907_10231893 | Not Available | 1537 | Open in IMG/M |
| 3300031758|Ga0315907_10377510 | Not Available | 1147 | Open in IMG/M |
| 3300031758|Ga0315907_10398171 | All Organisms → Viruses → Predicted Viral | 1110 | Open in IMG/M |
| 3300031758|Ga0315907_10761901 | Not Available | 728 | Open in IMG/M |
| 3300031758|Ga0315907_10780896 | Not Available | 716 | Open in IMG/M |
| 3300031758|Ga0315907_10883222 | Not Available | 658 | Open in IMG/M |
| 3300031758|Ga0315907_10959569 | Not Available | 621 | Open in IMG/M |
| 3300031758|Ga0315907_10969597 | Not Available | 617 | Open in IMG/M |
| 3300031784|Ga0315899_10000729 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 39008 | Open in IMG/M |
| 3300031784|Ga0315899_11571704 | Not Available | 547 | Open in IMG/M |
| 3300031787|Ga0315900_10234097 | Not Available | 1587 | Open in IMG/M |
| 3300031787|Ga0315900_10290079 | Not Available | 1364 | Open in IMG/M |
| 3300031787|Ga0315900_10366180 | Not Available | 1155 | Open in IMG/M |
| 3300031787|Ga0315900_10686613 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 728 | Open in IMG/M |
| 3300031857|Ga0315909_10028276 | Not Available | 5487 | Open in IMG/M |
| 3300031857|Ga0315909_10044319 | All Organisms → Viruses → Predicted Viral | 4176 | Open in IMG/M |
| 3300031857|Ga0315909_10087627 | All Organisms → Viruses → Predicted Viral | 2725 | Open in IMG/M |
| 3300031857|Ga0315909_10176659 | All Organisms → Viruses → Predicted Viral | 1721 | Open in IMG/M |
| 3300031857|Ga0315909_10193557 | All Organisms → Viruses → Predicted Viral | 1620 | Open in IMG/M |
| 3300031857|Ga0315909_10354117 | All Organisms → Viruses → Predicted Viral | 1071 | Open in IMG/M |
| 3300031857|Ga0315909_10354310 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1071 | Open in IMG/M |
| 3300031857|Ga0315909_10354649 | Not Available | 1070 | Open in IMG/M |
| 3300031857|Ga0315909_10389087 | All Organisms → Viruses → Predicted Viral | 1003 | Open in IMG/M |
| 3300031857|Ga0315909_10477298 | Not Available | 868 | Open in IMG/M |
| 3300031857|Ga0315909_10488193 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 854 | Open in IMG/M |
| 3300031857|Ga0315909_10547955 | Not Available | 786 | Open in IMG/M |
| 3300031857|Ga0315909_10691052 | Not Available | 664 | Open in IMG/M |
| 3300031857|Ga0315909_10703541 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 655 | Open in IMG/M |
| 3300031857|Ga0315909_10768587 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300031951|Ga0315904_10039726 | All Organisms → cellular organisms → Bacteria | 5367 | Open in IMG/M |
| 3300031951|Ga0315904_10117039 | All Organisms → Viruses → Predicted Viral | 2766 | Open in IMG/M |
| 3300031951|Ga0315904_10127705 | All Organisms → Viruses → Predicted Viral | 2617 | Open in IMG/M |
| 3300031951|Ga0315904_11167631 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 594 | Open in IMG/M |
| 3300031963|Ga0315901_10261610 | All Organisms → Viruses → Predicted Viral | 1456 | Open in IMG/M |
| 3300031963|Ga0315901_10308867 | All Organisms → Viruses → Predicted Viral | 1306 | Open in IMG/M |
| 3300031963|Ga0315901_10594834 | Not Available | 841 | Open in IMG/M |
| 3300031963|Ga0315901_11025308 | Not Available | 574 | Open in IMG/M |
| 3300031963|Ga0315901_11045266 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 566 | Open in IMG/M |
| 3300031963|Ga0315901_11239816 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
| 3300031997|Ga0315278_11320673 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 702 | Open in IMG/M |
| 3300031999|Ga0315274_10501074 | Not Available | 1373 | Open in IMG/M |
| 3300032050|Ga0315906_10015905 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 8519 | Open in IMG/M |
| 3300032050|Ga0315906_10181453 | All Organisms → Viruses → Predicted Viral | 2001 | Open in IMG/M |
| 3300032050|Ga0315906_10491698 | All Organisms → Viruses → Predicted Viral | 1040 | Open in IMG/M |
| 3300032050|Ga0315906_10515939 | Not Available | 1007 | Open in IMG/M |
| 3300032050|Ga0315906_10562485 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300032050|Ga0315906_10827553 | Not Available | 722 | Open in IMG/M |
| 3300032050|Ga0315906_10858499 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 703 | Open in IMG/M |
| 3300032050|Ga0315906_11190540 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 553 | Open in IMG/M |
| 3300032092|Ga0315905_10011555 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8956 | Open in IMG/M |
| 3300032092|Ga0315905_10712767 | Not Available | 888 | Open in IMG/M |
| 3300032092|Ga0315905_11145452 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 640 | Open in IMG/M |
| 3300032093|Ga0315902_10432490 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1175 | Open in IMG/M |
| 3300032093|Ga0315902_10983900 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 636 | Open in IMG/M |
| 3300032116|Ga0315903_10016090 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 8500 | Open in IMG/M |
| 3300032116|Ga0315903_10090075 | All Organisms → Viruses → Predicted Viral | 2962 | Open in IMG/M |
| 3300032116|Ga0315903_10097266 | All Organisms → Viruses → Predicted Viral | 2821 | Open in IMG/M |
| 3300032116|Ga0315903_10116135 | All Organisms → Viruses → Predicted Viral | 2522 | Open in IMG/M |
| 3300032116|Ga0315903_10340117 | Not Available | 1248 | Open in IMG/M |
| 3300032116|Ga0315903_10446767 | All Organisms → Viruses → Predicted Viral | 1038 | Open in IMG/M |
| 3300032116|Ga0315903_10509412 | Not Available | 948 | Open in IMG/M |
| 3300032116|Ga0315903_10970417 | Not Available | 598 | Open in IMG/M |
| 3300033993|Ga0334994_0275325 | Not Available | 868 | Open in IMG/M |
| 3300033993|Ga0334994_0292734 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 831 | Open in IMG/M |
| 3300033993|Ga0334994_0303018 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 811 | Open in IMG/M |
| 3300033996|Ga0334979_0513635 | Not Available | 647 | Open in IMG/M |
| 3300034012|Ga0334986_0107229 | All Organisms → Viruses → Predicted Viral | 1665 | Open in IMG/M |
| 3300034012|Ga0334986_0150645 | All Organisms → Viruses → Predicted Viral | 1342 | Open in IMG/M |
| 3300034019|Ga0334998_0048978 | Not Available | 2954 | Open in IMG/M |
| 3300034019|Ga0334998_0426328 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 755 | Open in IMG/M |
| 3300034020|Ga0335002_0184521 | Not Available | 1313 | Open in IMG/M |
| 3300034061|Ga0334987_0226785 | Not Available | 1291 | Open in IMG/M |
| 3300034061|Ga0334987_0260520 | Not Available | 1175 | Open in IMG/M |
| 3300034062|Ga0334995_0584817 | Not Available | 652 | Open in IMG/M |
| 3300034066|Ga0335019_0601869 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 643 | Open in IMG/M |
| 3300034071|Ga0335028_0312205 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 928 | Open in IMG/M |
| 3300034071|Ga0335028_0649446 | Not Available | 559 | Open in IMG/M |
| 3300034092|Ga0335010_0540186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus → Streptococcus pseudopneumoniae | 604 | Open in IMG/M |
| 3300034092|Ga0335010_0623095 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 543 | Open in IMG/M |
| 3300034101|Ga0335027_0407754 | Not Available | 879 | Open in IMG/M |
| 3300034102|Ga0335029_0452685 | Not Available | 759 | Open in IMG/M |
| 3300034102|Ga0335029_0608347 | Not Available | 611 | Open in IMG/M |
| 3300034104|Ga0335031_0831200 | Not Available | 513 | Open in IMG/M |
| 3300034106|Ga0335036_0445567 | Not Available | 820 | Open in IMG/M |
| 3300034106|Ga0335036_0696392 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 602 | Open in IMG/M |
| 3300034118|Ga0335053_0135672 | All Organisms → Viruses → Predicted Viral | 1673 | Open in IMG/M |
| 3300034119|Ga0335054_0497036 | Not Available | 682 | Open in IMG/M |
| 3300034120|Ga0335056_0121051 | All Organisms → Viruses → Predicted Viral | 1585 | Open in IMG/M |
| 3300034122|Ga0335060_0382548 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 749 | Open in IMG/M |
| 3300034272|Ga0335049_0669133 | Not Available | 633 | Open in IMG/M |
| 3300034279|Ga0335052_0327831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus → Streptococcus pseudopneumoniae | 837 | Open in IMG/M |
| 3300034283|Ga0335007_0367971 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 913 | Open in IMG/M |
| 3300034283|Ga0335007_0516950 | Not Available | 712 | Open in IMG/M |
| 3300034283|Ga0335007_0726717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus → Streptococcus pseudopneumoniae | 551 | Open in IMG/M |
| 3300034284|Ga0335013_0479532 | Not Available | 749 | Open in IMG/M |
| 3300034523|Ga0310143_08856 | Not Available | 1221 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 20.12% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 18.58% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 15.17% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 7.74% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.33% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 4.33% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 4.64% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.72% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.41% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.79% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.17% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.17% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.24% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.24% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.93% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.62% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.62% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 0.62% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.62% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.62% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.62% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.31% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.31% |
| Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 0.31% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.31% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.31% |
| Lotic | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Lotic | 0.31% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.31% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.31% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.31% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.31% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.31% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.31% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000206 | Lotic microbial communities from Mississippi River at two locations in the state of Minnesota, sample from River Site 1, Mississippi Headwaters | Environmental | Open in IMG/M |
| 3300000558 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011 | Engineered | Open in IMG/M |
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300001839 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM40, ROCA_DNA238_2.0um_Ob_C_3b | Environmental | Open in IMG/M |
| 3300002201 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - SEP 2013 | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300004096 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2) | Environmental | Open in IMG/M |
| 3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
| 3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005940 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007216 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface and Bottom layer) 16 sequencing projects | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
| 3300008265 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0126-100-LTR | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300010156 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel2S_0400h metaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300011009 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_DNA | Environmental | Open in IMG/M |
| 3300011116 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Nov | Environmental | Open in IMG/M |
| 3300011381 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel7S_1600h metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
| 3300012734 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES144 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013122 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10.3m | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
| 3300013137 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1m | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020557 | Freshwater microbial communities from Lake Mendota, WI - 15JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020570 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020603 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015035 Kigoma Deep Cast 150m | Environmental | Open in IMG/M |
| 3300021093 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015023 Mahale A surface | Environmental | Open in IMG/M |
| 3300021376 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface | Environmental | Open in IMG/M |
| 3300021424 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surface | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024351 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_0h | Environmental | Open in IMG/M |
| 3300024355 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8h | Environmental | Open in IMG/M |
| 3300024513 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8h | Environmental | Open in IMG/M |
| 3300024550 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024572 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025445 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026415 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026993 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel4S_1600h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027121 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8h | Environmental | Open in IMG/M |
| 3300027337 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8d | Environmental | Open in IMG/M |
| 3300027393 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 (SPAdes) | Environmental | Open in IMG/M |
| 3300027491 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8d | Environmental | Open in IMG/M |
| 3300027529 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8h | Environmental | Open in IMG/M |
| 3300027538 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8d | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027688 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027744 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027792 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027806 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027972 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028083 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300028553 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_16m | Environmental | Open in IMG/M |
| 3300029697 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
| 3300029933 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727_2 | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
| 3300034020 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| 3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
| 3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| 3300034279 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| 3300034523 | Fracking water microbial communities from deep shales in Oklahoma, United States - K-4-A | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| M3P_100119851 | 3300000206 | Lotic | MKPVAKKATPAAIAVLRQATALRPKRKKASDGLLPSAAHINQNP |
| Draft_114426031 | 3300000558 | Hydrocarbon Resource Environments | MKPVVKKATPAAIAVLRQATAISPSRKKASDGLLPSAAHISQSPN |
| JGI12421J11937_101559651 | 3300000756 | Freshwater And Sediment | MSAIAKRACPAAIAVLRQATALRPKRMKASDGLLPSKAHITQS |
| RCM40_10790081 | 3300001839 | Marine Plankton | MKPVIGKATPAAASVLLQATALYPKRKKTSDGLLPSK |
| metazooDRAFT_12613561 | 3300002201 | Lake | MKPLAKKPSPAAVAALRQATALAPKRAKASDGLLPSAAHLV |
| B570J29032_1099147211 | 3300002408 | Freshwater | VRATPAAMAVLRQATALKPLRKKLSDGLLPSAAHQVQ |
| B570J40625_1009233181 | 3300002835 | Freshwater | MKLLAKRATPAAIAVLRQATALYPKRKKLSDGLLPSSAHIKQ |
| JGI25907J50239_10523221 | 3300003394 | Freshwater Lake | MSVVKKATPAAIAVLRQATALKPNRNKASDGLLPSAAHLS |
| Ga0066177_103895143 | 3300004096 | Freshwater Lake | MTSAKTVRQATPAAIAVLRQATALKPKRMKASDGLLPSAAHIKQSP |
| Ga0068877_107357751 | 3300005525 | Freshwater Lake | MKKTVIGKATPAAIAVLRQATAIAPKRMKASDGLLPSAAHLK |
| Ga0068876_100166698 | 3300005527 | Freshwater Lake | MKSVVKKATPAAIAVLRQATAIAPLRMKASDGLLPSNAH |
| Ga0068876_106076731 | 3300005527 | Freshwater Lake | MKPVVKRATPAAIAVLRQATAIAPLRKKVSDGLLPSK |
| Ga0068876_106319371 | 3300005527 | Freshwater Lake | MTTVAKRATPAAIAVLRQATALRPNRKKASDGLLPSAA |
| Ga0049081_100668094 | 3300005581 | Freshwater Lentic | MKPVAKKATPAAIAVLRQATAIKPSRKKASDGLLPSAAHIKQSPT |
| Ga0049081_101254161 | 3300005581 | Freshwater Lentic | MKPVAKVASPAAIAVLRQATALFPKRKKLSDGLLPSLAH |
| Ga0049080_101077563 | 3300005582 | Freshwater Lentic | MKPVAKVASPAAIAVLRQATALFPKRKKLSDGLLPSLAHQ |
| Ga0049085_102010194 | 3300005583 | Freshwater Lentic | MSVVKKATPAAIAVLRQATALKPKRKKASDGLLPSAAH |
| Ga0049084_101873392 | 3300005585 | Freshwater Lentic | MKPVVKSATPAAIAVLRQATALVPNRKKASDGLLPSKAH |
| Ga0078894_104892095 | 3300005662 | Freshwater Lake | MTTVAKRATPAALAVLRQATALQPKRKKASDGLLPSAA |
| Ga0073913_100825373 | 3300005940 | Sand | MKTLVKKATPAAIAVLRQATAIKPSRKKASDGLLPSAAHINQN |
| Ga0075464_103506831 | 3300006805 | Aqueous | MKPVVKRATPAAIAVLRQATAIKPSRKKASDGLLPSAAHVNQNP |
| Ga0075464_109457243 | 3300006805 | Aqueous | MSAMIAKRATPAAIAVLRQATAHCPKRKKASDGLLPSKAHISA |
| Ga0075473_100735771 | 3300006875 | Aqueous | MKPLAKSATPAAVAVLRQATALAPKRKKASDGLLPSKAHIKA |
| Ga0075473_103468571 | 3300006875 | Aqueous | MKPVVKSATPAALAVLRQATALVPKRKKASDGLLPSKAHIKASPN |
| Ga0103961_12516751 | 3300007216 | Freshwater Lake | MKPLAKVASPAAIAALRQATALWPRRKKASDGLLP |
| Ga0070753_10559491 | 3300007346 | Aqueous | VKPVAKRATPAAIAVLRQATALVPKRNKISDGLLPSKAHIKANPNS |
| Ga0099846_10208771 | 3300007542 | Aqueous | MIAKKASPAALAVLRQATAIAPKRKKASDGLLPSVAH |
| Ga0099846_10577341 | 3300007542 | Aqueous | MIAKKASPAAIAVLRQATALSPKRKKLSDGLLPSAAHQK |
| Ga0099846_11921053 | 3300007542 | Aqueous | MKKFAKVATPAAIAVLRQATAISPSRKKASDGLLPSAAHRKQSPNS |
| Ga0099846_12008431 | 3300007542 | Aqueous | MSKPKVAKVASPAALSMLRQATALAPLRKKASDGLL |
| Ga0105746_12165533 | 3300007973 | Estuary Water | MKPVAKKATPAAIAVLRQATAIKPSRKKASDGLLPSAAHIKQS |
| Ga0105747_13102671 | 3300007974 | Estuary Water | MKATPAALAVLRQATALRPKRKKASDGLLPSVAHQKQNPDS |
| Ga0108970_113659375 | 3300008055 | Estuary | MKPTVAKKATPAAVAVLRQATALAPKRKKASDGLL |
| Ga0114340_10039491 | 3300008107 | Freshwater, Plankton | MIPLAKKATPAAIAVLRQATTHFPKRKKASDGLLPSK |
| Ga0114340_10386031 | 3300008107 | Freshwater, Plankton | MTTVAKKATPAAIAVLRQATALRPKRKKASDGLLPSAAHLK |
| Ga0114340_10453834 | 3300008107 | Freshwater, Plankton | MKPVAKKATPAAIAVLRQATAIVPLRMKASDGLLPSN |
| Ga0114340_10670594 | 3300008107 | Freshwater, Plankton | VKLAKKATPAAVAVLRQATALKPLRKKLSDGLLPSAA |
| Ga0114340_10699751 | 3300008107 | Freshwater, Plankton | MKNVVKKATPAAIAVLRQATAIAPLRMKASDGLLPS |
| Ga0114340_10973313 | 3300008107 | Freshwater, Plankton | MKTVAKKATPAAIAVLRQATALAPKRKKASDGLLPSAAHLKA |
| Ga0114340_11132783 | 3300008107 | Freshwater, Plankton | MIIAKTATPAAKSVLRQATALRPKRMKASDGLLPSKDH |
| Ga0114341_102451134 | 3300008108 | Freshwater, Plankton | MKPVVKRATPAAIAVLRQATAIAPLRKKASDGLLPSAAHIHQN |
| Ga0114341_105113083 | 3300008108 | Freshwater, Plankton | MNRIAKKPTPAALAVLRQATAVKPKRKKLSDGLLPSAAHI |
| Ga0114343_10618117 | 3300008110 | Freshwater, Plankton | MKLAKRATPAAIAVLRQATALRPKRKKASDGLLPSAAHV |
| Ga0114346_11795211 | 3300008113 | Freshwater, Plankton | MKLAKKATPAAVAVLRQATALKPLRKKLSDGLLPSAAH |
| Ga0114347_12639663 | 3300008114 | Freshwater, Plankton | MTTVAKKATPAAIAVLRQATALRPKRKKASDGLLPSAAHL |
| Ga0114350_10110331 | 3300008116 | Freshwater, Plankton | MTTVAKRATPAAIAVLRQATALRPKRKKASDGLLPSAAH |
| Ga0114350_10646223 | 3300008116 | Freshwater, Plankton | MKGVVKRATPAAIALLRQATALVPKRSKVSDGLLP |
| Ga0114350_11090351 | 3300008116 | Freshwater, Plankton | MKPVVAKKATPAAIAVLRQATALSPKRKKLSDGLLP |
| Ga0114355_10101371 | 3300008120 | Freshwater, Plankton | MIPLAKRPSNAAVALLRQATALAPKRKKASDGLLPSAA |
| Ga0114355_10462984 | 3300008120 | Freshwater, Plankton | MKPVAKRATPAAIAVLRQATALYPSRKKASDGLLP |
| Ga0114355_10504211 | 3300008120 | Freshwater, Plankton | MKGVVKRATPAAIALLRQATALVPKRSKVSDGLLPSAAHLSQ |
| Ga0114355_11655901 | 3300008120 | Freshwater, Plankton | MKGVAKRATPAAIALLRQATALVPKRSKVSDGLLPSAAHLSQ |
| Ga0114337_12677301 | 3300008262 | Freshwater, Plankton | MKPVAKTATPAAKSVLRQATKLWPKRAKASDGLLPSAAHLAA |
| Ga0114361_11494953 | 3300008265 | Freshwater, Plankton | MKPVVKSATPAAIAVLRQATALVPNRKKASDGLLPSKAHIKASP |
| Ga0114363_10242174 | 3300008266 | Freshwater, Plankton | MTVAKKATPAAIAVLRQATALRPNRKKASDGLLPSAAHLKA |
| Ga0114363_10288491 | 3300008266 | Freshwater, Plankton | MTKPKVAKSASPAALSMLRQATALAPLRKKASDGLLP |
| Ga0114363_10592361 | 3300008266 | Freshwater, Plankton | MATVAKKATPAAIAVLRQATALRPKRKRASDGLLPSAAHLKASPT |
| Ga0114363_10850801 | 3300008266 | Freshwater, Plankton | MVVNMKKVVKVASPAAIAVLRQATAIAPKRMKASDGLLPSAAHLK |
| Ga0114876_10550921 | 3300008448 | Freshwater Lake | MKPVAKSATPAAIAVLRQATALVPKRNKASDGLLPSK |
| Ga0114876_10589843 | 3300008448 | Freshwater Lake | MIPLAKKATPAAIAVLRQATAIWPKRMKASDGLLPSKAHVHQNP |
| Ga0114876_11145341 | 3300008448 | Freshwater Lake | MIPLVKKATPAAIAVLRQATAIWPKRKKASDGLLPSKAHVHQ |
| Ga0114876_11402643 | 3300008448 | Freshwater Lake | MIPLAKKATPAAIAVLRQATAIWPKRKKASDGLLPSK |
| Ga0114876_12369621 | 3300008448 | Freshwater Lake | MKSVVKKATPAAIAVLRQATAIAPLRMKASDGLLPSNA |
| Ga0114880_10857861 | 3300008450 | Freshwater Lake | MATVAKKATPAAIAVLRQATALRPKRKRASDGLLPSAAHL |
| Ga0105098_101361031 | 3300009081 | Freshwater Sediment | MIPLAKFPQPAAVALLRQATALAPKRMKASDGLLPSAAHVH |
| Ga0114968_103630863 | 3300009155 | Freshwater Lake | MIALAKRATPAAIAVLRQATAHFPKRKKASDGLLPS |
| Ga0114978_103190131 | 3300009159 | Freshwater Lake | MKTPVKKATPAAIAVLRQATAIKPSRKKASDGLLPSAAHI |
| Ga0114981_102489211 | 3300009160 | Freshwater Lake | MIPLAKKASPAAIAVLRQATALRPKRKKASDGLLPSAAH |
| Ga0114981_102837571 | 3300009160 | Freshwater Lake | MIPLAKAATPAAIAVLRQATALKPKRKKASDGLLPSKAH |
| Ga0114981_107480183 | 3300009160 | Freshwater Lake | MIPLARAAQPAAIAILRQATALFPKRLKASDGLLPSKAH |
| Ga0105096_105811593 | 3300009170 | Freshwater Sediment | MKPVAKRATPAAIAVLRQATAISPSRKKASDGLLPSAAHIKQS |
| Ga0114974_102058793 | 3300009183 | Freshwater Lake | MIALAKRATPAAIAVLRQATAHFPKRNKASDGLLPSAAH |
| Ga0114974_103530421 | 3300009183 | Freshwater Lake | MIALAKRATPAAIAVLRQATAHFPKRKKASDGLLPSA |
| Ga0114982_12528291 | 3300009419 | Deep Subsurface | MTTIAKKATPAAIAVLRQATAISPSRKKASDGLLP |
| Ga0068873_10364661 | 3300010156 | Freshwater Lake | MKPVAKRATPAAIAVLRQATALAPKRNKASDGLLPSKA |
| Ga0129333_104841123 | 3300010354 | Freshwater To Marine Saline Gradient | MKPVVKVASPAAIAVLRQATALFPKRKKLSDGLLPSLAHQKASPNS |
| Ga0129333_106087951 | 3300010354 | Freshwater To Marine Saline Gradient | MNKPKVARVASPAAIAMLRQATALAPLRKKASDGLLPSTAH |
| Ga0129333_110044304 | 3300010354 | Freshwater To Marine Saline Gradient | MKPLAKKPSAAAVAMLRQATALAPKRLKASDGLLPSAA |
| Ga0129333_112674673 | 3300010354 | Freshwater To Marine Saline Gradient | MKTKVVKVASPAAIAVLRQATALWPKRKKLSDGLLPSSAHLAASPN |
| Ga0129333_113753093 | 3300010354 | Freshwater To Marine Saline Gradient | MVVNLKKVVRVATPAAIAVLRQATAIAPKRNKASDGLLPSAAH |
| Ga0129333_114410201 | 3300010354 | Freshwater To Marine Saline Gradient | MKPVAKVASPAAIAVLRQATALSPKRKKLSDGLLPSAAH |
| Ga0129333_115237801 | 3300010354 | Freshwater To Marine Saline Gradient | MKPVAKKATPAAIAMLRQATALAPKRSKVSDGLLPSAAHLKTNPN |
| Ga0129336_102345965 | 3300010370 | Freshwater To Marine Saline Gradient | MKPVTKKATPAAIAVLRQATALSPKRKKLSDGLLPSAAHLKAS |
| Ga0129336_104953411 | 3300010370 | Freshwater To Marine Saline Gradient | MKPLAKKPSPAAVAALRQATALAPKRAKASDGLLPSAAHLVQNPDS |
| Ga0129336_105399653 | 3300010370 | Freshwater To Marine Saline Gradient | MKPKVATSASPAAIAMLRQATALAPLRKKASDGLLPSIAHL |
| Ga0129336_105730302 | 3300010370 | Freshwater To Marine Saline Gradient | MVVNLKKLVKVATPAAIAVLRQATAIAPKRKKASDGLLPSAAHI |
| Ga0129336_106607541 | 3300010370 | Freshwater To Marine Saline Gradient | MVVNLKKVVRVATPAAIAVLRQATAIAPKRNKASDGLLPSAAHIK |
| Ga0129336_107496503 | 3300010370 | Freshwater To Marine Saline Gradient | MKPVTKKATPAAIAMLRQATALAPKRSKVSDGLLPSAAHLKT |
| Ga0129318_100554023 | 3300011009 | Freshwater To Marine Saline Gradient | MTMSKATPAAIAVLRQATALRPKRKKASDGLLPSAAHMKQSPTS |
| Ga0151516_1118715 | 3300011116 | Freshwater | MIPLAKKATPAAIAVLRQATAIWPKRMKASDGLLPSKAHVHQ |
| Ga0102688_16845281 | 3300011381 | Freshwater Lake | MKPVTKKATPAAIAVLRQATALSPKRKKLSDGLLPS |
| Ga0153801_10657981 | 3300012017 | Freshwater | MKPTVAKKATPAAIAVLRQATALKPKRKKASDGLLP |
| Ga0157498_10378743 | 3300012666 | Freshwater, Surface Ice | MKPVVKKATPAAIAVLRQATALFPKRKKASDGLLP |
| Ga0157615_12396863 | 3300012734 | Freshwater | MKPVVKKATPAATAVLRQATAIAPSRLKVSDGLLPSKLHQAQNP |
| Ga0164293_103771424 | 3300013004 | Freshwater | MKIVKKASPAAISVLRQATAIKPTRNKLSDGLLPSAAHLKAS |
| Ga0164293_104539901 | 3300013004 | Freshwater | MTTVVKKATPAAVAVLRQATALKPKRKKASDGLLPS |
| Ga0164293_106099362 | 3300013004 | Freshwater | MDVNMNAKKATPAAIAVLRQATAIKPTRNKLSDGLLPSAAHLKAS |
| Ga0164292_102673521 | 3300013005 | Freshwater | MTTVAKKATPAAIAVLRQATALRPKRKKASDGLLPSAAHLSQSPN |
| Ga0164292_110321801 | 3300013005 | Freshwater | VVVDMTKVVKKATPAAIAVLRQATALWPKRKKASD |
| (restricted) Ga0172374_10316144 | 3300013122 | Freshwater | MKPVAKVASPAAIAVLRQATALFPKRKKLSDGLLPSLAHQKA |
| (restricted) Ga0172367_101002931 | 3300013126 | Freshwater | MKPVAKVASPAAIAVLRQATALFPKRKKLSDGLLPS |
| (restricted) Ga0172373_106607321 | 3300013131 | Freshwater | MKPLVKVASPAAIAVLRQATALFPKRKKLSDGLLP |
| (restricted) Ga0172372_101269273 | 3300013132 | Freshwater | MKPVAKVASPAAIAVLRQATALFPKRKKLSDGLLPSLAHQKAS |
| (restricted) Ga0172375_109266443 | 3300013137 | Freshwater | MSKPKVAKVASPAAIAMLRQATALAPLRKKASDGLLPSTAH |
| Ga0170791_113002243 | 3300013295 | Freshwater | MKTLVKKATPAAIAVLRQATAIKPLRKKLSDGLLPSAAHQIQNPDSD |
| Ga0177922_108352791 | 3300013372 | Freshwater | MKPVVKVASPAAIAVLRQATALYPKRKKLSDGLLP |
| Ga0177922_111475993 | 3300013372 | Freshwater | MKPVAKKATPAAIAVLRQATAIKPSRKKASDGLLPSA |
| Ga0177922_111652231 | 3300013372 | Freshwater | VKPVAKRATPAAIAVLRQATALAPKRNKASDGLLPSKAHIK |
| Ga0181363_10275631 | 3300017707 | Freshwater Lake | MKPVAKVASPAAIAVLRQATALFPKRKKLSDGLLPSLAHQK |
| Ga0181347_10970445 | 3300017722 | Freshwater Lake | MIPLARAAQPAAIAILRQATALYPKRLKASDGLLPSKAHI |
| Ga0181347_11199602 | 3300017722 | Freshwater Lake | MKPVVKVASPAAIAVLRQATALYPKRKKLSDGLLPSLAHQKASPN |
| Ga0181347_12138132 | 3300017722 | Freshwater Lake | MKTVAKVASPAAIAVLRQATALYPKRKKLSDGLLPSLAHQKASPN |
| Ga0181362_10098303 | 3300017723 | Freshwater Lake | MIALAKRATPAAIAVLRQATAHFPKRKKASDGLLPSAAHVHQ |
| Ga0181365_10018221 | 3300017736 | Freshwater Lake | MKRLAKKATPAAIAVLRQATAIKPSRKKASDGLLPSAA |
| Ga0181365_11626311 | 3300017736 | Freshwater Lake | MKLIAKKAAPAAIAVLRQATALYPKRKKLSDGLLPSLAHIKQSP |
| Ga0181352_10135033 | 3300017747 | Freshwater Lake | MIPLARVAQPAAIAVLRQATALRPKRKKASDGLLPSKAHIHQNP |
| Ga0181352_11986111 | 3300017747 | Freshwater Lake | MKKLAKKATPAAIAVLRQATAISPSRKKASDGLLPSAA |
| Ga0181344_11435463 | 3300017754 | Freshwater Lake | MKPVVKKATPAAIAVLRQATAISPLRMKASDGLLPS |
| Ga0181356_10779994 | 3300017761 | Freshwater Lake | VKATPAATAVLRQATALRPLRKKLSDGLLPSAAHQVQNPKS |
| Ga0181356_11259363 | 3300017761 | Freshwater Lake | VRTVAKVASPAAIAVLRQATALYPKRKKLSDGLLPSLAHQKASP |
| Ga0181343_11964493 | 3300017766 | Freshwater Lake | MTTVAKKATPAAIAVLRQATALRPKRKKASDGLLPSAAHLTQSPN |
| Ga0181358_10206471 | 3300017774 | Freshwater Lake | MKPVVKKATPAAVAVLRQATALFPKRKKASDGLLPSAAH |
| Ga0181358_10997291 | 3300017774 | Freshwater Lake | MKPVVKKATPAAIAVLRQATAIKPSRKKASDGLLPSAAHIKQSPD |
| Ga0181358_11919912 | 3300017774 | Freshwater Lake | MTTVVKKATPAAIAVLRQATALKPKRKKASDGLLPSAA |
| Ga0181358_12357841 | 3300017774 | Freshwater Lake | MTVKLVKKATPAAIAVLRQATALKPKRMKASDGLLPSAAHLKQSPT |
| Ga0181357_10546631 | 3300017777 | Freshwater Lake | MIPLAKKATPAAIAALRQATAHFPKRKKASDGLLPSAAH |
| Ga0181357_12006163 | 3300017777 | Freshwater Lake | MKPVVKRATPAAIAVLRQATAICPLRMKASDGLLPSKAHI |
| Ga0181357_12526423 | 3300017777 | Freshwater Lake | MIALAKKATPAAIAVLRQATAHFPKRKKASDGLLPSAAHAHQNPNS |
| Ga0181357_12973782 | 3300017777 | Freshwater Lake | MKPVAKSATPAAIAVLRQATALVPKRSKVSDGLLPSKAHIKASPN |
| Ga0181346_12686641 | 3300017780 | Freshwater Lake | MSKATPAALAVLRQATALRPARKKASDGLLPSAAHK |
| Ga0181346_12760754 | 3300017780 | Freshwater Lake | MIAKKATPAAIAVLRQATALRPRRKKASDGLLPSAAHI |
| Ga0181346_12870821 | 3300017780 | Freshwater Lake | MIPLAKAAQPAAIAVLRQATALKPKRKKASDGLLPSKAHLSKNPNS |
| Ga0181348_12843181 | 3300017784 | Freshwater Lake | MKPVAKKATPAAIAVLRQATAIKPSRKKASDGLLPSAAH |
| Ga0181348_12973201 | 3300017784 | Freshwater Lake | MKTLVKKATPAAIAVLRQATAIKPSRKKASDGLLPSAAHI |
| Ga0181355_10376214 | 3300017785 | Freshwater Lake | MKPVVKKATPAAIAVLRQSTALYPSRKKASDGLLPS |
| Ga0181355_11160183 | 3300017785 | Freshwater Lake | MKTPVKKATPAAIAVLRQATAIKPSRKKASDGLLPSAAHIKQSP |
| Ga0181355_11987873 | 3300017785 | Freshwater Lake | VRTVAKVASPAAIAVLRQATALYPKRKKLSDGLLPS |
| Ga0181355_13932451 | 3300017785 | Freshwater Lake | MKTPVKKATPAAIAVLRQATAIKPSRKKASDGLLP |
| Ga0181563_105683173 | 3300018420 | Salt Marsh | MKPVAKKASPAAIAVLRQATALYPKRKKASDGLLPSL |
| Ga0181359_10919451 | 3300019784 | Freshwater Lake | MKPVAKVASPAAIAVLRQATALYPKRKKLSDGLLPSLAHQK |
| Ga0181359_11189041 | 3300019784 | Freshwater Lake | MKSIVKKATPAAIAVLRQATAIKPSRKKASDGLLPS |
| Ga0181359_11478621 | 3300019784 | Freshwater Lake | MTTVVKKATPAAIAVLRQATALKPKRKKASDGLLPSA |
| Ga0207193_15547802 | 3300020048 | Freshwater Lake Sediment | MIPLAKRATPAAIAVLRQATAIWPKRVKASDGLLPSAAHVHQ |
| Ga0211731_106101314 | 3300020205 | Freshwater | MKPVVNRATPAALAVLRQATALKPLRKKASDGLLPSAAHIKASPNS |
| Ga0208091_10179014 | 3300020506 | Freshwater | MKLLAKRATPAAIAVLRQATALYPKRNKLSDGLLPSSAH |
| Ga0208231_10516833 | 3300020557 | Freshwater | MKLVKKATPAAIAVLRQATAISPLRMKASDGLLPSQAHIKQSPVSD |
| Ga0208465_10373884 | 3300020570 | Freshwater | MKPVTKKATPAAVAVLRQATALAPKRKKASDGLLP |
| Ga0208465_10432621 | 3300020570 | Freshwater | MTTVAKRATPAAIAVLRQATALRPKRKKASDGLLPS |
| Ga0194126_103075694 | 3300020603 | Freshwater Lake | MKPLAKKASPAAIAVLRQATALFPKRKKLSDGLLP |
| Ga0194123_101936725 | 3300021093 | Freshwater Lake | MTTVAKRATPAAIAVLRQATALRPKRKKASDGLLP |
| Ga0194130_105757312 | 3300021376 | Freshwater Lake | MKIVVAKKATPAAIAVLRQATALSPKRKKLSDGLLPSAAHLKA |
| Ga0194117_104250893 | 3300021424 | Freshwater Lake | MKPVVKKATPAAIAVLRQATALWPGRKKASDGLLPSSAHIKQNPNS |
| Ga0222714_103526961 | 3300021961 | Estuarine Water | VKPVAKVASPAAIAVLRQATALFPKRKKLSDGLLPSLAHRKA |
| Ga0222713_105247353 | 3300021962 | Estuarine Water | MKPVAKRATPAAIAVLRQATAIAPLRMKASDGLLPSKAHIH |
| Ga0222712_101915831 | 3300021963 | Estuarine Water | MIAKTATPAAKAVLRQATALRPKRKTASDGLLPSVAHQKQN |
| Ga0222712_105253013 | 3300021963 | Estuarine Water | MITVAKKATPAAIAVLRQATALRPQRKKASDGLLPSLAHQKQNPSS |
| Ga0181353_11200283 | 3300022179 | Freshwater Lake | MIPLAKKATPAAIAVLRQATALWPKRKKASDGLLPSAAHV |
| Ga0181354_12293181 | 3300022190 | Freshwater Lake | VKATPAAMAVLRQATALKPLRKKLSDGLLPSAAHQVQNPKS |
| Ga0181354_12431643 | 3300022190 | Freshwater Lake | VRTVAKAASPAAIAVLRQATALYPKRKKLSDGLLPS |
| Ga0181354_12528391 | 3300022190 | Freshwater Lake | MKATPAAIAVLRQATALKPNRKKASDGLLPSAAHM |
| Ga0196901_10082671 | 3300022200 | Aqueous | MSKPKVARVASPAALSMLRQATALAPLRKKASDGLLPSTAHLK |
| Ga0181351_11681131 | 3300022407 | Freshwater Lake | MKPLAKRATPAAIAVLRQATAICPLRMKASDGLLPSKAHIHQ |
| Ga0181351_12647441 | 3300022407 | Freshwater Lake | MIPLARAAQPAAIAILRQATALYPKRLKASDGLLPSKAHINQNP |
| Ga0214917_102388161 | 3300022752 | Freshwater | MTTVAKKATPAAIAVLRQATALRPKRKKASDGLLPSAA |
| Ga0214919_103711791 | 3300023184 | Freshwater | MIAKTAAPAAKAVLRQATALRPKRKTASDGLLPSASH |
| Ga0214919_105841183 | 3300023184 | Freshwater | MATVVKKAQPAAIAVLRQATAFKPKRIKASDGLLPSAAHQKQN |
| Ga0214919_106151281 | 3300023184 | Freshwater | MKPIAKRATPAAIAVLRQATAIAPLRMKASDGLLPSKAHIHQNPNS |
| Ga0255141_10689883 | 3300024351 | Freshwater | VIPLAKKATPAAIAVLRQATALWPKRKKASDGLLPSKA |
| Ga0255157_10121943 | 3300024355 | Freshwater | VKPVAKRATPAAIAVLRQATALVPKRNKASDGLLPS |
| Ga0255144_10729141 | 3300024513 | Freshwater | MNKPVVGKATPAAIAVLKQATALFPKRKKLSDGLLPSPAHIKASPN |
| Ga0255266_10512813 | 3300024550 | Freshwater | MKIAKKATPAAIAVLRQATALRPKRKKASDGLLPSAA |
| Ga0255268_11607763 | 3300024572 | Freshwater | MIPLAKIASPAAKALLRQATAIKPHRKKASDGLLPSK |
| Ga0208424_10093063 | 3300025445 | Aqueous | MKPVIGKATPAAAAVLKQATALYPKRKKTSDGLLPSK |
| Ga0208161_11177051 | 3300025646 | Aqueous | MKPVAKRATPAAVAVLRQATALAPKRKRASDGLLPSAA |
| Ga0208795_10513243 | 3300025655 | Aqueous | MSKPKVAKVASPAALSMLRQATALAPLRKKASDGLLP |
| Ga0208916_100335591 | 3300025896 | Aqueous | MSKATPAAIAVLRQATALRPKRKKASDGLLPSAAHMKQSPTS |
| Ga0256298_10392441 | 3300026415 | Freshwater | MKPTVAKKATPAAIAVLRQATALKPKRKKASDGLLPSAAHLKASP |
| Ga0209975_10035661 | 3300026993 | Freshwater Lake | MKPVARTAQPAAIALLRQATALWGKREKASDGLLPSQAH |
| Ga0255074_10389843 | 3300027121 | Freshwater | MKTVAKKATPAALAVLRQATALQPKRKKASDGLLPS |
| Ga0255087_10676913 | 3300027337 | Freshwater | MKTLAKKATPAAIAVLRQATAIKPSRKKASDGLLPSAAH |
| Ga0209867_10347593 | 3300027393 | Sand | MTVAKKATPAAIAVLRQATALRPKRKKASDGLLPSAAHLKQ |
| Ga0255097_10065742 | 3300027491 | Freshwater | MKPTVAKKATPAAIAVLRQATALKPKRKKASSRPYS |
| Ga0255077_10084095 | 3300027529 | Freshwater | MKPTVAKKATPAAIAVLRQATALKPKRKKASDGLLPSAAHLK |
| Ga0255077_10222093 | 3300027529 | Freshwater | MKTLAKKATPAAIAVLRQATAIKPSRKKASDGLLPSAAHIKQ |
| Ga0255085_10792233 | 3300027538 | Freshwater | MKPVAKKATPAAIAVLRQATAIVPLRMKASDGLLPSNAH |
| Ga0255085_10989481 | 3300027538 | Freshwater | MKPVVKVASPAAIAVLRQATALYPKRKKLSDGLLPSLAHQKASPNS |
| Ga0208974_10676154 | 3300027608 | Freshwater Lentic | MKAIVKKAAPAAIAVLRQATALKPTRKKLSDGLLPSAA |
| Ga0208974_11092043 | 3300027608 | Freshwater Lentic | MKPVAKKATPAAIAVLRQATAICPLRMKASDGLLPSKA |
| Ga0208975_10724822 | 3300027659 | Freshwater Lentic | MKTVAKKATPAAVAVLRQATALAPKRKKASDGLLPSA |
| Ga0208975_10853111 | 3300027659 | Freshwater Lentic | MTTVAKKATPAAIAVLRQATALRPKRKKASDGLLPSAAHLKASPTS |
| Ga0209769_11917684 | 3300027679 | Freshwater Lake | MKPVVKKATPAAIAVLRQATELFPKRKKASDGLLPSAAHQVASPD |
| Ga0209769_11930763 | 3300027679 | Freshwater Lake | MKPVAKKATPAAIAVLRQATALKPKRKKASDGLLPSAAHINQ |
| Ga0209553_10653291 | 3300027688 | Freshwater Lake | MNKATPAAIAILRQATALKPKRKKISDGLLPSAAHLK |
| Ga0209492_12822542 | 3300027721 | Freshwater Sediment | MKPVVKKATPAAIAVLRQATAISPSRKKASDGLLPSAAHKRQSPNS |
| Ga0209355_10336784 | 3300027744 | Freshwater Lake | MSVVKKATPAAIAVLRQATAIWPKRNKASDGLLPSAAHI |
| Ga0209355_13598201 | 3300027744 | Freshwater Lake | MKPVVKSATPAALAVLRQATALVPKRSKVSDGLLPSKAHIKA |
| Ga0209084_13755193 | 3300027749 | Freshwater Lake | MKPVVKKATPAAIAVLRQATALFPNRIKASDGLLPSAAHQKQN |
| Ga0209596_10548913 | 3300027754 | Freshwater Lake | MIPLAKRATPAAIAVLRQATAHFPKRKKASDGLLP |
| Ga0209296_11072791 | 3300027759 | Freshwater Lake | MKKLVKKATPAAIAVLRQATAICPSRKKASDGLLPSAA |
| Ga0209296_11243293 | 3300027759 | Freshwater Lake | MKPIAKKATPAAIAVLRQATAIKPSRKKASDGLLPS |
| Ga0209246_102379671 | 3300027785 | Freshwater Lake | MIAKQATPAAIAVLRQASALRPKRKKASDGLLPSKAH |
| Ga0209287_102024573 | 3300027792 | Freshwater Sediment | MKPVAKKATPAAIAVLRQATAIKPLRMKASDGLLPSKAHIHQ |
| Ga0209972_104543702 | 3300027793 | Freshwater Lake | MKPVVKRATPAAIAVLRQATAIAPLRKKVSDGLLPSKA |
| Ga0209229_100992633 | 3300027805 | Freshwater And Sediment | MKPVAKKATPAAIAVLRQATAIVPLRMKASDGLLPS |
| Ga0209229_105207821 | 3300027805 | Freshwater And Sediment | MIPLAKKATPAAIAVLRQATALWPKRKKASDGLLPSKAH |
| Ga0209985_102218691 | 3300027806 | Freshwater Lake | MKPVAKVASPAAIAVLRQATALYPKRKKLSDGLLPSLAHQKAS |
| Ga0209354_100223851 | 3300027808 | Freshwater Lake | VKATPAAVAVLRQATALRPRRKKASDGLLPSAAHLVQN |
| Ga0209354_100651013 | 3300027808 | Freshwater Lake | MIALAKRATPAAIAVLRQATAHFPKRKRASDGLLPSAAH |
| Ga0209990_100275511 | 3300027816 | Freshwater Lake | MKPVAKRATPAAIAVLRQATALYPSRKKASDGLLPSAAHI |
| Ga0209990_101210031 | 3300027816 | Freshwater Lake | MKPVAKRATPAAIAVLRQATALAPKRNKLSDGLLP |
| Ga0209990_104854293 | 3300027816 | Freshwater Lake | MKSVVKKATPAAIAVLRQATAIAPLRMKASDGLLP |
| Ga0209550_103283161 | 3300027892 | Freshwater Lake | MKPVVKSATPAALAVLRQATALVPKRSKVSDGLLPSKAHIKASPN |
| Ga0209550_104553461 | 3300027892 | Freshwater Lake | MKTLVKKATPAAIAVLRQATAIKPSRKKASDGLLPSAA |
| Ga0209550_105934561 | 3300027892 | Freshwater Lake | VRTVAKAASPAAIAVLRQATALYPKRKKLSDGLLPSS |
| Ga0209820_11808042 | 3300027956 | Freshwater Sediment | MKPVAKKATPAAIAVLRQATAISPSRKKASDGLLPSAAHITQSP |
| Ga0209079_102669941 | 3300027972 | Freshwater Sediment | MKPVVKKATPAAIAVLRQATAISPSRKKASDGLLPSAAHRSQNPN |
| Ga0209079_102787821 | 3300027972 | Freshwater Sediment | MKPVAKRATPAAIAVLRQATAISPSRKKASDGLLPSA |
| Ga0209298_101389941 | 3300027973 | Freshwater Lake | MNKATPAAIAVLRQATALRPKRKKASDGLLPSAAHMKQS |
| Ga0247723_10005361 | 3300028025 | Deep Subsurface Sediment | MKPVAKKATPAAIAVLRQATAIAPLRKKVSDGLLPSKAHINQ |
| Ga0247723_100573310 | 3300028025 | Deep Subsurface Sediment | MKTVAKKATPAAIAVLRQATAISPLRMKASDGLLPSN |
| Ga0255190_10568013 | 3300028083 | Freshwater | MTKPKVAKSASPAALSMLRQATALAPLRKKASDGLLPSTAHLALSP |
| (restricted) Ga0247839_10441343 | 3300028553 | Freshwater | MKKLVKKATPAAIAVLRQATAISPSRKKVSDGLLPSNAH |
| Ga0256301_10806973 | 3300029697 | Freshwater | MKPIVKSATPAAIAVLRQATALVPKRSKVSDGLLPSKA |
| Ga0119944_10181503 | 3300029930 | Aquatic | MKPVVKKATPAAIAVLRQATALWPKRKKLSDGLLPSAAHLKLS |
| Ga0119945_10097881 | 3300029933 | Aquatic | MKPVAKVASPAAIAVLRQATALYPKRKKLSDGLLPSLAHQKANPN |
| Ga0307377_104088743 | 3300031673 | Soil | VKPVAKVASPAAIAVLRQATALFPKRKKLSDGLLPSLAHRK |
| Ga0315291_101792201 | 3300031707 | Sediment | MKILAKRATPAAIAVLRQATALYPKRKKLSDGLLPSSAHIKQS |
| Ga0315907_102318933 | 3300031758 | Freshwater | MKKVVKRATPAAIAALRQATAIAPKRRTASDGLLPSRSHL |
| Ga0315907_103775104 | 3300031758 | Freshwater | MKPVAKRATPAAIAVLRQATALYPSRKKASDGLLPSAAHIH |
| Ga0315907_103981711 | 3300031758 | Freshwater | VKPVAKSAAPAAIALLRQATALWPKREKASDGLLPS |
| Ga0315907_107619011 | 3300031758 | Freshwater | MIPLARVAQPAAIAVLRQATALRPKRKKASDGLLPSKA |
| Ga0315907_107808961 | 3300031758 | Freshwater | MTTVAKKATPAALAVLRQATALQPKRKKASDGLLPSAAHVK |
| Ga0315907_108832221 | 3300031758 | Freshwater | MIPLAKKATPAAIAVLRQATAIWPKRMKASDGLLP |
| Ga0315907_109595691 | 3300031758 | Freshwater | MKPVVKAASPAAIAVLRQATALWPKRKKLSDGLLPSLAHQK |
| Ga0315907_109695971 | 3300031758 | Freshwater | VKLAKKASPAAVAVLRQATALKPLRKKLSDGLLPSAAH |
| Ga0315899_100007291 | 3300031784 | Freshwater | MKSVVKKATPAAIAVLRQATAIAPLRMKASDGLLPSN |
| Ga0315899_115717041 | 3300031784 | Freshwater | MKLAKKASPAAIAVLRQATALKPLRKKLSDGLLPSAA |
| Ga0315900_102340971 | 3300031787 | Freshwater | MKPVTKKATPAAIAMLRQATALAPKRMKASDGLLPSVAHLK |
| Ga0315900_102900791 | 3300031787 | Freshwater | MKPVVNKATPAALAVLRQATALKPLRKKASDGLLPSAAH |
| Ga0315900_103661801 | 3300031787 | Freshwater | MKKPVVGKATPAAVALLRQASALAPKRMKASDGLLPSAAHLKTS |
| Ga0315900_106866131 | 3300031787 | Freshwater | MKTVAKKATPAAIAVLRQATAICPLRKKASDGLLPSKAHIHQN |
| Ga0315909_1002827610 | 3300031857 | Freshwater | MKPTVAKKATPAAVAVLRQATALAPKRKKASDGLLPSAAHLKA |
| Ga0315909_100443196 | 3300031857 | Freshwater | MKKPVVGKATPAAVALLRQASALAPKRMKASDGLLPSAA |
| Ga0315909_100876274 | 3300031857 | Freshwater | MKPVAKKATPAAIAVLRQATALFPKRKKLSDGLLPSVA |
| Ga0315909_101766594 | 3300031857 | Freshwater | MKPVVKRATPAAIAVLRQATAIAPLRKKASDGLLP |
| Ga0315909_101935571 | 3300031857 | Freshwater | MKPVVKAASPAAIAVLRQATALFPKRKKLSDGLLPS |
| Ga0315909_103541175 | 3300031857 | Freshwater | MTTVVKKATPAAIAVLRQATALWPKRKKASDGLLP |
| Ga0315909_103543103 | 3300031857 | Freshwater | MKAIVKKATPAAIAVLRQATALKPTRNKLSDGLLP |
| Ga0315909_103546491 | 3300031857 | Freshwater | MKLVAKRATPAAIAVLRQATALWPKRKKASDGLLPSSAHIKQSPN |
| Ga0315909_103890874 | 3300031857 | Freshwater | MKPVAKVASPAAIAVLRQATALYPKRKKLSDGLLPSLAHQKA |
| Ga0315909_104772983 | 3300031857 | Freshwater | MTKPKVAKSASPAALSMLRQATALAPLRKKASDGLLPSTAHL |
| Ga0315909_104881931 | 3300031857 | Freshwater | VSKIAKKPTPAALAVLRQATAVKPKRKKLSDGLLPSA |
| Ga0315909_105479551 | 3300031857 | Freshwater | MKVKIARKATPAATAVLRQATALWPKRKKASDGLLP |
| Ga0315909_106910521 | 3300031857 | Freshwater | MKPVAKKATPAAIAVLRQATKISPSRMKASDGLLPSKAH |
| Ga0315909_107035412 | 3300031857 | Freshwater | MKTVVKRATPAAIAVLRQATALRPMRKKASDGLLPS |
| Ga0315909_107685871 | 3300031857 | Freshwater | MTTVAKRATPAAIAVLRQATALRPKRKKASDGLLPSA |
| Ga0315904_100397261 | 3300031951 | Freshwater | MIPLAKKATPAAIAALRQATAHFPKRKKASDGLLPSK |
| Ga0315904_101170394 | 3300031951 | Freshwater | MKHVVKAASPAAIAVLRQATALWPKRKKLSDGLLPSL |
| Ga0315904_101277051 | 3300031951 | Freshwater | MKPVAKKATPAAIAVLRQATALFPKRKKLSDGLLPSVAHQKQSPNS |
| Ga0315904_111676311 | 3300031951 | Freshwater | MKLVVKRATPAAIAVLRQATALWPKRKKASDGLLPSSAHIKQSP |
| Ga0315901_102616103 | 3300031963 | Freshwater | MTKPKVAKSASPAALSMLRQATALAPLRKKASDGLL |
| Ga0315901_103088671 | 3300031963 | Freshwater | MKPVAKRATPAAIAVLRQATALAPKRNKASDGLLPSKAHIKA |
| Ga0315901_105948341 | 3300031963 | Freshwater | MKPVVKKATPAAIAVLRQATALFPKRKKASDGLLPSAAHI |
| Ga0315901_110253083 | 3300031963 | Freshwater | MIIAKTATPAAKSVLRQATALRPKRLKASDGLLPSKEH |
| Ga0315901_110452663 | 3300031963 | Freshwater | MNRIAKKPTPAALAVLRQATAVKPKRKKLSDGLLPSAAHIKQSPT |
| Ga0315901_112398162 | 3300031963 | Freshwater | VSKIAKKPTPAALAVLRQATAVKPKRKKLSDGLLPSAAHIKQSPT |
| Ga0315278_113206731 | 3300031997 | Sediment | MIAKRATPAAIAVLRQATAHCPKRKKASDGLLPSKAHISA |
| Ga0315274_105010741 | 3300031999 | Sediment | MIPLAKKATPAAIAVLRQATAHWPKRNKASDGLLPSAAHVHQ |
| Ga0315906_1001590511 | 3300032050 | Freshwater | MTVAKKATPAAIAVLRQATALRPKRKKASDGLLPSAAHL |
| Ga0315906_101814533 | 3300032050 | Freshwater | MKNVVKKATPAAIAVLRQATAIAPLRMKASDGLLP |
| Ga0315906_104916981 | 3300032050 | Freshwater | MKPVAKVASPAAIAVLRQATALFPKRKKLSDGLLPSL |
| Ga0315906_105159391 | 3300032050 | Freshwater | VKPVAKRATPAAIAVLRQATALVPKRNKASDGLLPSKAHIKASPNS |
| Ga0315906_105624853 | 3300032050 | Freshwater | MKLVVKRATPAAIAVLRQATALWPKRKKASDGLLPS |
| Ga0315906_108275533 | 3300032050 | Freshwater | MIPLAKFPQPAAVALLRQANALAPRRNRASDGLLPSAAHVKQSPN |
| Ga0315906_108584993 | 3300032050 | Freshwater | MKLAKKPTPAAVALLRQATAIAPKRMKASDGLLPS |
| Ga0315906_111905401 | 3300032050 | Freshwater | MKPVAKRATPAALAVLRQATKLFPKRNKASDGLLPSAAHLKA |
| Ga0315905_100115551 | 3300032092 | Freshwater | MKLVKRATPAAIAVLRQATAIAPLRMKASDGLLPSRSH |
| Ga0315905_107127674 | 3300032092 | Freshwater | MTMNKATPAAIAVLRQATALKPKRKKISDGLLPSAAHMKQS |
| Ga0315905_111454523 | 3300032092 | Freshwater | MKPVVKKATPAAIAVLRQATAISPSRKKASDGLLPSAAHIHQN |
| Ga0315902_104324904 | 3300032093 | Freshwater | VSKIAKKPTPAALAVLRQATAVKPKRKKLSDGLLP |
| Ga0315902_109839001 | 3300032093 | Freshwater | MKPVAKVASPAAIAVLRQATALYPKRKKLSDGLLPSLA |
| Ga0315903_1001609011 | 3300032116 | Freshwater | MIPLAKKATPAAIAVLRQATAHFPKRKKASDGLLP |
| Ga0315903_100900754 | 3300032116 | Freshwater | MKPVVKAASPAAIAVLRQATALWPKRKKLSDGLLPSLA |
| Ga0315903_100972661 | 3300032116 | Freshwater | MMKLVVKKATPAAIAVLRQATALWPKRKKASDGLLPS |
| Ga0315903_101161355 | 3300032116 | Freshwater | MKPVAKVASPAAIAVLRQATALFPKRKKLSDGLLPSLAHQKASPNS |
| Ga0315903_103401171 | 3300032116 | Freshwater | MKPLAKKPSAAAVAMLRQATALAPKRLKASDGLLPSAAHLKLNPNSD |
| Ga0315903_104467671 | 3300032116 | Freshwater | MTVAKRATPAAIAVLRQATALRPKRKKASDGLLPSAAH |
| Ga0315903_105094121 | 3300032116 | Freshwater | MKFVAKKATPAAIAVLRQATAISPLRMKASDGLLPSN |
| Ga0315903_109704171 | 3300032116 | Freshwater | MKPVVKKATPAAIAVLRQATALYPSRKKASDGLLPSAA |
| Ga0334994_0275325_1_123 | 3300033993 | Freshwater | MSKATPAAIAVLRQATALRPKRKKASDGLLPSAAHMKQSPT |
| Ga0334994_0292734_3_125 | 3300033993 | Freshwater | MKPVVKKATPAAIAVLRQATAISPSRKKASDGLLPSAAHIH |
| Ga0334994_0303018_1_126 | 3300033993 | Freshwater | MKPVAKVASPAATAVLRQATALFPKRKKLSDGLLPSLAHQKA |
| Ga0334979_0513635_3_140 | 3300033996 | Freshwater | MKPVAKVASPAAIAVLRQATALYPKRKKLSDGLLPSLAHQKASPNS |
| Ga0334986_0107229_1547_1663 | 3300034012 | Freshwater | MKPVAKKATPAAIAVLRQATAISPSRKKASDGLLPSAAH |
| Ga0334986_0150645_3_116 | 3300034012 | Freshwater | MTTVVKKATPAAIAVLRQATALWPKRKKASDGLLPSAA |
| Ga0334998_0048978_2846_2953 | 3300034019 | Freshwater | MKPVAKKATPAAVAVLRQATALAPKRKKASDGLLPS |
| Ga0334998_0426328_651_755 | 3300034019 | Freshwater | MKPVVKKATPAAIAVLRQATAISPSRKKASDGLLP |
| Ga0335002_0184521_2_109 | 3300034020 | Freshwater | MKKLAKKATPAAIAVLRQATAISPSRKKASDGLLPS |
| Ga0334987_0226785_3_116 | 3300034061 | Freshwater | MKPVAKKATPAAIAVLRQATAISPSRKKASDGLLPSKA |
| Ga0334987_0260520_1059_1175 | 3300034061 | Freshwater | MKPVVKRATPAAIAVLRQATALRPLRKKASDGLLPSKAH |
| Ga0334995_0584817_3_134 | 3300034062 | Freshwater | MKPVAKKATPAAIAVLRQATALKPKRGKASDGLLPSAAHINQNP |
| Ga0335019_0601869_518_643 | 3300034066 | Freshwater | MKPVVKKATPAAIAVLRQATAISPSRKKASDGLLPSAAHIHQ |
| Ga0335028_0312205_822_926 | 3300034071 | Freshwater | MSKLAKKPTPAALAVLRQATAIKPKRKKLSDGLLP |
| Ga0335028_0649446_2_130 | 3300034071 | Freshwater | MKKLAKKATPAAIAVLRQATAISPSRKKASDGLLPSKAHINQS |
| Ga0335010_0540186_3_140 | 3300034092 | Freshwater | MKPVAKRATPAALAVLRQATALVPKRNKISDGLLPSKAHIKASPNS |
| Ga0335010_0623095_415_543 | 3300034092 | Freshwater | MMKPVAKKATPAAIAVLRQATAIAPLRKKASDGLLPSKAHIHQ |
| Ga0335027_0407754_749_877 | 3300034101 | Freshwater | MTVAKRATPAAIAVLRQATALRPKRKKASDGLLPSAAHLTQSP |
| Ga0335029_0452685_2_127 | 3300034102 | Freshwater | MMKPVVKRATPAAIAVLRQATAIAPSRTKASDGLLPSNAHLK |
| Ga0335029_0608347_3_125 | 3300034102 | Freshwater | MKPVVKKATPAAIAVLRQATAISPSRKKASDGLLPSAAHIN |
| Ga0335031_0831200_395_511 | 3300034104 | Freshwater | MSVVKRATPAAIAVLRQATALRPKRKKASDGLLPSAAHL |
| Ga0335036_0445567_1_135 | 3300034106 | Freshwater | MKLLAKRATPAAIAVLRQATALYPKRKKLSDGLLPSSAHIKQSPN |
| Ga0335036_0696392_3_116 | 3300034106 | Freshwater | MNKLAKKATPAALAVLRQATAIAPKRKKLSDGLLPSAA |
| Ga0335053_0135672_1568_1672 | 3300034118 | Freshwater | MKPVAKKATPAAIAVLRQATKIAPSRMKASDGLLP |
| Ga0335054_0497036_560_682 | 3300034119 | Freshwater | MMKPVAKKATPAAIAVLRQATAISPSRKKASDGLLPSKAHI |
| Ga0335056_0121051_3_113 | 3300034120 | Freshwater | MIKLVKKATPAAIAVLRQATAICPSRMKASDGLLPSS |
| Ga0335060_0382548_615_749 | 3300034122 | Freshwater | MIPLAKKASPSAIAVLRQATALWPKRAKASDGLLPSKAHVHQNPN |
| Ga0335049_0669133_1_123 | 3300034272 | Freshwater | MKLLAKRATPAAIAVLRQATALYPKRKKLSDGLLPSSAHIK |
| Ga0335052_0327831_1_135 | 3300034279 | Freshwater | MKPLAKKATPAAIAVLRQATALRPKRKKASDGLLPSAAHVHQNPN |
| Ga0335007_0367971_798_911 | 3300034283 | Freshwater | MKLVKKATPAAIAVLRQATAICPSRKKASDGLLPSAAH |
| Ga0335007_0516950_3_125 | 3300034283 | Freshwater | MTVAKRATPAAIAVLRQATALRPKRKKASDGLLPSAAHLTQ |
| Ga0335007_0726717_425_550 | 3300034283 | Freshwater | MTTVAKKATPAAIAVLRQATALKPKRKKASDGLLPSAAHLTQ |
| Ga0335013_0479532_1_126 | 3300034284 | Freshwater | MTTVAKKATPAAIAVLRQATALRPKRKKASDGLLPSAAHLSQ |
| Ga0310143_08856_1115_1219 | 3300034523 | Fracking Water | MKPVAKKATPAAIAVLRQATVIAPSRLKASDGLLP |
| ⦗Top⦘ |