| Basic Information | |
|---|---|
| Family ID | F008919 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 326 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MTEAELKKHLDAAEKSPKQIAAAVSGLPEKTLRYKPSPDKWCILEI |
| Number of Associated Samples | 259 |
| Number of Associated Scaffolds | 326 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 88.34 % |
| % of genes near scaffold ends (potentially truncated) | 98.16 % |
| % of genes from short scaffolds (< 2000 bps) | 85.28 % |
| Associated GOLD sequencing projects | 241 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.29 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.172 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.350 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.086 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.626 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.78% β-sheet: 0.00% Coil/Unstructured: 66.22% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 326 Family Scaffolds |
|---|---|---|
| PF10996 | Beta-Casp | 45.40 |
| PF07521 | RMMBL | 8.59 |
| PF12706 | Lactamase_B_2 | 4.60 |
| PF16661 | Lactamase_B_6 | 1.84 |
| PF08032 | SpoU_sub_bind | 1.53 |
| PF12867 | DinB_2 | 1.53 |
| PF03200 | Glyco_hydro_63 | 0.92 |
| PF15780 | ASH | 0.92 |
| PF00588 | SpoU_methylase | 0.92 |
| PF03372 | Exo_endo_phos | 0.31 |
| PF00459 | Inositol_P | 0.31 |
| PF02803 | Thiolase_C | 0.31 |
| PF01061 | ABC2_membrane | 0.31 |
| PF13181 | TPR_8 | 0.31 |
| PF00069 | Pkinase | 0.31 |
| PF02518 | HATPase_c | 0.31 |
| PF01134 | GIDA | 0.31 |
| PF12697 | Abhydrolase_6 | 0.31 |
| PF01977 | UbiD | 0.31 |
| PF01266 | DAO | 0.31 |
| PF08734 | GYD | 0.31 |
| PF01182 | Glucosamine_iso | 0.31 |
| PF10116 | Host_attach | 0.31 |
| PF00924 | MS_channel | 0.31 |
| PF00589 | Phage_integrase | 0.31 |
| PF13360 | PQQ_2 | 0.31 |
| PF02870 | Methyltransf_1N | 0.31 |
| PF17137 | DUF5110 | 0.31 |
| PF00561 | Abhydrolase_1 | 0.31 |
| PF13620 | CarboxypepD_reg | 0.31 |
| PF04226 | Transgly_assoc | 0.31 |
| PF13545 | HTH_Crp_2 | 0.31 |
| PF13485 | Peptidase_MA_2 | 0.31 |
| PF12680 | SnoaL_2 | 0.31 |
| PF00583 | Acetyltransf_1 | 0.31 |
| PF14698 | ASL_C2 | 0.31 |
| PF00196 | GerE | 0.31 |
| PF00912 | Transgly | 0.31 |
| PF02585 | PIG-L | 0.31 |
| COG ID | Name | Functional Category | % Frequency in 326 Family Scaffolds |
|---|---|---|---|
| COG0566 | tRNA G18 (ribose-2'-O)-methylase SpoU | Translation, ribosomal structure and biogenesis [J] | 2.45 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 1.23 |
| COG0219 | tRNA(Leu) C34 or U34 (ribose-2'-O)-methylase TrmL, contains SPOUT domain | Translation, ribosomal structure and biogenesis [J] | 0.92 |
| COG0565 | tRNA C32,U32 (ribose-2'-O)-methylase TrmJ or a related methyltransferase | Translation, ribosomal structure and biogenesis [J] | 0.92 |
| COG0043 | 3-polyprenyl-4-hydroxybenzoate decarboxylase | Coenzyme transport and metabolism [H] | 0.31 |
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.31 |
| COG0350 | DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase) | Replication, recombination and repair [L] | 0.31 |
| COG0363 | 6-phosphogluconolactonase/Glucosamine-6-phosphate isomerase/deaminase | Carbohydrate transport and metabolism [G] | 0.31 |
| COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.31 |
| COG0744 | Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.31 |
| COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 0.31 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.31 |
| COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 0.31 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.31 |
| COG4953 | Membrane carboxypeptidase/penicillin-binding protein PbpC | Cell wall/membrane/envelope biogenesis [M] | 0.31 |
| COG5009 | Membrane carboxypeptidase/penicillin-binding protein | Cell wall/membrane/envelope biogenesis [M] | 0.31 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.17 % |
| Unclassified | root | N/A | 5.83 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000574|JGI1357J11328_10139739 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300001661|JGI12053J15887_10521615 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300002917|JGI25616J43925_10265076 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
| 3300004092|Ga0062389_100175606 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2064 | Open in IMG/M |
| 3300004114|Ga0062593_101526708 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300004479|Ga0062595_100702123 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 812 | Open in IMG/M |
| 3300004479|Ga0062595_101625259 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
| 3300004635|Ga0062388_100543927 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
| 3300005176|Ga0066679_10622893 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300005184|Ga0066671_10335643 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300005332|Ga0066388_102088542 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1019 | Open in IMG/M |
| 3300005332|Ga0066388_105116731 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300005335|Ga0070666_11161726 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300005337|Ga0070682_101243212 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300005338|Ga0068868_100113792 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2201 | Open in IMG/M |
| 3300005338|Ga0068868_101860574 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300005439|Ga0070711_100065548 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2541 | Open in IMG/M |
| 3300005447|Ga0066689_10765987 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300005458|Ga0070681_10254183 | All Organisms → cellular organisms → Bacteria | 1669 | Open in IMG/M |
| 3300005468|Ga0070707_101059562 | Not Available | 776 | Open in IMG/M |
| 3300005529|Ga0070741_10545537 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1042 | Open in IMG/M |
| 3300005530|Ga0070679_101956488 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300005534|Ga0070735_10055380 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2606 | Open in IMG/M |
| 3300005541|Ga0070733_10015657 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 4750 | Open in IMG/M |
| 3300005546|Ga0070696_100238910 | All Organisms → cellular organisms → Bacteria | 1369 | Open in IMG/M |
| 3300005554|Ga0066661_10395150 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 847 | Open in IMG/M |
| 3300005557|Ga0066704_10001397 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 10392 | Open in IMG/M |
| 3300005559|Ga0066700_10160410 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1530 | Open in IMG/M |
| 3300005559|Ga0066700_10360066 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
| 3300005563|Ga0068855_101741065 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 634 | Open in IMG/M |
| 3300005564|Ga0070664_100044790 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3736 | Open in IMG/M |
| 3300005568|Ga0066703_10293126 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300005568|Ga0066703_10321083 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 934 | Open in IMG/M |
| 3300005591|Ga0070761_10970738 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 539 | Open in IMG/M |
| 3300005607|Ga0070740_10373372 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300005610|Ga0070763_10064068 | All Organisms → cellular organisms → Bacteria | 1781 | Open in IMG/M |
| 3300005618|Ga0068864_100577981 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1088 | Open in IMG/M |
| 3300005618|Ga0068864_102676654 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300005764|Ga0066903_103635147 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300005890|Ga0075285_1047229 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300005897|Ga0075281_1071820 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300005921|Ga0070766_10005352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 6500 | Open in IMG/M |
| 3300005952|Ga0080026_10045426 | Not Available | 1139 | Open in IMG/M |
| 3300005994|Ga0066789_10064297 | All Organisms → cellular organisms → Bacteria | 1595 | Open in IMG/M |
| 3300006032|Ga0066696_10585874 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 726 | Open in IMG/M |
| 3300006050|Ga0075028_100436293 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 755 | Open in IMG/M |
| 3300006052|Ga0075029_100081485 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1917 | Open in IMG/M |
| 3300006052|Ga0075029_100114357 | All Organisms → cellular organisms → Bacteria | 1632 | Open in IMG/M |
| 3300006059|Ga0075017_100224266 | All Organisms → cellular organisms → Bacteria | 1367 | Open in IMG/M |
| 3300006059|Ga0075017_100859025 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 703 | Open in IMG/M |
| 3300006086|Ga0075019_11131167 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300006102|Ga0075015_100857069 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300006162|Ga0075030_101333614 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300006163|Ga0070715_10259422 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300006174|Ga0075014_100414936 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300006174|Ga0075014_100690784 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300006176|Ga0070765_101907089 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300006354|Ga0075021_10045032 | All Organisms → cellular organisms → Bacteria | 2540 | Open in IMG/M |
| 3300006358|Ga0068871_102064909 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300006791|Ga0066653_10660614 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300006794|Ga0066658_10269314 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 912 | Open in IMG/M |
| 3300006794|Ga0066658_10849754 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
| 3300006796|Ga0066665_10179329 | All Organisms → cellular organisms → Bacteria | 1629 | Open in IMG/M |
| 3300006796|Ga0066665_10508068 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300006797|Ga0066659_10271410 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1280 | Open in IMG/M |
| 3300006800|Ga0066660_10696646 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300009036|Ga0105244_10379697 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
| 3300009038|Ga0099829_10130300 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1990 | Open in IMG/M |
| 3300009089|Ga0099828_10052889 | All Organisms → cellular organisms → Bacteria | 3377 | Open in IMG/M |
| 3300009090|Ga0099827_11829354 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300009098|Ga0105245_10292922 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1595 | Open in IMG/M |
| 3300009137|Ga0066709_104468729 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300009174|Ga0105241_10179078 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1757 | Open in IMG/M |
| 3300009630|Ga0116114_1003987 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5796 | Open in IMG/M |
| 3300009632|Ga0116102_1197846 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300009639|Ga0116122_1197026 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
| 3300009698|Ga0116216_10517797 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
| 3300009824|Ga0116219_10641252 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 583 | Open in IMG/M |
| 3300010048|Ga0126373_10112951 | All Organisms → cellular organisms → Bacteria | 2530 | Open in IMG/M |
| 3300010048|Ga0126373_10802018 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
| 3300010048|Ga0126373_11388537 | Not Available | 768 | Open in IMG/M |
| 3300010323|Ga0134086_10072632 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1190 | Open in IMG/M |
| 3300010341|Ga0074045_10143732 | All Organisms → cellular organisms → Bacteria | 1625 | Open in IMG/M |
| 3300010343|Ga0074044_10674043 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300010360|Ga0126372_11205328 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300010361|Ga0126378_11122167 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 886 | Open in IMG/M |
| 3300010361|Ga0126378_11631749 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 732 | Open in IMG/M |
| 3300010366|Ga0126379_11647652 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300010366|Ga0126379_13113247 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300010375|Ga0105239_10349425 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1669 | Open in IMG/M |
| 3300010376|Ga0126381_104145597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter | 563 | Open in IMG/M |
| 3300010376|Ga0126381_104741719 | Not Available | 523 | Open in IMG/M |
| 3300010376|Ga0126381_104831985 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300010379|Ga0136449_102668108 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 710 | Open in IMG/M |
| 3300010379|Ga0136449_104469566 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300010398|Ga0126383_12538173 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
| 3300010400|Ga0134122_13207425 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300011269|Ga0137392_10110497 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2180 | Open in IMG/M |
| 3300011269|Ga0137392_10521503 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 987 | Open in IMG/M |
| 3300011269|Ga0137392_11068428 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 662 | Open in IMG/M |
| 3300011270|Ga0137391_10346667 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1276 | Open in IMG/M |
| 3300011270|Ga0137391_10505285 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1023 | Open in IMG/M |
| 3300011270|Ga0137391_10747755 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 809 | Open in IMG/M |
| 3300011270|Ga0137391_10992868 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
| 3300011270|Ga0137391_11016379 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
| 3300011271|Ga0137393_11780298 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300012096|Ga0137389_11527352 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300012189|Ga0137388_11464398 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300012202|Ga0137363_11637138 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300012203|Ga0137399_10834598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 776 | Open in IMG/M |
| 3300012203|Ga0137399_11292771 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
| 3300012205|Ga0137362_11508633 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300012209|Ga0137379_10746540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 884 | Open in IMG/M |
| 3300012349|Ga0137387_11268574 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300012361|Ga0137360_10661628 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 896 | Open in IMG/M |
| 3300012362|Ga0137361_10656761 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 959 | Open in IMG/M |
| 3300012362|Ga0137361_10728512 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 905 | Open in IMG/M |
| 3300012683|Ga0137398_10551633 | Not Available | 795 | Open in IMG/M |
| 3300012917|Ga0137395_10612672 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 787 | Open in IMG/M |
| 3300012929|Ga0137404_10202842 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1681 | Open in IMG/M |
| 3300012929|Ga0137404_10659430 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 944 | Open in IMG/M |
| 3300012944|Ga0137410_10241104 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1414 | Open in IMG/M |
| 3300012944|Ga0137410_10328214 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1218 | Open in IMG/M |
| 3300012948|Ga0126375_11672367 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300012960|Ga0164301_11898621 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300012971|Ga0126369_12307516 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
| 3300012971|Ga0126369_12612443 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
| 3300012988|Ga0164306_10673950 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 819 | Open in IMG/M |
| 3300013296|Ga0157374_10047500 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3981 | Open in IMG/M |
| 3300014156|Ga0181518_10584055 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300014200|Ga0181526_10532677 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 743 | Open in IMG/M |
| 3300014493|Ga0182016_10489813 | Not Available | 712 | Open in IMG/M |
| 3300014499|Ga0182012_10193539 | All Organisms → cellular organisms → Bacteria | 1431 | Open in IMG/M |
| 3300014745|Ga0157377_11221342 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 583 | Open in IMG/M |
| 3300015359|Ga0134085_10571407 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300015371|Ga0132258_13966360 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1005 | Open in IMG/M |
| 3300015372|Ga0132256_100045676 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4047 | Open in IMG/M |
| 3300015372|Ga0132256_100139161 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2420 | Open in IMG/M |
| 3300015374|Ga0132255_100524098 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1744 | Open in IMG/M |
| 3300015374|Ga0132255_105850013 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300016294|Ga0182041_12294560 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300016319|Ga0182033_10450042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium Io17-Chloro-G6 | 1098 | Open in IMG/M |
| 3300016319|Ga0182033_11628600 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
| 3300016371|Ga0182034_10174685 | Not Available | 1639 | Open in IMG/M |
| 3300016387|Ga0182040_10161850 | All Organisms → cellular organisms → Bacteria | 1607 | Open in IMG/M |
| 3300017657|Ga0134074_1066727 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1221 | Open in IMG/M |
| 3300017927|Ga0187824_10390577 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300017928|Ga0187806_1139991 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 793 | Open in IMG/M |
| 3300017933|Ga0187801_10375143 | Not Available | 588 | Open in IMG/M |
| 3300017934|Ga0187803_10132046 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 981 | Open in IMG/M |
| 3300017940|Ga0187853_10317589 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 701 | Open in IMG/M |
| 3300017942|Ga0187808_10399616 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| 3300017943|Ga0187819_10330004 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 883 | Open in IMG/M |
| 3300017946|Ga0187879_10092063 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1743 | Open in IMG/M |
| 3300017955|Ga0187817_10498064 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 777 | Open in IMG/M |
| 3300017959|Ga0187779_10339980 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 968 | Open in IMG/M |
| 3300017966|Ga0187776_11564887 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300017972|Ga0187781_10077650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2294 | Open in IMG/M |
| 3300017972|Ga0187781_10944017 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300017975|Ga0187782_10180246 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1578 | Open in IMG/M |
| 3300017995|Ga0187816_10343340 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium | 659 | Open in IMG/M |
| 3300018007|Ga0187805_10006788 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4676 | Open in IMG/M |
| 3300018009|Ga0187884_10054080 | Not Available | 1863 | Open in IMG/M |
| 3300018009|Ga0187884_10102027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1249 | Open in IMG/M |
| 3300018012|Ga0187810_10358342 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
| 3300018020|Ga0187861_10035047 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2779 | Open in IMG/M |
| 3300018020|Ga0187861_10198014 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 899 | Open in IMG/M |
| 3300018020|Ga0187861_10401389 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300018030|Ga0187869_10430041 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| 3300018034|Ga0187863_10042609 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2620 | Open in IMG/M |
| 3300018035|Ga0187875_10361197 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 779 | Open in IMG/M |
| 3300018037|Ga0187883_10242210 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 923 | Open in IMG/M |
| 3300018042|Ga0187871_10232509 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1025 | Open in IMG/M |
| 3300018044|Ga0187890_10655374 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300018044|Ga0187890_10798032 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300018057|Ga0187858_10512121 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 733 | Open in IMG/M |
| 3300018058|Ga0187766_11185793 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300018060|Ga0187765_11145189 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300018064|Ga0187773_10023289 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2676 | Open in IMG/M |
| 3300018086|Ga0187769_10037964 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3302 | Open in IMG/M |
| 3300018086|Ga0187769_10238749 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1350 | Open in IMG/M |
| 3300018086|Ga0187769_11117166 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
| 3300018088|Ga0187771_10864256 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 767 | Open in IMG/M |
| 3300018088|Ga0187771_10924621 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 740 | Open in IMG/M |
| 3300018090|Ga0187770_10493389 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 968 | Open in IMG/M |
| 3300018433|Ga0066667_11081037 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
| 3300018482|Ga0066669_10599637 | Not Available | 965 | Open in IMG/M |
| 3300019878|Ga0193715_1073681 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 714 | Open in IMG/M |
| 3300019879|Ga0193723_1008915 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3258 | Open in IMG/M |
| 3300019887|Ga0193729_1148903 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 848 | Open in IMG/M |
| 3300020018|Ga0193721_1003701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3980 | Open in IMG/M |
| 3300020579|Ga0210407_10001027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 27694 | Open in IMG/M |
| 3300020580|Ga0210403_10004560 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 11920 | Open in IMG/M |
| 3300020581|Ga0210399_10032518 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4167 | Open in IMG/M |
| 3300020581|Ga0210399_10287571 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1372 | Open in IMG/M |
| 3300020581|Ga0210399_10638221 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 879 | Open in IMG/M |
| 3300020583|Ga0210401_10499858 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1078 | Open in IMG/M |
| 3300020583|Ga0210401_10676831 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 892 | Open in IMG/M |
| 3300020583|Ga0210401_10852695 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 770 | Open in IMG/M |
| 3300021168|Ga0210406_10411607 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1082 | Open in IMG/M |
| 3300021170|Ga0210400_10255675 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1433 | Open in IMG/M |
| 3300021170|Ga0210400_11293097 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300021344|Ga0193719_10146798 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1019 | Open in IMG/M |
| 3300021388|Ga0213875_10048573 | Not Available | 1991 | Open in IMG/M |
| 3300021401|Ga0210393_10039935 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3682 | Open in IMG/M |
| 3300021403|Ga0210397_10055666 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2551 | Open in IMG/M |
| 3300021404|Ga0210389_10179766 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1646 | Open in IMG/M |
| 3300021405|Ga0210387_11804879 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300021406|Ga0210386_10890323 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 762 | Open in IMG/M |
| 3300021420|Ga0210394_10640428 | Not Available | 933 | Open in IMG/M |
| 3300021432|Ga0210384_10549433 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1039 | Open in IMG/M |
| 3300021479|Ga0210410_10501789 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1083 | Open in IMG/M |
| 3300021479|Ga0210410_10979971 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 734 | Open in IMG/M |
| 3300021479|Ga0210410_11689079 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300021559|Ga0210409_10841752 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 790 | Open in IMG/M |
| 3300021559|Ga0210409_11099525 | Not Available | 670 | Open in IMG/M |
| 3300022721|Ga0242666_1190501 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300022732|Ga0224569_103185 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1292 | Open in IMG/M |
| 3300023101|Ga0224557_1071740 | All Organisms → cellular organisms → Bacteria | 1502 | Open in IMG/M |
| 3300023101|Ga0224557_1167468 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 794 | Open in IMG/M |
| 3300025320|Ga0209171_10184387 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1191 | Open in IMG/M |
| 3300025453|Ga0208455_1104080 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300025576|Ga0208820_1070161 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 920 | Open in IMG/M |
| 3300025898|Ga0207692_10036240 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2403 | Open in IMG/M |
| 3300025905|Ga0207685_10653625 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
| 3300025906|Ga0207699_10159171 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1502 | Open in IMG/M |
| 3300025912|Ga0207707_11297589 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300025913|Ga0207695_10922267 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 753 | Open in IMG/M |
| 3300025914|Ga0207671_10507186 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 962 | Open in IMG/M |
| 3300025927|Ga0207687_10915962 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 750 | Open in IMG/M |
| 3300025927|Ga0207687_11553167 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
| 3300025928|Ga0207700_10961638 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 764 | Open in IMG/M |
| 3300025933|Ga0207706_10069990 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3085 | Open in IMG/M |
| 3300025938|Ga0207704_10422286 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1057 | Open in IMG/M |
| 3300025938|Ga0207704_11418756 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300025945|Ga0207679_10091860 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2350 | Open in IMG/M |
| 3300026067|Ga0207678_10561277 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 999 | Open in IMG/M |
| 3300026078|Ga0207702_10125858 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2300 | Open in IMG/M |
| 3300026088|Ga0207641_10389163 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1337 | Open in IMG/M |
| 3300026095|Ga0207676_10142471 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2054 | Open in IMG/M |
| 3300026095|Ga0207676_11786215 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
| 3300026121|Ga0207683_10001917 | All Organisms → cellular organisms → Bacteria | 18415 | Open in IMG/M |
| 3300026142|Ga0207698_10444363 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1250 | Open in IMG/M |
| 3300026281|Ga0209863_10185506 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 604 | Open in IMG/M |
| 3300026304|Ga0209240_1062175 | All Organisms → cellular organisms → Bacteria | 1397 | Open in IMG/M |
| 3300026331|Ga0209267_1323242 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300026498|Ga0257156_1141564 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300026542|Ga0209805_1040694 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2350 | Open in IMG/M |
| 3300026551|Ga0209648_10093329 | Not Available | 2483 | Open in IMG/M |
| 3300026557|Ga0179587_10380033 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 919 | Open in IMG/M |
| 3300026959|Ga0207852_1035103 | Not Available | 511 | Open in IMG/M |
| 3300027383|Ga0209213_1061130 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 706 | Open in IMG/M |
| 3300027432|Ga0209421_1027561 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1106 | Open in IMG/M |
| 3300027565|Ga0209219_1031908 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1310 | Open in IMG/M |
| 3300027565|Ga0209219_1151208 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300027570|Ga0208043_1110961 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 736 | Open in IMG/M |
| 3300027641|Ga0208827_1018207 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2615 | Open in IMG/M |
| 3300027645|Ga0209117_1085756 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300027676|Ga0209333_1148056 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300027812|Ga0209656_10424869 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
| 3300027862|Ga0209701_10254698 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1025 | Open in IMG/M |
| 3300027867|Ga0209167_10381481 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 768 | Open in IMG/M |
| 3300027882|Ga0209590_10057503 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2193 | Open in IMG/M |
| 3300027894|Ga0209068_10020751 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3198 | Open in IMG/M |
| 3300027903|Ga0209488_10629802 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 775 | Open in IMG/M |
| 3300027905|Ga0209415_10845580 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
| 3300027911|Ga0209698_10801171 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 712 | Open in IMG/M |
| 3300027911|Ga0209698_11157980 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
| 3300027911|Ga0209698_11199793 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300028017|Ga0265356_1034438 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300028807|Ga0307305_10255864 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 800 | Open in IMG/M |
| 3300028906|Ga0308309_10049994 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3007 | Open in IMG/M |
| 3300029916|Ga0302148_1155410 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300029953|Ga0311343_11296940 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300030494|Ga0310037_10038763 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2282 | Open in IMG/M |
| 3300030707|Ga0310038_10208247 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 929 | Open in IMG/M |
| 3300031231|Ga0170824_113876482 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300031231|Ga0170824_114233880 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 748 | Open in IMG/M |
| 3300031261|Ga0302140_10321079 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1297 | Open in IMG/M |
| 3300031525|Ga0302326_13443585 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300031561|Ga0318528_10798469 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300031708|Ga0310686_108771445 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1410 | Open in IMG/M |
| 3300031715|Ga0307476_10504049 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 897 | Open in IMG/M |
| 3300031715|Ga0307476_10768421 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 713 | Open in IMG/M |
| 3300031724|Ga0318500_10501106 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| 3300031744|Ga0306918_11014977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium Io17-Chloro-G6 | 644 | Open in IMG/M |
| 3300031753|Ga0307477_10372612 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 980 | Open in IMG/M |
| 3300031754|Ga0307475_10909896 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
| 3300031754|Ga0307475_11309384 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300031769|Ga0318526_10272065 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 693 | Open in IMG/M |
| 3300031771|Ga0318546_10564573 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa acidisoli | 800 | Open in IMG/M |
| 3300031820|Ga0307473_10121959 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1432 | Open in IMG/M |
| 3300031820|Ga0307473_10176024 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1246 | Open in IMG/M |
| 3300031820|Ga0307473_10833712 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
| 3300031821|Ga0318567_10449599 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 731 | Open in IMG/M |
| 3300031823|Ga0307478_11025612 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 689 | Open in IMG/M |
| 3300031823|Ga0307478_11349523 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300031890|Ga0306925_10984231 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 861 | Open in IMG/M |
| 3300031910|Ga0306923_10252529 | Not Available | 2017 | Open in IMG/M |
| 3300031912|Ga0306921_10019811 | All Organisms → cellular organisms → Bacteria | 7361 | Open in IMG/M |
| 3300031942|Ga0310916_10101827 | Not Available | 2309 | Open in IMG/M |
| 3300031947|Ga0310909_11345651 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
| 3300032001|Ga0306922_12137390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium Io17-Chloro-G6 | 541 | Open in IMG/M |
| 3300032025|Ga0318507_10552763 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300032035|Ga0310911_10898073 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300032044|Ga0318558_10632749 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300032076|Ga0306924_10629688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium Io17-Chloro-G6 | 1211 | Open in IMG/M |
| 3300032091|Ga0318577_10471795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium Io17-Chloro-G6 | 599 | Open in IMG/M |
| 3300032160|Ga0311301_10271042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2763 | Open in IMG/M |
| 3300032160|Ga0311301_12573852 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
| 3300032174|Ga0307470_10296624 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1094 | Open in IMG/M |
| 3300032180|Ga0307471_100646407 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1219 | Open in IMG/M |
| 3300032205|Ga0307472_100077971 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2191 | Open in IMG/M |
| 3300032261|Ga0306920_100398301 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2047 | Open in IMG/M |
| 3300032261|Ga0306920_100868860 | Not Available | 1320 | Open in IMG/M |
| 3300032261|Ga0306920_101143983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium Io17-Chloro-G6 | 1127 | Open in IMG/M |
| 3300032261|Ga0306920_103074685 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
| 3300032261|Ga0306920_104479151 | Not Available | 500 | Open in IMG/M |
| 3300032770|Ga0335085_12331546 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300032783|Ga0335079_10316587 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1699 | Open in IMG/M |
| 3300032893|Ga0335069_12448584 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300033004|Ga0335084_11439561 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
| 3300033289|Ga0310914_10429157 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1196 | Open in IMG/M |
| 3300033433|Ga0326726_10992719 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 815 | Open in IMG/M |
| 3300033433|Ga0326726_11633754 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300033818|Ga0334804_110223 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 708 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.35% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.83% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.60% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.60% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.60% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.91% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.99% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.37% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.07% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.76% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.15% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.45% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.84% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.53% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.53% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.53% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.53% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.23% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.23% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.23% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.23% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.23% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.23% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.23% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.92% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.92% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.92% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.92% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.92% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.61% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.61% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.61% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.61% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.61% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.61% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.61% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.31% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.31% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.31% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.31% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.31% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.31% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.31% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.31% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.31% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.31% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.31% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.31% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.31% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000574 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005607 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005890 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_104 | Environmental | Open in IMG/M |
| 3300005897 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_103 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009630 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 | Environmental | Open in IMG/M |
| 3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
| 3300009639 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014499 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaG | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022721 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU1 | Host-Associated | Open in IMG/M |
| 3300023101 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14 | Environmental | Open in IMG/M |
| 3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025453 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025576 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026959 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027383 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Host-Associated | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029916 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_1 | Environmental | Open in IMG/M |
| 3300029953 | II_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031261 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033818 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 S-3-M | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1357J11328_101397391 | 3300000574 | Groundwater | MTEAEFKKHLDAAETSPKEIAAAVSGLPEKVLRYKPSPDKWCVLEILGHLAD |
| JGI12053J15887_105216151 | 3300001661 | Forest Soil | VTEAELKNHLDAAEDSPKRVAAAVLGLPETTLRYKP |
| JGI25616J43925_102650762 | 3300002917 | Grasslands Soil | MTEAELKKHLDAAEQSPKEIAAAVSGLSEKVLRYRPSPEKWCV |
| Ga0062389_1001756061 | 3300004092 | Bog Forest Soil | MTETDLRKHLDAAEKSPKEIAAAVSGLSEKVLRYKPSPEKWCV |
| Ga0062593_1015267081 | 3300004114 | Soil | MTESELKKHLEAAEKSPKQVAAAVSGLPEKVLRYKPAPDKWCILEILGH |
| Ga0062595_1007021232 | 3300004479 | Soil | MTEAELKKHLDAAEKSPKEIAAAVSGLSERMLHYKPSPEKWCVLEILGHLAD |
| Ga0062595_1016252591 | 3300004479 | Soil | MTEAECKNFLDTAEKSPKQIAAAVTGLPDKVLRYKPSPEKW |
| Ga0062388_1005439272 | 3300004635 | Bog Forest Soil | MTEAELKKHLDSAEKSPKQIAAAVSGLPDKTLRFKPSPDKWCILEVLGH |
| Ga0066679_106228931 | 3300005176 | Soil | MNEAELKQHLEAAEKSPKQIAAAVSGLPDKTLRYKPAPDKWCILEV |
| Ga0066671_103356431 | 3300005184 | Soil | MTEAELKKHLEAAEKSPKQIAAAVSGLPEKTLRYKPAPNKWSILEILA |
| Ga0066388_1020885422 | 3300005332 | Tropical Forest Soil | MTEAELKKHLDTAEKSPKEIAAAVSGLLPAVLRYRSDPAKWCILEILGHLADIEIVYAYRLRQM |
| Ga0066388_1051167312 | 3300005332 | Tropical Forest Soil | MTEAELKKHVEAAEKSPKEIAAAVSGLSPQVLRHKPAPQKWSILEI |
| Ga0070666_111617261 | 3300005335 | Switchgrass Rhizosphere | MTEIDLKKHLEAAEKSPKQVAAAVSGLPEKVLRYKPSPEKWCIHD |
| Ga0070682_1012432122 | 3300005337 | Corn Rhizosphere | MTEAEIKNYLDEAEKGPKKLAAAVSGLTDNLLRYKPTPDKWCI |
| Ga0068868_1001137921 | 3300005338 | Miscanthus Rhizosphere | MTEAECKNFLDAAEKSPKQIAAAVTGLPDKVLRYKPSPEKWCILEIIGHL |
| Ga0068868_1018605742 | 3300005338 | Miscanthus Rhizosphere | MTEAEIKNYLDEAEKGPKKLAAAVSGLTDNLLRYKPTPDKWCILEI |
| Ga0070711_1000655481 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MTEIDLKKHLEAAEKSPKQVAAAVSGLPEKVLRYKQSPEKWSI |
| Ga0066689_107659871 | 3300005447 | Soil | MTDADLKNHLEAAEKSPKQIAAAVSGLSDRTLRYKPNPNKWCILEV |
| Ga0070681_102541831 | 3300005458 | Corn Rhizosphere | MTEHELKMHLETAEKSPKLVAAAVSGLPDKVLRYKPAPDKWCILEI |
| Ga0070707_1010595621 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VTEAELKNHLDAAEKSPKQIAAAVLSLPEKMLRYKPSPDKWCI |
| Ga0070741_105455372 | 3300005529 | Surface Soil | MTEKELKSHLASAEKDPQQVAAAVSRLPDKVLRYKPAPD |
| Ga0070679_1019564881 | 3300005530 | Corn Rhizosphere | MTEAEIKNYLDEAEKGPKKLAAAVSGLTDKVLRYKPTPDKWCILEILGHL |
| Ga0070735_100553801 | 3300005534 | Surface Soil | MTADDLKQIIESAEKDPKKIAAAVSGLPDGILRYKP |
| Ga0070733_100156571 | 3300005541 | Surface Soil | MTEAELKKHLDAAEKSPKEIAAAVSGLPDKILRYKP |
| Ga0070696_1002389102 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MTESELKKHLETAEKSPKLVAAAVSGLPDKVLRYKPAPDKWC |
| Ga0066661_103951502 | 3300005554 | Soil | MNEAELKQHLEAAEKSPKQIAAAVSGLPDKILRYKPSPDKW |
| Ga0066704_100013971 | 3300005557 | Soil | MTEAELKKHLDAAEKSPKEIAAAVSGLPDQVLRYKPA |
| Ga0066700_101604104 | 3300005559 | Soil | MTESEFKKHLDAAEKSPKQIAAAVSGLPDKTLRYKPAPDKWCIL |
| Ga0066700_103600662 | 3300005559 | Soil | VTQAELNKHLDAAEKSPKQIAAAVSGLSDKTLRYKPSADKWCILEI |
| Ga0068855_1017410651 | 3300005563 | Corn Rhizosphere | MTEHELKMHLETAEKSPKLVAAAVSGLPDKVLRYKPAPD |
| Ga0070664_1000447904 | 3300005564 | Corn Rhizosphere | MTESELKKHLETAEKSPKLVAAAVSGLPDKVLRYKPAPDKWCIL |
| Ga0066703_102931261 | 3300005568 | Soil | MTEAELKKHLEAAEKSPKQIAAAVSGLPEKTLRYKPAPNKWSILEILAH |
| Ga0066703_103210831 | 3300005568 | Soil | MTEAELKKHLDAAEKSPKEIAAAVSGLAPEVLHRKPA |
| Ga0070761_109707383 | 3300005591 | Soil | VTEAELKNHLDAAEKSPKQIAAAVLGLPEKTLRYK |
| Ga0070740_103733722 | 3300005607 | Surface Soil | MTEAELRKNIEEAEKSPKQIAAAVAGLSDKVLRYRPAPDKWCILEILA |
| Ga0070763_100640681 | 3300005610 | Soil | MTEAELKKHLDAAEKSPKEIAAAVSGLPEKTLRYKPSPDKWCVLEVLGHLA |
| Ga0068864_1005779812 | 3300005618 | Switchgrass Rhizosphere | MTEHELKMHLETAEKSPKLVAAAVSGLPDKVLRYKPAPDKWCILEIL |
| Ga0068864_1026766542 | 3300005618 | Switchgrass Rhizosphere | MTESELKKHLETAEKSPKLVAAAVSGLPDKVLRYKPAPDKWCILEIL |
| Ga0066903_1036351472 | 3300005764 | Tropical Forest Soil | MTGVQFQSHLDAAEKSPKDIAKAISGLSDRVLRYKSSPDKWCVLEILGHLA |
| Ga0075285_10472291 | 3300005890 | Rice Paddy Soil | MTADELKQHIDSAEKDPKKIAAAVSGVPDSILRYKPSREK |
| Ga0075281_10718202 | 3300005897 | Rice Paddy Soil | MTEAELKKHLEAAEKSPKLIAAAVSGLPEKTLRFKPAPDKWSIIEIL |
| Ga0070766_100053521 | 3300005921 | Soil | MTDAELKNLLEVAEKSPKQIAAAVSGLPDKTLRYKPSPDKWCILE |
| Ga0080026_100454263 | 3300005952 | Permafrost Soil | VTEAELKKRLDAAEDSSKQIAAAVLSLPEKTLSYKSSRANSAF* |
| Ga0066789_100642971 | 3300005994 | Soil | MTEAELKQHLEAAEKSPKQIATAVSGLPDKVLRYKPSPEKWCILEILGH |
| Ga0066696_105858742 | 3300006032 | Soil | MTESELKKHLDAAEQSPKQVAAAVSGLGERTLHYKPAPDK |
| Ga0075028_1004362931 | 3300006050 | Watersheds | MTEAELKKHLDAAEKSPKQIATAVAGLPEKMLRYKPSPE |
| Ga0075029_1000814853 | 3300006052 | Watersheds | MTDAEFKKHLDAAEKSPKEIAAAVSGLSDKVLRYKPSPEKW |
| Ga0075029_1001143571 | 3300006052 | Watersheds | MTESELKDYLEAAEKSPKQIAAAVLGLAEKVLRYKPASDKWCI |
| Ga0075017_1002242662 | 3300006059 | Watersheds | MTESELKKHLEAAEKSPKQVAAAVSGLAEKTLRYKPAPDKWCILEI |
| Ga0075017_1008590252 | 3300006059 | Watersheds | MTESELKKHLDAAEKSPKQVAAAVSGLPEKTLRYKPAPD |
| Ga0075019_111311671 | 3300006086 | Watersheds | MTEAELKKHIEAAEKSPKEIAAAVSGLVPAVLRYKPAPDKWCILEILGHLADVEIIY |
| Ga0075015_1008570692 | 3300006102 | Watersheds | MTEAEFKKHLDAAEKSPKEIAAAVSGLSDKVLRYKPSPEKW |
| Ga0075030_1013336142 | 3300006162 | Watersheds | VTESELKKHLDAAEKSPKQIAAAVLGLPEKTLRYKPALDKWCILEILGH |
| Ga0070715_102594221 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MTEGELKKYLEAAQKNPKQIAAAVSGLPEKVLRYKPAPDKWCIHEIL |
| Ga0075014_1004149361 | 3300006174 | Watersheds | MTEAELKKHLEAAEKSPKEIAAAVSGLPDEVLRYKPSPEKWCVLEILGH |
| Ga0075014_1006907842 | 3300006174 | Watersheds | MTESELKDYLEAAEKSPKQIAAAVLGLAEKVLRYKPASDKWCIHEILG |
| Ga0070765_1019070891 | 3300006176 | Soil | VTEAELKKHLDTAEDSPKRIAAAVLGLPEKTLRHKPSPDKWCILEI |
| Ga0075021_100450321 | 3300006354 | Watersheds | VHVSGDVMTESELKDYLEAAEKSPKQVAAAVSGLPDKVLRYKPSPDKWCIQE |
| Ga0068871_1020649092 | 3300006358 | Miscanthus Rhizosphere | MTESELKKHLEAAEKSPKQVAAAVSGLPEKVLRYKPAPDKWC |
| Ga0066653_106606141 | 3300006791 | Soil | MTEAEFRKHLDAAEKSPKQIAAAVSGLPDKTLRYKPAPDKWCILEI |
| Ga0066658_102693142 | 3300006794 | Soil | MTEAEIKNYLDEAEKGPKKLAAAVSGLSEKVLRYKPP |
| Ga0066658_108497542 | 3300006794 | Soil | MTEAEFRKHLDAAEKSPKQIAAAVSGLPDKTLRYKPAPD |
| Ga0066665_101793292 | 3300006796 | Soil | MTEAELKKHLEAAETSPKQIAAAVSGLPEKTLRYKPPGKWCILEILGHLAD |
| Ga0066665_105080682 | 3300006796 | Soil | MTEAELKKHLDAAEKSPKEIAAAVSGLPDQVLRYKPAPDKWSILEILG |
| Ga0066659_102714104 | 3300006797 | Soil | MTESEFKKHLDAAEKSPKQIAAAVSGLPDKTLRYKPAPDKWCILE |
| Ga0066660_106966461 | 3300006800 | Soil | MTESELKKHLDAAEQSPKQVAAAVSGLGERTLHYKPAPDKWCIQEVLGH |
| Ga0105244_103796971 | 3300009036 | Miscanthus Rhizosphere | MTEAELKKHLDAAEKSPREIAAAVSGLPEKVLRFKSAPNKWSI |
| Ga0099829_101303002 | 3300009038 | Vadose Zone Soil | MTEAELKKHLDAAEISPRQIAAAVSGLSDKALRYKPAPNK* |
| Ga0099828_100528893 | 3300009089 | Vadose Zone Soil | MTEAEFKKHLDAAEKSPKEIAAAVSGLPEKVLHYKPSPEKWCVLEVLGHLAD |
| Ga0099827_118293541 | 3300009090 | Vadose Zone Soil | MTEAELKKHLDAAEKSPKEIAAAVSGLSEKVLRYKPSPEKWCVLE |
| Ga0105245_102929221 | 3300009098 | Miscanthus Rhizosphere | MTEGELKKYLEAAEKNPKQIAAAVSGLPEKVLRYKPAPDKWCIHEILGHL |
| Ga0066709_1044687292 | 3300009137 | Grasslands Soil | MTEAEYKKHLDAAEKSPKQIAAAAIGLSDKVLRYKPSPDKWCILEILGHLAD |
| Ga0105241_101790781 | 3300009174 | Corn Rhizosphere | MTEHELKMHLETAEKSPKLVAAAVSGLPDKVLRYKPAPDKWCILEILG |
| Ga0116114_10039877 | 3300009630 | Peatland | MTEAEFKKHLDAAEKSPKEIAAAVSGLPEKVLRYKPSPDKWCVLEILGHLA |
| Ga0116102_11978461 | 3300009632 | Peatland | MTEAELKKHLDAAEKSPKEIAAAVSGLPEKVLRYKPSPEKWCVLEVL |
| Ga0116122_11970262 | 3300009639 | Peatland | MTEAELKKHLDAAEKSPKEIAAAVSGLPEKVLRYKPS |
| Ga0116216_105177972 | 3300009698 | Peatlands Soil | MTEAELNKHLEAAEKSPKQIAAAVSGLPDKTLRYKPS |
| Ga0116219_106412521 | 3300009824 | Peatlands Soil | MTEDVLNKHPDTAEKSPKQIAAAVLGLPEKTLRYKPSP |
| Ga0126373_101129511 | 3300010048 | Tropical Forest Soil | LTEAEFNQLLDAAEKSPKQIAAAVSGLSPEVLRYRISPEK |
| Ga0126373_108020181 | 3300010048 | Tropical Forest Soil | MTEEEFKKQLNAGENSPKEIAAAVSGLLESVLRYKP |
| Ga0126373_113885372 | 3300010048 | Tropical Forest Soil | LTEAEFKKLLDAAEKSPKEIAAAVSGLSEKVLRFKPSPEKWCVLEILGH |
| Ga0134086_100726322 | 3300010323 | Grasslands Soil | MTESEFKKHLDAAEKSPKQIAAAVSGLPDKTLRYKPAPDKWCILEILAH |
| Ga0074045_101437323 | 3300010341 | Bog Forest Soil | MTEAEFKKHLDAAEKSPKEIAAAVSGLSEKVLRYKPSPEQWCVLEILGHLADAE |
| Ga0074044_106740432 | 3300010343 | Bog Forest Soil | MTEAELKKHLDIAEKSPKEIAAAVSGLPDKTLRYKPSPEKWCILEIL |
| Ga0126372_112053283 | 3300010360 | Tropical Forest Soil | MTEAEFHSHLDAAENSPKEIAAAVSGLSEKVLRYK |
| Ga0126378_111221672 | 3300010361 | Tropical Forest Soil | MTDQELKKNLEAAEKSPKQIAAAVSGVPEKTLRFKPAPDKWCILEIL |
| Ga0126378_116317491 | 3300010361 | Tropical Forest Soil | MTEAELKKHLDTAEKSPKEIAAAVSGLLPAVLRYRSDPAKWCILEI |
| Ga0126379_116476521 | 3300010366 | Tropical Forest Soil | MTEAEFHSHLDAAEKSPKDIAAAVSGLSEKVLRYKPS |
| Ga0126379_131132472 | 3300010366 | Tropical Forest Soil | MTQAELKKHLEAAEKSPKEIATAVSGLPDKTLRYKPSPDKWC |
| Ga0105239_103494251 | 3300010375 | Corn Rhizosphere | MTEHELKMHLETAEKSPKLVAAAVSGLPDKVLRYKPAPDKWCILE |
| Ga0126381_1041455971 | 3300010376 | Tropical Forest Soil | MTEAEFKKNLDSAEKSPREIAAAVSGLSERVLHYKPSPEKWCVLEI |
| Ga0126381_1047417191 | 3300010376 | Tropical Forest Soil | LTEAELNKYLDAAEKSPKEIAVAVSGLSAKALRYKPSPEKWCVLEILGH |
| Ga0126381_1048319852 | 3300010376 | Tropical Forest Soil | MTDSELKKHIETAASSPKEIAAAVAGLPDATLRYKPAP |
| Ga0136449_1026681082 | 3300010379 | Peatlands Soil | MTEAEIRKHLDAAGKSPKEIAAAVSGLPDKVLRYKPSPEKWC |
| Ga0136449_1044695662 | 3300010379 | Peatlands Soil | MTEAELTKHLDTAEDSPKQIAAAVSGLSDKILRYKPSPNKWCILEILGHLV |
| Ga0126383_125381732 | 3300010398 | Tropical Forest Soil | MTVAELKKCLDAAERSPREIAASVSGLSEKVLRYKSAPDKW |
| Ga0134122_132074252 | 3300010400 | Terrestrial Soil | MTEHELKMHLETAEKSPKLVAAAVSGMPDKVLRYKPAPDKWCILEILGHLA |
| Ga0137392_101104972 | 3300011269 | Vadose Zone Soil | MTEAEFKKHLDAAEKSPKEIAAAVSGLPERDLRYKPSP |
| Ga0137392_105215031 | 3300011269 | Vadose Zone Soil | MTEAELKKHLDAAEISPRQIAAAVSGLSDKTLRYKPAPNRWSILEILGH |
| Ga0137392_110684282 | 3300011269 | Vadose Zone Soil | MTQAELQKHLDAAEKSPKQIAAAVSGLPDKTLRYKP |
| Ga0137391_103466671 | 3300011270 | Vadose Zone Soil | MTESELKKHLDAAEKSPKQLAAAVSGLTETVLRYKPA |
| Ga0137391_105052851 | 3300011270 | Vadose Zone Soil | MTEAELKKHLAAAEKSPKEIAAAVSGLSEKVLRYKPSPEKWCVLEVL |
| Ga0137391_107477551 | 3300011270 | Vadose Zone Soil | MTEAEFKKHLDAAEKSPKEIAAAVSGLPEKVLHYKPSPEKWCVLEV |
| Ga0137391_109928681 | 3300011270 | Vadose Zone Soil | MTEAEFKKHLDAAEKSPKEIAAAVSGLPEKVLHYKPSPEKWCV |
| Ga0137391_110163792 | 3300011270 | Vadose Zone Soil | MTDSELKEYLEAAAKNPKQVAAAVSGLPERVLRYKPAPD |
| Ga0137393_117802982 | 3300011271 | Vadose Zone Soil | MTDSELKEYLEAAAKNPKQVAAAVSGLPERVLRYKPAP |
| Ga0137389_115273521 | 3300012096 | Vadose Zone Soil | MTESELKKHLEAAEKSPKQIAMAVSGVPDKVLRYKPSPDKLCILEILGHLTDIEIVYAYRLR |
| Ga0137388_114643982 | 3300012189 | Vadose Zone Soil | MTEAELKKHLDAAEKSPKQIAAAVSGLPDKTLRYKPSPDKWCIH |
| Ga0137363_116371381 | 3300012202 | Vadose Zone Soil | MTEAELKKHLDAAEQSPKEIAAAVSGLSEKVLRYRPSPEKWCVLEVLGH |
| Ga0137399_108345982 | 3300012203 | Vadose Zone Soil | MTEAELKKHLDAAEISPRKIAAAVSGLSDKALRYKPAPNRWSILEILG |
| Ga0137399_112927711 | 3300012203 | Vadose Zone Soil | MSEGELKKYLDAAEQNPKQIATAVSGLPEKMLRYKPAPGRW |
| Ga0137362_115086331 | 3300012205 | Vadose Zone Soil | MTETEFKQHLDAADKSPKEIAAAVSGLSEKVLRYRPS |
| Ga0137379_107465402 | 3300012209 | Vadose Zone Soil | MTELELKKHLDVATKSPQQIAVAVSRVPDAVLRYKPAPEKWCILEVLGHLAD |
| Ga0137387_112685742 | 3300012349 | Vadose Zone Soil | VTQAELNKRLDAAEKSPKQIAAAVSGLSDKTLRYKPSADKWCILEILG |
| Ga0137360_106616282 | 3300012361 | Vadose Zone Soil | MTEAEFKKHLDAAEKSPKEIAAAVSGLPEKILRYKPSPEKWCVLEVLGHLADIEI |
| Ga0137361_106567612 | 3300012362 | Vadose Zone Soil | VSLDPEVVMTEAEFKKHLDAAEKSPKEIAAAVSGLPEKVLCYKPSPEKWCVLEVLGHLADIE |
| Ga0137361_107285121 | 3300012362 | Vadose Zone Soil | MTEAEFKKHLDAAEKSPKEIAAAVSGLPEKVLRYKPSPEKWC |
| Ga0137398_105516332 | 3300012683 | Vadose Zone Soil | VTEAVLKKHLDDAEKSPKQIAAVVLGLSEKTLRHKPAPD |
| Ga0137395_106126721 | 3300012917 | Vadose Zone Soil | VTEAELKTHPDAAEKSPKQIAAAVLGLAEKTLRRETI |
| Ga0137404_102028421 | 3300012929 | Vadose Zone Soil | MTEAEFKKHLEAAEKSPKQIAAAVSGLADKTLRHKPAPDKWCILKFWGGSC* |
| Ga0137404_106594301 | 3300012929 | Vadose Zone Soil | MGAFMTESDLKKHLDAAEKSPKQVAAAVSGLAEETLRYKPA |
| Ga0137410_102411041 | 3300012944 | Vadose Zone Soil | MNEAEFKKHLDAAEKSPKQIAATVSGLADKVLRYKPSPDKWCIHEI |
| Ga0137410_103282141 | 3300012944 | Vadose Zone Soil | MTESELKKHLDAAEKSPKQLAAAVSGLTETVLRYKPAPDKWCIL |
| Ga0126375_116723671 | 3300012948 | Tropical Forest Soil | MTESQLKEHLAAAEKSPKEIAAAVSGLSPQVLRYKSAPEKWSILEILGHLA |
| Ga0164301_118986211 | 3300012960 | Soil | MTEAEFKKHLDAAEKSPKEIAAAVSGLSEQILRYKPSPEKWCVLEMLGHL |
| Ga0126369_123075162 | 3300012971 | Tropical Forest Soil | MSEAELKENIAAADKSPKQIAAAVSGLPDAILRYKPAPN |
| Ga0126369_126124432 | 3300012971 | Tropical Forest Soil | MTEAEFKQHLDSAEKSPGEIAAAVAGLPDKILRFKPTPEKWCILEILGHLADME |
| Ga0164306_106739501 | 3300012988 | Soil | MTESELKKHLEAAEKSPKEIAAAVSGLSPAVLRYRSNPQKWCILEILAHLAD |
| Ga0157374_100475001 | 3300013296 | Miscanthus Rhizosphere | MTEAEIKNYLDEAEKGPKKLAAAVSGLTDKVLRYK |
| Ga0181518_105840551 | 3300014156 | Bog | MTETEFKTHLDAAEKSPKEIAAAVSGLSEKVLRYKPSPEKWCVLEVLGHL |
| Ga0181526_105326772 | 3300014200 | Bog | MTEAEFKKHLDAAEKSPKEIAAAVSGLSEKVLRYKPSPEKW |
| Ga0182016_104898132 | 3300014493 | Bog | MTTQPSANEVKQHLEAAERSPREVAAAVSGLPEKTLLYKPSPEKWSILEILSH* |
| Ga0182012_101935393 | 3300014499 | Bog | VTEAELKKHLDAAEKSPKEIAAAVLGLPEKTLRYKPSPDKWCIW |
| Ga0157377_112213421 | 3300014745 | Miscanthus Rhizosphere | MRSVMTEAEIKNYLDEAEKVPKKLAAAVSGLTDKVLHYKPTPDKWCIL |
| Ga0134085_105714072 | 3300015359 | Grasslands Soil | MTESEFKKHLDAAEKSPKQIAAAVSGLPDKTLRYKPA |
| Ga0132258_139663601 | 3300015371 | Arabidopsis Rhizosphere | MTESEFKKHLDAAEKSPKQIAAAVSRLPDKTLRYKPAPDKWCILEILAH |
| Ga0132256_1000456764 | 3300015372 | Arabidopsis Rhizosphere | MTESELKKHLETAEKSPKLVAAAVSGLPDKVLRYKPAPDKWCILEILG |
| Ga0132256_1001391613 | 3300015372 | Arabidopsis Rhizosphere | MTEAELKKHLEAAERSPKEIAAAVSGLSPQVPRYKPSADKWSILEILG |
| Ga0132255_1005240982 | 3300015374 | Arabidopsis Rhizosphere | MTESELKKHLETAEKSPKLVAAAVSGLPDKVLRYKPAPDKWCILE |
| Ga0132255_1058500131 | 3300015374 | Arabidopsis Rhizosphere | MTESELKKQLDAAEKSPKQVAAAVLGLAEKVLRYKPAPHKW |
| Ga0182041_122945602 | 3300016294 | Soil | MNQAELKERIATADKSPKQIAAAVSGLPDAVLRYKPAANKWS |
| Ga0182033_104500423 | 3300016319 | Soil | LTEAEFKKLLDAAEKSPKEIAAAVSGLSEKVLRFKPSPE |
| Ga0182033_116286002 | 3300016319 | Soil | SIPTHSEATLTEAELKKHLDAAEKSPKGIAAAVSGLSNKALHNKPSPE |
| Ga0182034_101746851 | 3300016371 | Soil | LTEAELKKHLDAAGKSPKEIAAAVSGLSNKALHYKPSPEKW |
| Ga0182040_101618501 | 3300016387 | Soil | LTEAELKKHLDAAEKSPKEIAAAVSGLSNKALHYKPSPEKWS |
| Ga0134074_10667272 | 3300017657 | Grasslands Soil | MTEAEFRKHLDAAEKSPKQIAAAVSGLPDKTLRYKPAP |
| Ga0187824_103905771 | 3300017927 | Freshwater Sediment | MTERELKQHLDAAEKSPKQVAAAVSGVAEKVMRYKSSPEQWCILE |
| Ga0187806_11399912 | 3300017928 | Freshwater Sediment | VTEAELNKHLDEAEQSPKQIAAAVSGLPDAKLRYKPSPEKWSILEV |
| Ga0187801_103751432 | 3300017933 | Freshwater Sediment | MTEAEFKKHLDAAERSPKEIAAAVSGLPEKVLRYK |
| Ga0187803_101320462 | 3300017934 | Freshwater Sediment | MTETEFKKHLDAAEKSPKEIAAAVSGLSEKFLRYKPSPEKWCVLEVLGHLADA |
| Ga0187853_103175891 | 3300017940 | Peatland | VTEAELKKHLDDAEKSPKQIAAAVLGLPEKTLRYKPSPDKWCILEIL |
| Ga0187808_103996161 | 3300017942 | Freshwater Sediment | MTEAEFKKHLDAAEKSPKEIAAAVSGLPEKVLRYKPSPDKWCVLEI |
| Ga0187819_103300041 | 3300017943 | Freshwater Sediment | LRSEACVTEAELKKHLDAAEESPKQIAAAVLGLPEKTLRYKPSPDKWCI |
| Ga0187879_100920635 | 3300017946 | Peatland | VTGAELKKHLDAAEESPKQIAAAVLRLPEKTLRYKPSPDKWCIVEILG |
| Ga0187817_104980641 | 3300017955 | Freshwater Sediment | MTEAEFKKHLEAAVKSPKEIAAAVSGLPEEVLRYK |
| Ga0187779_103399802 | 3300017959 | Tropical Peatland | MTETEFKKHLDAAEKSPKQIAAAVTGLSDATLRYKPAPD |
| Ga0187776_115648871 | 3300017966 | Tropical Peatland | MTEAELRKHLDAAEKSPKQIAAAVSGLPQRILLYKPAPDKW |
| Ga0187781_100776503 | 3300017972 | Tropical Peatland | MTVAEFKKRLDDAEKSPKEIAAAVSGLPEKVLRYKPSPEKWCV |
| Ga0187781_109440171 | 3300017972 | Tropical Peatland | MGGAMTETEYRKHLNAAEKSPKEIAAAVSGLPEKVLRYKPSPEKWCV |
| Ga0187782_101802462 | 3300017975 | Tropical Peatland | MGGAMTETEFRKHLDAAEKSPKEIAAAVSGLPEKVLRYKPSPEKWCVLEVLGH |
| Ga0187816_103433402 | 3300017995 | Freshwater Sediment | MTEAELKKHLEAAERSPKEIAVAVSGLPEKVLRYKPS |
| Ga0187805_100067885 | 3300018007 | Freshwater Sediment | MTEAELKKQLEAAEKSPKQIAAAVSGLPDKTLRYKPSPDKWCI |
| Ga0187884_100540801 | 3300018009 | Peatland | VTEAELTKHLDTAEKSPKQIAAAVLGLPEKTLRYKPSPDK |
| Ga0187884_101020273 | 3300018009 | Peatland | MTETEFKKHLDAAEKSPKEIAAAVSGLSEKVLRYKPSP |
| Ga0187810_103583422 | 3300018012 | Freshwater Sediment | MTEAELRKHLDTAEKSPKQIAAAVSGLSDKVLRYKPSP |
| Ga0187861_100350473 | 3300018020 | Peatland | LTEADLKKHLDAAEKSPKEIAAAVSGLSEKILRYKPSQEKWCVLEVLGHLADAEII |
| Ga0187861_101980141 | 3300018020 | Peatland | MTEAELKKHLDAAEKSPKEIAAAVSGLPEKVLRYKPSPEKWCVLEILGHLA |
| Ga0187861_104013891 | 3300018020 | Peatland | MTETEFKKHLDAAEKSPKEIAAAVSGLPEKVLRYKPSPEKWCVLEI |
| Ga0187869_104300412 | 3300018030 | Peatland | MTEGELKKHLDAAEKSPKEIAASVSGLPDKILRYKPSLD |
| Ga0187863_100426093 | 3300018034 | Peatland | LRNHKWASPVTEAEFKKHLDTAEKSPKEIAAAVSGLSEKVLRYKPSPEKWC |
| Ga0187875_103611971 | 3300018035 | Peatland | MTEAELKKYLDAAEKSSKEIAAAVSGLPEKVLRYKPS |
| Ga0187883_102422101 | 3300018037 | Peatland | VTGAELKKHLDAAEESPKQIAAAVLRLPEKTLRYKPSPDKWCIVEIL |
| Ga0187871_102325092 | 3300018042 | Peatland | VTEAELKGYLEASEKSPKQIAAAVLGLPEKTLRYKSSPDKWCILEILGHLA |
| Ga0187890_106553741 | 3300018044 | Peatland | MTEAELKKHLDAAEQSPKQIAAAVLGLPDETLRSKPSPDKWCIL |
| Ga0187890_107980321 | 3300018044 | Peatland | MLTEAEIKKHLDAAEKSPKEIAAAVSGLSEKVLRYKPSPEKWCVLE |
| Ga0187858_105121212 | 3300018057 | Peatland | MTEADLKKHLDAAEKSPKEIAAAVSGLSEKVLRYKPSPEKWCVLEVLGHL |
| Ga0187766_111857932 | 3300018058 | Tropical Peatland | MNDAEFKKHLEAAEKSPPEIAGAVSGLPEKVLRYKPSPEKWCVLE |
| Ga0187765_111451891 | 3300018060 | Tropical Peatland | MTEAEAKQHIDAAEKSPKQIATAVSGLPDRVLRYKPAPAKWCIVEILA |
| Ga0187773_100232893 | 3300018064 | Tropical Peatland | MTDKELKKLIETAENEPRLVAAAVSGLKDKVLDYK |
| Ga0187769_100379641 | 3300018086 | Tropical Peatland | MTEAELKKHLDAAEKSPKQIAAAVSGLPDKVLRHKPGPEKWCILEILGHLVDVEVV |
| Ga0187769_102387491 | 3300018086 | Tropical Peatland | MAELQKHLDDAEKSPKQIAAVSGLPDKTLRYKPAPDKW |
| Ga0187769_111171661 | 3300018086 | Tropical Peatland | MPMTEAEFKKYLDAAEKSPKEIAAAVSGLSEKVLRYKPSPEKWCVLE |
| Ga0187771_108642562 | 3300018088 | Tropical Peatland | MTETELKKHLDIAEKSPKEIAAAVSGLPDKTLRYK |
| Ga0187771_109246211 | 3300018088 | Tropical Peatland | MTEAELKKHIEDAEKSPKQIAAAVSGLPDKTLRYKPAP |
| Ga0187770_104933892 | 3300018090 | Tropical Peatland | MTEADLKKHLDAAEKSPKEIAAAVSGLSEKVLRYKPSPEK |
| Ga0066667_110810372 | 3300018433 | Grasslands Soil | MNEAELKQHLEAAEKSPKQIAAAVSGLPDKTLRYKPAPHKWCILEV |
| Ga0066669_105996371 | 3300018482 | Grasslands Soil | MTEEQFHSHLDDAERSPKDIAAAISGLSDKVLRYKPSPDRWCMLEILG |
| Ga0193715_10736811 | 3300019878 | Soil | MNEAELKQHLEAAEKSPKQIAAAVSGLPDKTLLYKPAPGKWCI |
| Ga0193723_10089153 | 3300019879 | Soil | MTEAELKKHLETAEKSPKEIAASVSGLAPAVLRYKPSLEKWSIL |
| Ga0193729_11489032 | 3300019887 | Soil | MTQAELQKHLGDAEKSPKQIAAAVSGLPDKTLRYKPAPDKWCILEI |
| Ga0193721_10037013 | 3300020018 | Soil | MNEAELKQHLEAAEKSPKQIAAAVSGLPDKTLRYKPAPDKWCILGSTGPPGRH |
| Ga0210407_1000102726 | 3300020579 | Soil | MTQAELQKHLDAAEKSPKQIAAAVSGLSEKTLRYKPAPDK |
| Ga0210403_1000456010 | 3300020580 | Soil | MTEAELRKHLDTAEKSPKQIAAAVSGLPEKTLRYKPSPDQ |
| Ga0210399_100325181 | 3300020581 | Soil | MTEAELTKHIEVAEKSPKEIAAAVSGLSPAGLRYKPKPDKWCILEILGH |
| Ga0210399_102875712 | 3300020581 | Soil | LTETEFKNHLEAAEKSPKEIAAAVSGLPEKVLRYKPSPEKWCVLEVLGHLADIEI |
| Ga0210399_106382211 | 3300020581 | Soil | MVKAMTEAEFKKHLDAAEKSPKEIAATVSGLSEKVLRYKPAPKKWC |
| Ga0210401_104998581 | 3300020583 | Soil | MTEAELKKHLDAAEQSPKQIAAAVSGLSDKTLRYKPSPGKWCIL |
| Ga0210401_106768311 | 3300020583 | Soil | MTEAELKQHLDAAEKSPKEIAAAVSGLAPELLRHKPAPDKWSILEILGQLA |
| Ga0210401_108526951 | 3300020583 | Soil | MTEAEFRKHLDAAERNPKEIAAAVSGLSQQILRYKPSPEKWCVLEILGHLADVE |
| Ga0210406_104116072 | 3300021168 | Soil | MTDSELKKYLEAAEKNPKQVAAAVSGLPEKVLRYKPAPDKWCIQEILG |
| Ga0210400_102556752 | 3300021170 | Soil | MTEAELKKHLDAAEKSPKEIAAAVSGLAEKVLRYKPSPEKWCVL |
| Ga0210400_112930972 | 3300021170 | Soil | MTEAELKKHLDAAEKSPKEIAAAVSGLPDKILRYKPSA |
| Ga0193719_101467982 | 3300021344 | Soil | MTEAELKKHLETAEKSPKEIAASVSGLAPAVLRYKPSPEK |
| Ga0213875_100485734 | 3300021388 | Plant Roots | VTEAEFKKHLDVAEKSPREIAAAVSGLSEELLRYKPSPD |
| Ga0210393_100399351 | 3300021401 | Soil | VTEAELKKHLDTAEDSPKRIAAAVLGLPEKTLRHKPSPDKWSILE |
| Ga0210397_100556661 | 3300021403 | Soil | MTEKELKNHLEAAEKSPKQVAAAVLGLSEKVLRYKPAPDKWCIL |
| Ga0210389_101797661 | 3300021404 | Soil | MTEAELKKHLDAAEKSPKQIAAAVSGLPDKTLCYKPSPDKWCILEVL |
| Ga0210387_118048791 | 3300021405 | Soil | MTEAELKKHLDLAEKSPKQIAAAVLGLPDKTLRYKPAPDKWCILEILAHLA |
| Ga0210386_108903232 | 3300021406 | Soil | MTEAELKKHIEAAEKSPKEIAAAVSGLPPDVLRYKPAPEKWSILEIL |
| Ga0210394_106404283 | 3300021420 | Soil | VTEAELKNHLDAAEKSPKQIAAAVLGLPEKTLRYKPSLD |
| Ga0210384_105494331 | 3300021432 | Soil | MTDAELKNHLDVAEKSPKQIAAAVSGLPDKTLRYKPS |
| Ga0210410_105017892 | 3300021479 | Soil | MTEAELKKHLDAAEKSPKEIAAAVSGLAEKVLRYKPSPEKWCVLEVLGQL |
| Ga0210410_109799712 | 3300021479 | Soil | MTEKELKNHLEAAEKSPKQVAAAVLGLSEKVLRYKPAPDKWCILEI |
| Ga0210410_116890792 | 3300021479 | Soil | MTESEVKKHLEAAEKSPKQIAAGVSGLPEKTLRYKPAP |
| Ga0210409_108417521 | 3300021559 | Soil | MTEAELKKHLEAAEKSPKEIAAAVSGLAPEVLRRKPAPDKWSIL |
| Ga0210409_110995252 | 3300021559 | Soil | VTEGELKKHLDAAEKSPKQIAAAVLRLPEKTLRYKPTPDKWC |
| Ga0242666_11905011 | 3300022721 | Soil | WNETRGRRPLTETEFKNHLEAAEKSPKEIAAAVSGLPEKVLRYKPSPEKWCVL |
| Ga0224569_1031852 | 3300022732 | Rhizosphere | MTEAELKKYLDAAEKSPKQVAAAVSGLPDKTLRYKPSPDKWCILE |
| Ga0224557_10717401 | 3300023101 | Soil | MTEAEFKKHLDAAEKSPKQIAAAVSGLSDKALRYKPSPEKWCVLEI |
| Ga0224557_11674681 | 3300023101 | Soil | MTEADLKKHLDAAEKSPKQIAAAVSGLPEKTLRYKPAPDKWCIL |
| Ga0209171_101843875 | 3300025320 | Iron-Sulfur Acid Spring | VTEAELKNHLDAAEKSPKQIAAAVLGLPEKTLRHKPS |
| Ga0208455_11040801 | 3300025453 | Peatland | MTEAELKKHLDAAEKSPKEIAAAVSGLPEKVLRYKPSPEKWCVLEV |
| Ga0208820_10701612 | 3300025576 | Peatland | MTEAEFKKHLDAAEKSPKEIAAAVSGLPEKVLRYKPSPDKWCVLE |
| Ga0207692_100362403 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MTEFEVKQHLEAAEQNPKQVAAAVSGLSEKILRFKPAPDQWCILDVLGHL |
| Ga0207685_106536252 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MTEIDLKKHLEAAEKSPKQVAAAVSGLPEKVLRYKPSPEKWCIHDIL |
| Ga0207699_101591711 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MTEFEVKQHLEAAEQNPKQVAAAVSGLSEKILRFKPAPDQWCILDV |
| Ga0207707_112975892 | 3300025912 | Corn Rhizosphere | MTESELKKHLEAAEKSPKQVAAAVSGLPEKVLRYKPAAD |
| Ga0207695_109222672 | 3300025913 | Corn Rhizosphere | MTEAELKKHLDAAEKSPREIAAAVSGLPEKVLRFKPAP |
| Ga0207671_105071861 | 3300025914 | Corn Rhizosphere | MLVSLFVGDLMTEIDLKKHLEAAEKSPKQVAAAVSGLPEKVLRYKPS |
| Ga0207687_109159621 | 3300025927 | Miscanthus Rhizosphere | MTEHELKMHLETAEKSPKLVAAAVSGLPDKVLRYK |
| Ga0207687_115531672 | 3300025927 | Miscanthus Rhizosphere | MTEGELKKYLEAAEKNPKQIAAAVSGLPEKVLRYKPAPDKWCIHEILG |
| Ga0207700_109616382 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MTDAELKKHLEVAEKSPKEIAAAVSGLSPAVLRYRSNPAKWCILEIL |
| Ga0207706_100699903 | 3300025933 | Corn Rhizosphere | MTEAEIKNYLDEAEKGPKKLAAAVSGLTDKVLRYKPTPDKWCILEIL |
| Ga0207704_104222861 | 3300025938 | Miscanthus Rhizosphere | MTEAELKKHLDAAEKSPREIAAAVSGLPEKVLRFKSAP |
| Ga0207704_114187562 | 3300025938 | Miscanthus Rhizosphere | MTESELKKHLEAAEKSPKQVAAAVSGLPEKVLRYKPAPD |
| Ga0207679_100918601 | 3300025945 | Corn Rhizosphere | MTEAEIKNYLDEAEKGPKKLAAAVSGLTDNLLRYKP |
| Ga0207678_105612772 | 3300026067 | Corn Rhizosphere | MTEAEIKNYLDEAEKGPKKLAAAVSGLTDNVLRYKPTPDKWCILEIL |
| Ga0207702_101258581 | 3300026078 | Corn Rhizosphere | MTESELKKHLETAEKSPKLVAAAVSGLPDKVLRYKPAPDKWCILEILGH |
| Ga0207641_103891632 | 3300026088 | Switchgrass Rhizosphere | MTDNELRAYLEDAEKNPRQIAATVSGLHDKVLRYKPAPDKW |
| Ga0207676_101424713 | 3300026095 | Switchgrass Rhizosphere | MTEHELKMHLETAEKSPKLVAAAVSGLPDKVLRYKPAPDKW |
| Ga0207676_117862152 | 3300026095 | Switchgrass Rhizosphere | MTESELKKHLETAEKSPKLVAAAVSGLPDKVLRYKPAPDK |
| Ga0207683_100019171 | 3300026121 | Miscanthus Rhizosphere | MTEAELKKHLDAAEKSPREIAAAVSGLPEKVLRFK |
| Ga0207698_104443631 | 3300026142 | Corn Rhizosphere | MTEAELKKHLDAAEKSPREIAAAVSGLPEKVLRFKPAPNKWS |
| Ga0209863_101855061 | 3300026281 | Prmafrost Soil | MTQAELTKLLDAAEKSPKQIAAAVSGLPEKTLCYK |
| Ga0209240_10621751 | 3300026304 | Grasslands Soil | MTEIELKKHLEAAEKSPKQIAVAVSGLPDKVMRYKPAPDKWCILEILGHLTDIEIVYAY |
| Ga0209267_13232422 | 3300026331 | Soil | MTEAEFRKHLDAAEKSPKQIAAAVSGLPDKTLRYK |
| Ga0257156_11415642 | 3300026498 | Soil | MTEAELKKHLDAAEKSPKQIAAAVSGLPEKTLRYKPSPDKWCILEI |
| Ga0209805_10406943 | 3300026542 | Soil | MTEAELKKHLDAAEISPRKIAAAVSGLSDKALRYKPAPNR |
| Ga0209648_100933292 | 3300026551 | Grasslands Soil | VTEAELKNHLGDAEKSPKQIAAAVLGLPEKTLRYKSSPDKW |
| Ga0179587_103800332 | 3300026557 | Vadose Zone Soil | MTETEFKKHLDAAEKSPKEIAAAVSGLSEKVLRYKPSPEKWC |
| Ga0207852_10351032 | 3300026959 | Tropical Forest Soil | MTEAEFKKHLDAAEKSPREIAAAVSGLPDKVLRYKPSPEQ |
| Ga0209213_10611301 | 3300027383 | Forest Soil | MTESELKTHLEAAEKSPKQIAIAVSGLPDRVIRYKPSPDKWCILEILGHLTDI |
| Ga0209421_10275612 | 3300027432 | Forest Soil | MTQAELTKLLDAAEMSPKQIAAAVSGLPEKTLRYKPAPDKWCILEIL |
| Ga0209219_10319082 | 3300027565 | Forest Soil | MTEAELKKHLDAAEKSPKEIAAAVSGLSEKVLRYK |
| Ga0209219_11512082 | 3300027565 | Forest Soil | MTEAELKKHLDAAEKSPKQIATAVLGLPEKTLRYKPSPDKWCILEILGHL |
| Ga0208043_11109612 | 3300027570 | Peatlands Soil | MTEAELKKHLDTAEKSPKQIAAAVLGLPDKTLRYKPSPDKWCILEVL |
| Ga0208827_10182073 | 3300027641 | Peatlands Soil | MTEAEFKKHLDAAEKSPKQIAAAVSGLPDKTLRYKPSPDKWCILEIL |
| Ga0209117_10857562 | 3300027645 | Forest Soil | MTEAELKKHLDVAEKSPKQIATAVLGLAEKTIRYK |
| Ga0209333_11480561 | 3300027676 | Forest Soil | MTEAELKKHLDLAEKSPKEIAAAVLGLTDKTLRYKP |
| Ga0209656_104248692 | 3300027812 | Bog Forest Soil | MTQAELTKLLDAAEKSPKQIAVAVSGLPEKTLHYK |
| Ga0209701_102546982 | 3300027862 | Vadose Zone Soil | MTQAELQKHLDAAEKSPKQIAAAVSGLPDKKLRYKPAQD |
| Ga0209167_103814812 | 3300027867 | Surface Soil | MTEAELKKHLDAAEKSPKEIAAAVSGLPDKILRYKPAAD |
| Ga0209590_100575031 | 3300027882 | Vadose Zone Soil | MTEAEFRKHLDAAEKSPKQIAAAVSGLPDKTLRYKPAPDKWCILEILA |
| Ga0209068_100207511 | 3300027894 | Watersheds | VHVSGDVMTESELKDYLEAAEKSPKQVAAAVSGLPDKVLRYKPSPDKWCIQEIL |
| Ga0209488_106298021 | 3300027903 | Vadose Zone Soil | MTEAEFKKHLDAAEKSPKEIAAAVSGLSEKVLRYKPSPEKWCVL |
| Ga0209415_108455801 | 3300027905 | Peatlands Soil | MTESELKKHLDAAEKSPKQIAAPVLGLSDKTLRYKPSPDKWCILEILGHLA |
| Ga0209698_108011712 | 3300027911 | Watersheds | VTESELKKHLDAAEKSPKQIAAAVLGLPEKTLRYKPALDKWCILEILGHL |
| Ga0209698_111579801 | 3300027911 | Watersheds | MTDAEFKKHLDAAEKSPKEIAAAVSGLSDKVLRYKPSPEKWSV |
| Ga0209698_111997931 | 3300027911 | Watersheds | MTEAEFKKHLDAAEKSPKEIAAAVSGLSDKVLRYKPSPEKWSV |
| Ga0265356_10344381 | 3300028017 | Rhizosphere | VTEAELKKHLDAAEESPKQVAATVLGLPEKTLRHKPCPDRWCILEILGHLA |
| Ga0307305_102558642 | 3300028807 | Soil | MNEAELKQHLEAAEKSPKQIAAAVSGLPDKTLLYKPAPGKWCILE |
| Ga0308309_100499944 | 3300028906 | Soil | MTEAELKKHLDAAEKSPKEIAAAVSGLAEKVLRYKPSPEKW |
| Ga0302148_11554102 | 3300029916 | Bog | VTEAELKKHLDAAEKSPKEIAAAVLGLPEKTLRYKPSPDK |
| Ga0311343_112969401 | 3300029953 | Bog | MTTQPSANEVKQHLEAAERSPREVAAAVSGLPEKTLLYKPSPEKWSILEIL |
| Ga0310037_100387631 | 3300030494 | Peatlands Soil | MTEADLKKHLDAAEKSPKQIAAAVSGLPDKSLRYKP |
| Ga0310038_102082471 | 3300030707 | Peatlands Soil | MTEAELKQHLEAAEKSPKQIAVAVSGLPDKTLRYKPSPDKWCILEILGH |
| Ga0170824_1138764821 | 3300031231 | Forest Soil | MTEAELKKHLEAAEKSPKEIAAAVSGLSPAVLRYRSNPAKWCILEILAH |
| Ga0170824_1142338801 | 3300031231 | Forest Soil | MTEFEVKQHLEAAEQNPKQVAAAVSGLPEKILRFKPAPDQWCILDVLGHLA |
| Ga0302140_103210791 | 3300031261 | Bog | MTTQPSANEVKQHLEAAERSPREVAAAVSGLPEKTLLYKPSPEK |
| Ga0302326_134435852 | 3300031525 | Palsa | MTETELKKHLDAAEKSPKEIAAAVSGLPEKVLRYKPSPEKWCVLEILG |
| Ga0318528_107984691 | 3300031561 | Soil | MTEGELKKHIEAAEKSPKEIAAAVSGLAPAVLGYKPAPGNWSIQE |
| Ga0310686_1087714451 | 3300031708 | Soil | MTDAELKTHLDAAEKSPKQIAAAVSGLPDQVLRHKPSPEKWC |
| Ga0307476_105040491 | 3300031715 | Hardwood Forest Soil | MTETELKKHLEVAEKSPKQIAAAVSGLPDKALRYKPSPEKW |
| Ga0307476_107684211 | 3300031715 | Hardwood Forest Soil | MTEAEFKKHLEAAERSPKEVAAAVSGLSEQVLRYKPSPEKWCVL |
| Ga0318500_105011062 | 3300031724 | Soil | MTEAELKKHIEAAEKSPKEIAAAVSGLTPDVLRYKPTSNKW |
| Ga0306918_110149772 | 3300031744 | Soil | LTEAEFKKLLDAAEKSPKEIAAAVSGLSEKVLRFKP |
| Ga0307477_103726121 | 3300031753 | Hardwood Forest Soil | MTEAELKKHLEAAEKSPKEIAAAVSGLSEKVLRYKPSPEKWC |
| Ga0307475_109098962 | 3300031754 | Hardwood Forest Soil | MTEAELKKHLEAAEKSPKEIAAAVSGLAPEVLRRKPAPDKWSI |
| Ga0307475_113093841 | 3300031754 | Hardwood Forest Soil | MTEAELKKHIEAAEKSPKEIAAAVSGLSPAVLRYKPVPDKWCILEILGHLA |
| Ga0318526_102720651 | 3300031769 | Soil | MTEAELKKHIEAAEKSPKEIAAAVSGLTPDVLRYKPTSNKWNILEILG |
| Ga0318546_105645731 | 3300031771 | Soil | MATHGEATLTEAELKKHLDAAEKSPKEIAAAVSGLSNKALHYKPAPEKWCVLEI |
| Ga0307473_101219591 | 3300031820 | Hardwood Forest Soil | MTEAEFKKHLDAAEKSPKEIAAAVSGLPERVLRYKPSPEKWCVLEV |
| Ga0307473_101760242 | 3300031820 | Hardwood Forest Soil | MNEGELKQHLEAAEKSPKQIAAAVSGLPDKTLRYK |
| Ga0307473_108337122 | 3300031820 | Hardwood Forest Soil | MTETELKNHLDTAEKSPKEIAAAVSGLSPTVLRYKPDPAKWCILEILAHLADIEI |
| Ga0318567_104495991 | 3300031821 | Soil | MTEAELKKYIEAAEKSPKEIAAAVSGLTPDVLRYKPTSNKWNILEILGHL |
| Ga0307478_110256121 | 3300031823 | Hardwood Forest Soil | MTEAEFRKHLDAAEKSPKEIAAAVSGLPDKVLRYKPSPDKWCVLEVLGH |
| Ga0307478_113495232 | 3300031823 | Hardwood Forest Soil | MTEAEFKKHLEAAERSPKEVAAAVSGLSEQVLRYKPSPEKWCVLEIL |
| Ga0306925_109842311 | 3300031890 | Soil | MNQAELKERIATADKSPKQIAAAVSGLPDAVLRYKPAANKWSIL |
| Ga0306923_102525292 | 3300031910 | Soil | LTEAELKKHLDAAGKSPKEIAAAVSGLSNKALHYKPSPEKWCMLEILGHLADVEII |
| Ga0306921_100198111 | 3300031912 | Soil | LTEAELKKHLDAAEKSPKEIAAAVSGLSNKALHYKP |
| Ga0310916_101018271 | 3300031942 | Soil | LTEAELKKHLDAAGKSPKEIAAAVSGLSNKALHYKPSPEKWCM |
| Ga0310909_113456511 | 3300031947 | Soil | MNQAELKERIATADKSPKQIAAAVSGLPDAVLRYKPAANKWSILEIL |
| Ga0306922_121373902 | 3300032001 | Soil | LTEAEFKKLLDAAEKSPKEIAAAVSGLSEKVLRFKPSPEKWCVLEVLGHLA |
| Ga0318507_105527631 | 3300032025 | Soil | MTQAAYKKHLDAAEKSPKEIAATVSGLSDNVLRYKPSPEK |
| Ga0310911_108980731 | 3300032035 | Soil | MNEGELKKHIEAAEKSPKEIAAAVSGLAPAVLRYKPAPGKWSIQE |
| Ga0318558_106327492 | 3300032044 | Soil | LTEAELKKHLDAAEKSPKEIAAAVSGLSNKALHYKPSPEKWCVL |
| Ga0306924_106296881 | 3300032076 | Soil | LTEAEFKKLLDAAEKSPKEIAAAVSGLSEKVLRFKPSPEK |
| Ga0318577_104717951 | 3300032091 | Soil | LTEAEFKKLLDAAEKSPKEIAAAVSGLSEKVLRFK |
| Ga0311301_102710421 | 3300032160 | Peatlands Soil | MTEAEFKKHLDAAEKSPKEIAAAVSGLPEKVLRYKPSPEKWCVL |
| Ga0311301_125738521 | 3300032160 | Peatlands Soil | MTEAEIRKHLDAAGKSPKEIAAAVSGLPDKVLRYKPSPEKWCVL |
| Ga0307470_102966242 | 3300032174 | Hardwood Forest Soil | MTEAELKKHLGAAEKSPKEIAAAVSGLSPAVLRYRSDPQKWCILEILGHLADIEIVY |
| Ga0307471_1006464072 | 3300032180 | Hardwood Forest Soil | MTEAELKKHLEAAEKSPKEIAAAVSGLAPDVLRRKPAPDKWSILEILGH |
| Ga0307472_1000779713 | 3300032205 | Hardwood Forest Soil | MTDAELKKHLEVAEKSPKEIAAAVSGLSPAVLRYRSNPAKWCILEILAH |
| Ga0306920_1003983011 | 3300032261 | Soil | MNEGELKKHIEAAEKSPKEIAAAVSGLAPAVLRYKPAPGKWSIQEILG |
| Ga0306920_1008688603 | 3300032261 | Soil | LTEAELKKHLDAAEKSPKEIAAAVSGLSDKALHYKP |
| Ga0306920_1011439833 | 3300032261 | Soil | LTEAEFKKLLDAAEKSPKEIAAAVSGLSEKVLRFKPS |
| Ga0306920_1030746851 | 3300032261 | Soil | MTDSELKKHIETAASSPKEIAAAVAGLPDATLRYKPAPNKWSILEML |
| Ga0306920_1044791511 | 3300032261 | Soil | MTKAQLQSHLDAAEKSPRDIATAVSGLSDEVLRYKPSSDK |
| Ga0335085_123315461 | 3300032770 | Soil | MTEGEFKYHLEAAEKSPKQIAAAVSGLSEKILRYKPAPDKWCILE |
| Ga0335079_103165872 | 3300032783 | Soil | MTEDELKKQLDVAEKSPKQIAAAVSGLPDKTLRYKP |
| Ga0335069_124485842 | 3300032893 | Soil | MTEAELKKHLDAAEKSPKEIAAAVSGLSDKVLRYKPSPEKWCILEILGHLAD |
| Ga0335084_114395611 | 3300033004 | Soil | MTETELKKHLEAAEKSPKQVAAAVSGLPEKVLRYKPAPD |
| Ga0310914_104291571 | 3300033289 | Soil | LTEAEFKKLLDAAEKSPKEIAAAVSGLSEKVLRFKPSPEKWCVLEILGHLADV |
| Ga0326726_109927192 | 3300033433 | Peat Soil | VVNSGFDMTEAELKKHLDAAEKSPKQIAAAVSGLTD |
| Ga0326726_116337542 | 3300033433 | Peat Soil | MTEAELKKHLDAAEKSPKLIAAAVSGLPDKALRYKPAPDKWCIL |
| Ga0334804_110223_2_154 | 3300033818 | Soil | MTEAEIKKHLDAAEKSPKEIAAAVSGLSEKVLRYKPSPEKWCVLEILAHLA |
| ⦗Top⦘ |