| Basic Information | |
|---|---|
| Family ID | F008509 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 332 |
| Average Sequence Length | 47 residues |
| Representative Sequence | ALEKRIREALATPGRPGIRVIAERFGVNPSTVQRISRPFDGASVAVA |
| Number of Associated Samples | 222 |
| Number of Associated Scaffolds | 332 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.49 % |
| % of genes near scaffold ends (potentially truncated) | 90.36 % |
| % of genes from short scaffolds (< 2000 bps) | 83.73 % |
| Associated GOLD sequencing projects | 198 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (55.723 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (12.952 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.916 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (41.867 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.33% β-sheet: 0.00% Coil/Unstructured: 74.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 332 Family Scaffolds |
|---|---|---|
| PF04392 | ABC_sub_bind | 13.25 |
| PF00536 | SAM_1 | 6.93 |
| PF11306 | DUF3108 | 3.31 |
| PF06439 | 3keto-disac_hyd | 3.31 |
| PF13191 | AAA_16 | 2.71 |
| PF08448 | PAS_4 | 2.11 |
| PF03401 | TctC | 1.51 |
| PF12951 | PATR | 1.51 |
| PF13676 | TIR_2 | 1.20 |
| PF00072 | Response_reg | 0.90 |
| PF00589 | Phage_integrase | 0.90 |
| PF06769 | YoeB_toxin | 0.60 |
| PF00940 | RNA_pol | 0.60 |
| PF00239 | Resolvase | 0.60 |
| PF02798 | GST_N | 0.60 |
| PF13545 | HTH_Crp_2 | 0.60 |
| PF13495 | Phage_int_SAM_4 | 0.30 |
| PF01068 | DNA_ligase_A_M | 0.30 |
| PF08042 | PqqA | 0.30 |
| PF07883 | Cupin_2 | 0.30 |
| PF00753 | Lactamase_B | 0.30 |
| PF13683 | rve_3 | 0.30 |
| PF04214 | DUF411 | 0.30 |
| PF13936 | HTH_38 | 0.30 |
| PF13560 | HTH_31 | 0.30 |
| PF13185 | GAF_2 | 0.30 |
| PF13467 | RHH_4 | 0.30 |
| PF00128 | Alpha-amylase | 0.30 |
| PF14487 | DarT | 0.30 |
| PF12686 | DUF3800 | 0.30 |
| PF13518 | HTH_28 | 0.30 |
| PF07045 | DUF1330 | 0.30 |
| PF07007 | LprI | 0.30 |
| PF02705 | K_trans | 0.30 |
| PF00909 | Ammonium_transp | 0.30 |
| PF06411 | HdeA | 0.30 |
| PF04228 | Zn_peptidase | 0.30 |
| PF03797 | Autotransporter | 0.30 |
| PF13426 | PAS_9 | 0.30 |
| PF00912 | Transgly | 0.30 |
| PF14520 | HHH_5 | 0.30 |
| COG ID | Name | Functional Category | % Frequency in 332 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 13.25 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 1.51 |
| COG5108 | Mitochondrial DNA-directed RNA polymerase | Transcription [K] | 0.60 |
| COG4115 | Toxin component of the Txe-Axe toxin-antitoxin module, Txe/YoeB family | Defense mechanisms [V] | 0.60 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.60 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.60 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.30 |
| COG0004 | Ammonia channel protein AmtB | Inorganic ion transport and metabolism [P] | 0.30 |
| COG5009 | Membrane carboxypeptidase/penicillin-binding protein | Cell wall/membrane/envelope biogenesis [M] | 0.30 |
| COG4953 | Membrane carboxypeptidase/penicillin-binding protein PbpC | Cell wall/membrane/envelope biogenesis [M] | 0.30 |
| COG3755 | Uncharacterized conserved protein YecT, DUF1311 family | Function unknown [S] | 0.30 |
| COG3280 | Maltooligosyltrehalose synthase | Carbohydrate transport and metabolism [G] | 0.30 |
| COG3158 | K+ uptake protein Kup | Inorganic ion transport and metabolism [P] | 0.30 |
| COG3019 | Uncharacterized metal-binding protein, DUF411 family | Function unknown [S] | 0.30 |
| COG2321 | Predicted metalloprotease | General function prediction only [R] | 0.30 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.30 |
| COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 0.30 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.30 |
| COG0744 | Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.30 |
| COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 0.30 |
| COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 0.30 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 55.72 % |
| Unclassified | root | N/A | 44.28 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459010|GIO7OMY02H8UO5 | Not Available | 502 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10010770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2192 | Open in IMG/M |
| 3300000955|JGI1027J12803_100833013 | Not Available | 534 | Open in IMG/M |
| 3300000956|JGI10216J12902_103918893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 535 | Open in IMG/M |
| 3300001661|JGI12053J15887_10135356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1307 | Open in IMG/M |
| 3300001978|JGI24747J21853_1034312 | Not Available | 588 | Open in IMG/M |
| 3300002074|JGI24748J21848_1014160 | Not Available | 946 | Open in IMG/M |
| 3300002910|JGI25615J43890_1007088 | All Organisms → cellular organisms → Bacteria | 1749 | Open in IMG/M |
| 3300004268|Ga0066398_10129440 | Not Available | 615 | Open in IMG/M |
| 3300004479|Ga0062595_101886342 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300005147|Ga0066821_1000484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1560 | Open in IMG/M |
| 3300005163|Ga0066823_10006601 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1545 | Open in IMG/M |
| 3300005165|Ga0066869_10010548 | Not Available | 1253 | Open in IMG/M |
| 3300005174|Ga0066680_10585563 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 700 | Open in IMG/M |
| 3300005330|Ga0070690_101389882 | Not Available | 564 | Open in IMG/M |
| 3300005331|Ga0070670_101424411 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 635 | Open in IMG/M |
| 3300005332|Ga0066388_100305585 | Not Available | 2236 | Open in IMG/M |
| 3300005332|Ga0066388_100402440 | All Organisms → cellular organisms → Bacteria | 2014 | Open in IMG/M |
| 3300005332|Ga0066388_100701099 | All Organisms → cellular organisms → Bacteria | 1619 | Open in IMG/M |
| 3300005332|Ga0066388_101038870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1378 | Open in IMG/M |
| 3300005332|Ga0066388_101700109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1117 | Open in IMG/M |
| 3300005332|Ga0066388_101812894 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
| 3300005332|Ga0066388_102023763 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
| 3300005332|Ga0066388_102299736 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 975 | Open in IMG/M |
| 3300005332|Ga0066388_102320119 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300005332|Ga0066388_102672849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 910 | Open in IMG/M |
| 3300005332|Ga0066388_103090768 | Not Available | 850 | Open in IMG/M |
| 3300005332|Ga0066388_104001465 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300005332|Ga0066388_104342661 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300005332|Ga0066388_104493112 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300005332|Ga0066388_104705688 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300005332|Ga0066388_105341174 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300005332|Ga0066388_108607285 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 507 | Open in IMG/M |
| 3300005338|Ga0068868_101320594 | Not Available | 670 | Open in IMG/M |
| 3300005340|Ga0070689_100444304 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
| 3300005344|Ga0070661_100209481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1491 | Open in IMG/M |
| 3300005353|Ga0070669_100509946 | Not Available | 999 | Open in IMG/M |
| 3300005363|Ga0008090_10102102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 508 | Open in IMG/M |
| 3300005363|Ga0008090_14758071 | Not Available | 544 | Open in IMG/M |
| 3300005366|Ga0070659_100279094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1390 | Open in IMG/M |
| 3300005435|Ga0070714_100879040 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300005436|Ga0070713_102284286 | Not Available | 524 | Open in IMG/M |
| 3300005439|Ga0070711_101184059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 660 | Open in IMG/M |
| 3300005455|Ga0070663_100028354 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3811 | Open in IMG/M |
| 3300005456|Ga0070678_102137537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 530 | Open in IMG/M |
| 3300005459|Ga0068867_100904269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 794 | Open in IMG/M |
| 3300005467|Ga0070706_100763573 | Not Available | 896 | Open in IMG/M |
| 3300005471|Ga0070698_101847817 | Not Available | 557 | Open in IMG/M |
| 3300005543|Ga0070672_100843671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 807 | Open in IMG/M |
| 3300005548|Ga0070665_100084518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3179 | Open in IMG/M |
| 3300005549|Ga0070704_101335164 | Not Available | 657 | Open in IMG/M |
| 3300005563|Ga0068855_101844551 | Not Available | 614 | Open in IMG/M |
| 3300005564|Ga0070664_100569545 | Not Available | 1049 | Open in IMG/M |
| 3300005564|Ga0070664_100569751 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
| 3300005578|Ga0068854_101393200 | Not Available | 634 | Open in IMG/M |
| 3300005586|Ga0066691_10687007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 606 | Open in IMG/M |
| 3300005616|Ga0068852_100228864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1771 | Open in IMG/M |
| 3300005713|Ga0066905_100191851 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1518 | Open in IMG/M |
| 3300005713|Ga0066905_100589529 | Not Available | 939 | Open in IMG/M |
| 3300005713|Ga0066905_100804785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseovarius → Roseovarius litoreus | 815 | Open in IMG/M |
| 3300005713|Ga0066905_101176241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 684 | Open in IMG/M |
| 3300005713|Ga0066905_102233644 | Not Available | 511 | Open in IMG/M |
| 3300005713|Ga0066905_102255160 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300005718|Ga0068866_10150645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1347 | Open in IMG/M |
| 3300005718|Ga0068866_11186092 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300005764|Ga0066903_100374050 | All Organisms → cellular organisms → Bacteria | 2323 | Open in IMG/M |
| 3300005764|Ga0066903_101007977 | All Organisms → cellular organisms → Bacteria | 1523 | Open in IMG/M |
| 3300005764|Ga0066903_101861250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1151 | Open in IMG/M |
| 3300005764|Ga0066903_101879018 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
| 3300005764|Ga0066903_102383107 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
| 3300005764|Ga0066903_103237781 | Not Available | 880 | Open in IMG/M |
| 3300005764|Ga0066903_105132083 | Not Available | 693 | Open in IMG/M |
| 3300005764|Ga0066903_105315803 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300005764|Ga0066903_107277333 | Not Available | 572 | Open in IMG/M |
| 3300005764|Ga0066903_107873321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Azorhizobium → Azorhizobium caulinodans → Azorhizobium caulinodans ORS 571 | 547 | Open in IMG/M |
| 3300005841|Ga0068863_100713063 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
| 3300005842|Ga0068858_100318628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1486 | Open in IMG/M |
| 3300005842|Ga0068858_100683077 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300005843|Ga0068860_100313952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1537 | Open in IMG/M |
| 3300005843|Ga0068860_100745829 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
| 3300005937|Ga0081455_10136141 | All Organisms → cellular organisms → Bacteria | 1914 | Open in IMG/M |
| 3300006028|Ga0070717_10550786 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1044 | Open in IMG/M |
| 3300006038|Ga0075365_10328418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1077 | Open in IMG/M |
| 3300006046|Ga0066652_100792435 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 905 | Open in IMG/M |
| 3300006051|Ga0075364_10781915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 651 | Open in IMG/M |
| 3300006175|Ga0070712_100308610 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1283 | Open in IMG/M |
| 3300006178|Ga0075367_10693642 | Not Available | 648 | Open in IMG/M |
| 3300006237|Ga0097621_100109843 | Not Available | 2329 | Open in IMG/M |
| 3300006237|Ga0097621_101220777 | Not Available | 709 | Open in IMG/M |
| 3300006606|Ga0074062_10027718 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300006755|Ga0079222_11120043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 694 | Open in IMG/M |
| 3300006791|Ga0066653_10270246 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 864 | Open in IMG/M |
| 3300006844|Ga0075428_102721202 | Not Available | 504 | Open in IMG/M |
| 3300006853|Ga0075420_100406815 | Not Available | 1176 | Open in IMG/M |
| 3300006854|Ga0075425_102671272 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 551 | Open in IMG/M |
| 3300006871|Ga0075434_102624942 | Not Available | 504 | Open in IMG/M |
| 3300006881|Ga0068865_100007842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 6588 | Open in IMG/M |
| 3300006881|Ga0068865_101677215 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300006953|Ga0074063_14233937 | Not Available | 1026 | Open in IMG/M |
| 3300006954|Ga0079219_11294550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 641 | Open in IMG/M |
| 3300009094|Ga0111539_10638535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1240 | Open in IMG/M |
| 3300009094|Ga0111539_11689961 | Not Available | 734 | Open in IMG/M |
| 3300009098|Ga0105245_10042043 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4076 | Open in IMG/M |
| 3300009098|Ga0105245_10515548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1213 | Open in IMG/M |
| 3300009100|Ga0075418_12386165 | Not Available | 577 | Open in IMG/M |
| 3300009101|Ga0105247_10054601 | Not Available | 2465 | Open in IMG/M |
| 3300009101|Ga0105247_10344873 | Not Available | 1046 | Open in IMG/M |
| 3300009156|Ga0111538_10487886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1562 | Open in IMG/M |
| 3300009156|Ga0111538_10968664 | Not Available | 1076 | Open in IMG/M |
| 3300009156|Ga0111538_11463421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 861 | Open in IMG/M |
| 3300009156|Ga0111538_13396932 | Not Available | 553 | Open in IMG/M |
| 3300009174|Ga0105241_11658023 | Not Available | 620 | Open in IMG/M |
| 3300009176|Ga0105242_10095990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2503 | Open in IMG/M |
| 3300009176|Ga0105242_11802171 | Not Available | 650 | Open in IMG/M |
| 3300009177|Ga0105248_11820207 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 691 | Open in IMG/M |
| 3300009553|Ga0105249_10220340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1867 | Open in IMG/M |
| 3300009553|Ga0105249_11373950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 778 | Open in IMG/M |
| 3300009792|Ga0126374_11055256 | Not Available | 641 | Open in IMG/M |
| 3300009818|Ga0105072_1007981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1836 | Open in IMG/M |
| 3300010043|Ga0126380_10570934 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 884 | Open in IMG/M |
| 3300010046|Ga0126384_10294757 | Not Available | 1331 | Open in IMG/M |
| 3300010046|Ga0126384_11416616 | Not Available | 648 | Open in IMG/M |
| 3300010046|Ga0126384_11908101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Azorhizobium → Azorhizobium caulinodans → Azorhizobium caulinodans ORS 571 | 566 | Open in IMG/M |
| 3300010046|Ga0126384_12080133 | Not Available | 544 | Open in IMG/M |
| 3300010048|Ga0126373_11587758 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 719 | Open in IMG/M |
| 3300010360|Ga0126372_11020294 | Not Available | 840 | Open in IMG/M |
| 3300010360|Ga0126372_11109120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 810 | Open in IMG/M |
| 3300010361|Ga0126378_10142734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 2428 | Open in IMG/M |
| 3300010361|Ga0126378_10250318 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1865 | Open in IMG/M |
| 3300010362|Ga0126377_11442704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 761 | Open in IMG/M |
| 3300010366|Ga0126379_12903403 | Not Available | 573 | Open in IMG/M |
| 3300010371|Ga0134125_12082251 | Not Available | 617 | Open in IMG/M |
| 3300010375|Ga0105239_11312436 | Not Available | 835 | Open in IMG/M |
| 3300010375|Ga0105239_11319578 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300010375|Ga0105239_12967244 | Not Available | 553 | Open in IMG/M |
| 3300010376|Ga0126381_101289247 | Not Available | 1056 | Open in IMG/M |
| 3300010376|Ga0126381_101558227 | Not Available | 955 | Open in IMG/M |
| 3300010397|Ga0134124_10189827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1858 | Open in IMG/M |
| 3300010863|Ga0124850_1001711 | All Organisms → cellular organisms → Bacteria | 6202 | Open in IMG/M |
| 3300010868|Ga0124844_1028356 | All Organisms → cellular organisms → Bacteria | 1751 | Open in IMG/M |
| 3300010999|Ga0138505_100033880 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300011119|Ga0105246_10063659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2573 | Open in IMG/M |
| 3300011119|Ga0105246_10126195 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1904 | Open in IMG/M |
| 3300011119|Ga0105246_10190483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1587 | Open in IMG/M |
| 3300011119|Ga0105246_10228083 | Not Available | 1465 | Open in IMG/M |
| 3300011119|Ga0105246_10884464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 800 | Open in IMG/M |
| 3300011269|Ga0137392_11588967 | Not Available | 512 | Open in IMG/M |
| 3300012202|Ga0137363_10666543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 880 | Open in IMG/M |
| 3300012204|Ga0137374_10812142 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300012205|Ga0137362_10709184 | Not Available | 864 | Open in IMG/M |
| 3300012208|Ga0137376_10065941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2999 | Open in IMG/M |
| 3300012211|Ga0137377_10919313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 806 | Open in IMG/M |
| 3300012350|Ga0137372_10152449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1886 | Open in IMG/M |
| 3300012351|Ga0137386_10619148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 779 | Open in IMG/M |
| 3300012356|Ga0137371_10072653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2665 | Open in IMG/M |
| 3300012532|Ga0137373_10114498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2330 | Open in IMG/M |
| 3300012532|Ga0137373_10711793 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 748 | Open in IMG/M |
| 3300012923|Ga0137359_10292103 | Not Available | 1452 | Open in IMG/M |
| 3300012939|Ga0162650_100066125 | Not Available | 611 | Open in IMG/M |
| 3300012948|Ga0126375_10771799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 758 | Open in IMG/M |
| 3300012951|Ga0164300_10143855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1108 | Open in IMG/M |
| 3300012955|Ga0164298_10250957 | Not Available | 1067 | Open in IMG/M |
| 3300012958|Ga0164299_10612800 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300012961|Ga0164302_10149931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1372 | Open in IMG/M |
| 3300012971|Ga0126369_12260069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 631 | Open in IMG/M |
| 3300012977|Ga0134087_10506837 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 608 | Open in IMG/M |
| 3300012984|Ga0164309_10669394 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 820 | Open in IMG/M |
| 3300012984|Ga0164309_11026263 | Not Available | 681 | Open in IMG/M |
| 3300012986|Ga0164304_10300974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1099 | Open in IMG/M |
| 3300012986|Ga0164304_10933610 | Not Available | 681 | Open in IMG/M |
| 3300012986|Ga0164304_11736744 | Not Available | 522 | Open in IMG/M |
| 3300012987|Ga0164307_10629041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 831 | Open in IMG/M |
| 3300012988|Ga0164306_10298736 | Not Available | 1174 | Open in IMG/M |
| 3300012988|Ga0164306_11178619 | Not Available | 641 | Open in IMG/M |
| 3300013297|Ga0157378_10024907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 5270 | Open in IMG/M |
| 3300013306|Ga0163162_10162961 | Not Available | 2352 | Open in IMG/M |
| 3300013308|Ga0157375_11798786 | Not Available | 726 | Open in IMG/M |
| 3300013308|Ga0157375_13041523 | Not Available | 560 | Open in IMG/M |
| 3300014969|Ga0157376_10061978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3146 | Open in IMG/M |
| 3300015371|Ga0132258_10379495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 3505 | Open in IMG/M |
| 3300015373|Ga0132257_100094851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 3424 | Open in IMG/M |
| 3300015373|Ga0132257_103428482 | Not Available | 577 | Open in IMG/M |
| 3300015373|Ga0132257_103573234 | Not Available | 566 | Open in IMG/M |
| 3300015374|Ga0132255_100203758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 2800 | Open in IMG/M |
| 3300015374|Ga0132255_103096606 | Not Available | 709 | Open in IMG/M |
| 3300016270|Ga0182036_11391881 | Not Available | 587 | Open in IMG/M |
| 3300016270|Ga0182036_11598101 | Not Available | 549 | Open in IMG/M |
| 3300016294|Ga0182041_10200598 | All Organisms → cellular organisms → Bacteria | 1588 | Open in IMG/M |
| 3300016341|Ga0182035_11765439 | Not Available | 560 | Open in IMG/M |
| 3300016387|Ga0182040_10418890 | Not Available | 1055 | Open in IMG/M |
| 3300016404|Ga0182037_10068685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2443 | Open in IMG/M |
| 3300016404|Ga0182037_11077525 | Not Available | 702 | Open in IMG/M |
| 3300016404|Ga0182037_11786275 | Not Available | 549 | Open in IMG/M |
| 3300016445|Ga0182038_11008186 | Not Available | 737 | Open in IMG/M |
| 3300017792|Ga0163161_10027158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4060 | Open in IMG/M |
| 3300017792|Ga0163161_10892871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 752 | Open in IMG/M |
| 3300018031|Ga0184634_10302555 | Not Available | 734 | Open in IMG/M |
| 3300018066|Ga0184617_1207890 | Not Available | 583 | Open in IMG/M |
| 3300018067|Ga0184611_1045129 | Not Available | 1456 | Open in IMG/M |
| 3300018067|Ga0184611_1166560 | Not Available | 782 | Open in IMG/M |
| 3300018073|Ga0184624_10402656 | Not Available | 607 | Open in IMG/M |
| 3300018076|Ga0184609_10525230 | Not Available | 537 | Open in IMG/M |
| 3300018082|Ga0184639_10550967 | Not Available | 573 | Open in IMG/M |
| 3300018422|Ga0190265_10168393 | Not Available | 2166 | Open in IMG/M |
| 3300018469|Ga0190270_11316177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 766 | Open in IMG/M |
| 3300018469|Ga0190270_12010167 | Not Available | 636 | Open in IMG/M |
| 3300018476|Ga0190274_10789547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1005 | Open in IMG/M |
| 3300018481|Ga0190271_13213442 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 548 | Open in IMG/M |
| 3300019356|Ga0173481_10135477 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 997 | Open in IMG/M |
| 3300021082|Ga0210380_10008430 | All Organisms → cellular organisms → Bacteria | 4299 | Open in IMG/M |
| 3300021560|Ga0126371_11301900 | Not Available | 860 | Open in IMG/M |
| 3300022694|Ga0222623_10260460 | Not Available | 669 | Open in IMG/M |
| 3300025898|Ga0207692_10934140 | Not Available | 571 | Open in IMG/M |
| 3300025900|Ga0207710_10199191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 989 | Open in IMG/M |
| 3300025904|Ga0207647_10120384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1548 | Open in IMG/M |
| 3300025904|Ga0207647_10250007 | Not Available | 1017 | Open in IMG/M |
| 3300025908|Ga0207643_10272006 | Not Available | 1049 | Open in IMG/M |
| 3300025914|Ga0207671_10294245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1282 | Open in IMG/M |
| 3300025915|Ga0207693_10144605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1870 | Open in IMG/M |
| 3300025915|Ga0207693_10605312 | Not Available | 853 | Open in IMG/M |
| 3300025918|Ga0207662_10306635 | Not Available | 1057 | Open in IMG/M |
| 3300025919|Ga0207657_10037407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4333 | Open in IMG/M |
| 3300025920|Ga0207649_11429909 | Not Available | 547 | Open in IMG/M |
| 3300025924|Ga0207694_10661753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 880 | Open in IMG/M |
| 3300025928|Ga0207700_10934718 | Not Available | 776 | Open in IMG/M |
| 3300025929|Ga0207664_10765375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS191 | 868 | Open in IMG/M |
| 3300025936|Ga0207670_10217266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1461 | Open in IMG/M |
| 3300025938|Ga0207704_10875164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 754 | Open in IMG/M |
| 3300025960|Ga0207651_10280231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1377 | Open in IMG/M |
| 3300025960|Ga0207651_11946593 | Not Available | 528 | Open in IMG/M |
| 3300025961|Ga0207712_10908084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 778 | Open in IMG/M |
| 3300025981|Ga0207640_10503819 | Not Available | 1009 | Open in IMG/M |
| 3300026023|Ga0207677_10370036 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1206 | Open in IMG/M |
| 3300026023|Ga0207677_11682591 | Not Available | 588 | Open in IMG/M |
| 3300026035|Ga0207703_10033269 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4085 | Open in IMG/M |
| 3300026088|Ga0207641_11957386 | Not Available | 587 | Open in IMG/M |
| 3300026089|Ga0207648_10564746 | Not Available | 1046 | Open in IMG/M |
| 3300026095|Ga0207676_10254617 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1582 | Open in IMG/M |
| 3300026118|Ga0207675_100710618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1014 | Open in IMG/M |
| 3300026121|Ga0207683_10267552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1561 | Open in IMG/M |
| 3300026121|Ga0207683_10452294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1184 | Open in IMG/M |
| 3300026142|Ga0207698_10689768 | Not Available | 1015 | Open in IMG/M |
| 3300026333|Ga0209158_1231037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 636 | Open in IMG/M |
| 3300027603|Ga0209331_1168569 | Not Available | 513 | Open in IMG/M |
| 3300027909|Ga0209382_11133582 | Not Available | 805 | Open in IMG/M |
| 3300027909|Ga0209382_11258122 | Not Available | 753 | Open in IMG/M |
| 3300027909|Ga0209382_11893392 | Not Available | 577 | Open in IMG/M |
| 3300028381|Ga0268264_10173078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1954 | Open in IMG/M |
| 3300028717|Ga0307298_10178292 | Not Available | 622 | Open in IMG/M |
| 3300028718|Ga0307307_10261104 | Not Available | 554 | Open in IMG/M |
| 3300028720|Ga0307317_10173399 | Not Available | 726 | Open in IMG/M |
| 3300028778|Ga0307288_10101448 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1049 | Open in IMG/M |
| 3300028784|Ga0307282_10075795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1534 | Open in IMG/M |
| 3300028784|Ga0307282_10414083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 653 | Open in IMG/M |
| 3300028809|Ga0247824_10643048 | Not Available | 641 | Open in IMG/M |
| 3300028819|Ga0307296_10116540 | All Organisms → cellular organisms → Bacteria | 1434 | Open in IMG/M |
| 3300028819|Ga0307296_10576321 | Not Available | 616 | Open in IMG/M |
| 3300028824|Ga0307310_10505599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 609 | Open in IMG/M |
| 3300028828|Ga0307312_10092118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1868 | Open in IMG/M |
| 3300028828|Ga0307312_11045184 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300028875|Ga0307289_10119348 | Not Available | 1080 | Open in IMG/M |
| 3300028875|Ga0307289_10362027 | Not Available | 597 | Open in IMG/M |
| 3300028881|Ga0307277_10012340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3295 | Open in IMG/M |
| 3300028881|Ga0307277_10059520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1567 | Open in IMG/M |
| 3300028881|Ga0307277_10393154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 619 | Open in IMG/M |
| 3300031543|Ga0318516_10648004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 601 | Open in IMG/M |
| 3300031545|Ga0318541_10011472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3997 | Open in IMG/M |
| 3300031545|Ga0318541_10476070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 698 | Open in IMG/M |
| 3300031545|Ga0318541_10561557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 638 | Open in IMG/M |
| 3300031573|Ga0310915_11172995 | Not Available | 532 | Open in IMG/M |
| 3300031640|Ga0318555_10013378 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3694 | Open in IMG/M |
| 3300031679|Ga0318561_10113520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1434 | Open in IMG/M |
| 3300031682|Ga0318560_10272001 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300031682|Ga0318560_10551760 | Not Available | 624 | Open in IMG/M |
| 3300031719|Ga0306917_10985798 | Not Available | 658 | Open in IMG/M |
| 3300031723|Ga0318493_10712397 | Not Available | 563 | Open in IMG/M |
| 3300031724|Ga0318500_10010965 | Not Available | 3174 | Open in IMG/M |
| 3300031724|Ga0318500_10558852 | Not Available | 578 | Open in IMG/M |
| 3300031744|Ga0306918_11254423 | Not Available | 571 | Open in IMG/M |
| 3300031744|Ga0306918_11494415 | Not Available | 516 | Open in IMG/M |
| 3300031748|Ga0318492_10721965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 534 | Open in IMG/M |
| 3300031764|Ga0318535_10266778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 766 | Open in IMG/M |
| 3300031765|Ga0318554_10360601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Variibacter → Variibacter gotjawalensis | 826 | Open in IMG/M |
| 3300031771|Ga0318546_10398096 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300031779|Ga0318566_10452950 | Not Available | 630 | Open in IMG/M |
| 3300031780|Ga0318508_1065514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 979 | Open in IMG/M |
| 3300031797|Ga0318550_10446053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 625 | Open in IMG/M |
| 3300031797|Ga0318550_10578044 | Not Available | 540 | Open in IMG/M |
| 3300031819|Ga0318568_10026734 | Not Available | 3186 | Open in IMG/M |
| 3300031859|Ga0318527_10006501 | Not Available | 3636 | Open in IMG/M |
| 3300031879|Ga0306919_10108494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1966 | Open in IMG/M |
| 3300031879|Ga0306919_11154534 | Not Available | 589 | Open in IMG/M |
| 3300031910|Ga0306923_11390966 | Not Available | 739 | Open in IMG/M |
| 3300031941|Ga0310912_10038939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 3284 | Open in IMG/M |
| 3300031941|Ga0310912_10766849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 746 | Open in IMG/M |
| 3300031942|Ga0310916_10368819 | Not Available | 1220 | Open in IMG/M |
| 3300031946|Ga0310910_10833860 | Not Available | 725 | Open in IMG/M |
| 3300031946|Ga0310910_11107260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 616 | Open in IMG/M |
| 3300031947|Ga0310909_11053580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 662 | Open in IMG/M |
| 3300031954|Ga0306926_12990150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 505 | Open in IMG/M |
| 3300032009|Ga0318563_10083379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1673 | Open in IMG/M |
| 3300032055|Ga0318575_10704199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 511 | Open in IMG/M |
| 3300032059|Ga0318533_10155177 | All Organisms → cellular organisms → Bacteria | 1622 | Open in IMG/M |
| 3300032059|Ga0318533_10737595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 723 | Open in IMG/M |
| 3300032068|Ga0318553_10011352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3923 | Open in IMG/M |
| 3300032090|Ga0318518_10556054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 586 | Open in IMG/M |
| 3300032090|Ga0318518_10558071 | Not Available | 585 | Open in IMG/M |
| 3300032090|Ga0318518_10660787 | Not Available | 532 | Open in IMG/M |
| 3300032094|Ga0318540_10105917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1326 | Open in IMG/M |
| 3300032094|Ga0318540_10458980 | Not Available | 615 | Open in IMG/M |
| 3300032094|Ga0318540_10466080 | Not Available | 610 | Open in IMG/M |
| 3300032261|Ga0306920_100696683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 1497 | Open in IMG/M |
| 3300032261|Ga0306920_102326547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseovarius → Roseovarius litoreus | 742 | Open in IMG/M |
| 3300032261|Ga0306920_103069948 | Not Available | 628 | Open in IMG/M |
| 3300033289|Ga0310914_10278331 | All Organisms → cellular organisms → Bacteria | 1507 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.95% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 11.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.72% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.52% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.22% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.31% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.31% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.01% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.71% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.41% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.11% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.11% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.11% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.81% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.20% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.51% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.51% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.90% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.90% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.60% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.60% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.60% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.60% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.60% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.60% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.60% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.60% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.60% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.30% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.30% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.30% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.30% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.30% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.30% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.30% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Host-Associated | Open in IMG/M |
| 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Host-Associated | Open in IMG/M |
| 3300002910 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005147 | Soil and rhizosphere microbial communities from Laval, Canada - mgLMC | Environmental | Open in IMG/M |
| 3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
| 3300005165 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006051 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Host-Associated | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006178 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009818 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300010999 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012939 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F62_07333910 | 2170459010 | Grass Soil | ALEKRIREALATPGRPGIRVIAERLGVNPSTVQRISRPFDGASVAVA |
| AF_2010_repII_A001DRAFT_100107703 | 3300000793 | Forest Soil | KRIREALATPGRPGVRVIAKQFGVNPGTVQRISRPFETSAVGAVQ* |
| JGI1027J12803_1008330131 | 3300000955 | Soil | LATPGRPGVRVIAKRFGVDPGTVQRISRPFDGVNVVMA* |
| JGI10216J12902_1039188931 | 3300000956 | Soil | MAKGWVPAGIRVIAERFGVTVQRISRPFDGASVAV |
| JGI12053J15887_101353562 | 3300001661 | Forest Soil | MEERSRKALATPGRPGVRVIAKQFGVDPGTVQRVSRPFEGGASAGAV* |
| JGI24747J21853_10343121 | 3300001978 | Corn, Switchgrass And Miscanthus Rhizosphere | AEVQRIRALSTPGRPGIRVIAERFGVNPSTVQRVSHPFDGASVAVA* |
| JGI24748J21848_10141602 | 3300002074 | Corn, Switchgrass And Miscanthus Rhizosphere | ASAEVQRIRALSTPGRPGIRVIAERFGVNPSTVQRVSXPFDGASVAVA* |
| JGI25615J43890_10070884 | 3300002910 | Grasslands Soil | RIREALATRGRPGIRVIAERFGVNPSTVQRISRPFDGASVAVA* |
| Ga0066398_101294402 | 3300004268 | Tropical Forest Soil | ALEKRIREALATPGRPGVRVIAKRFGVDPGTVQRISRPFEASAVGA* |
| Ga0062595_1018863421 | 3300004479 | Soil | LEKRIREALATPGRPGVRVIAKQFGVNPGTVQRISRPFDQDAVAL* |
| Ga0066821_10004842 | 3300005147 | Soil | SEGKRLGRPPIAPALEKRIREALATPGRPGIRVIAERLGVNPSTVQRISRPFDGASVAVA |
| Ga0066823_100066012 | 3300005163 | Soil | EKRIREALATPGRPGIRVIAERFGVNPSTLQRISRPFDGASVAVA* |
| Ga0066869_100105481 | 3300005165 | Soil | EKRIREALATPGRPGIRVIAERFGVNPSTVQRVSRPFDGASVAVA* |
| Ga0066680_105855631 | 3300005174 | Soil | RVRAGLARARAEGKRVGRPPIATALEKRIREATPGRPGVRVAKQFEVDPGTVQRISRPFAAASVAAAVP* |
| Ga0070690_1013898822 | 3300005330 | Switchgrass Rhizosphere | APALEKRIREALATPGRPGIRVIAERLGVNPSTVQRISRPFDDASVSVA* |
| Ga0070670_1014244111 | 3300005331 | Switchgrass Rhizosphere | ALATPGRPGIRVIAERFGVNPSTVQRISRPFDGASVAVA* |
| Ga0066388_1003055851 | 3300005332 | Tropical Forest Soil | LAKATEEAIRAAPSQPGRPGVRVIAKQFGVDPSTVQRISRPFGDQAASAVA* |
| Ga0066388_1004024402 | 3300005332 | Tropical Forest Soil | LIKKEKRIREALAAPGRPGVRIIAKQFGVDPGTVQRVSRPFAAASVAVA* |
| Ga0066388_1007010991 | 3300005332 | Tropical Forest Soil | RPPIAPALEKRIREALATPGRPGVRVIAKRFGVNPGTVQRISRPFDGASIAAA* |
| Ga0066388_1010388701 | 3300005332 | Tropical Forest Soil | PPIAPALEKRIREALATPGRRGVRVIAKQFGVNPGTVQRISRPFEQDAVAL* |
| Ga0066388_1017001092 | 3300005332 | Tropical Forest Soil | IRAALAKPGRPGVRKIAEQFGVNAGTVQRISRPFGVGASVAG* |
| Ga0066388_1018128942 | 3300005332 | Tropical Forest Soil | LPPIAPALEKRIREALATPGRPGVRVIAKRFGVDPGTVQRISRPFGDLSVIAAVP* |
| Ga0066388_1020237631 | 3300005332 | Tropical Forest Soil | IREALATPGRPGVRVIAKRFGVDPGTVQRISRPFDGASVAVA* |
| Ga0066388_1022997361 | 3300005332 | Tropical Forest Soil | LEERIREALAAPNRPGVRVIAKRFGVNPGTVQRISRPFSEASVGAA* |
| Ga0066388_1023201191 | 3300005332 | Tropical Forest Soil | MPWASPPIAPALEKRIREALATPGRPGVRVIAKQFGVNPGTVQRISRPFEQNAVVL* |
| Ga0066388_1026728493 | 3300005332 | Tropical Forest Soil | REALATPGRRGVRVIAKQFGVNPGTVQRISRPFEQNAVVL* |
| Ga0066388_1030907683 | 3300005332 | Tropical Forest Soil | LEKRIREALATPGRPGVRVIAKRFGVDPGTVQRISRPFDGASVAVA* |
| Ga0066388_1040014651 | 3300005332 | Tropical Forest Soil | PALEKRIREALATPGRPGVRVIAKQFGVNPGTVQRISRPFEQDAVAP* |
| Ga0066388_1043426612 | 3300005332 | Tropical Forest Soil | IREALATPGRPGVRVIAKQFGVNPGTVQRISRPFEQNAVAL* |
| Ga0066388_1044931121 | 3300005332 | Tropical Forest Soil | SEGKRLGRPPIAPALEKRIREALAAPGRPGVRVIAKQFGVDPGTVQRISRPFDGASVVAVA* |
| Ga0066388_1047056883 | 3300005332 | Tropical Forest Soil | PPIAPAVEKRIREALATPGRPGVRVIAKQFGVNPGTMQRISRPFEQNWVAL* |
| Ga0066388_1053411742 | 3300005332 | Tropical Forest Soil | EALATPGRPGVRVIAKQFGVNPGTVQRISRPFEQNAVVL* |
| Ga0066388_1086072852 | 3300005332 | Tropical Forest Soil | EGKRLGRPPIAPALEKRIREALATPGRPGVRVIAKQFGVNPGTVQRISRPFEQDAVAL* |
| Ga0068868_1013205942 | 3300005338 | Miscanthus Rhizosphere | LEKRIREALATPGRPGIRVIAERFGVNPSTVQRINRPFDGAGVAVA* |
| Ga0070689_1004443043 | 3300005340 | Switchgrass Rhizosphere | PIASALEKRIREALATPGRPGIRVIAERFGVNPSTVQRINRPFDGAGVAVA* |
| Ga0070661_1002094811 | 3300005344 | Corn Rhizosphere | ALEKRIREALATPGRPGIRVIAERFGVNPSTVQRISRPFDDASVSVA* |
| Ga0070669_1005099461 | 3300005353 | Switchgrass Rhizosphere | EALATPGRPGIRVIAERFGVNPSTVQRVSRPFDGASVAVA* |
| Ga0008090_101021021 | 3300005363 | Tropical Rainforest Soil | EKRIREALATPGRPGVRVIAKRFGVDPGTVQRISRPFAGASVVAAV* |
| Ga0008090_147580711 | 3300005363 | Tropical Rainforest Soil | LEARIRKSLTIPGGPGVCVIAKRLGVDPGTVQRISRPFDGGGGHA* |
| Ga0070659_1002790941 | 3300005366 | Corn Rhizosphere | ALATPGRPGIRVIAERFGVNPSTVQRVSRPFDGASVAVA* |
| Ga0070714_1008790402 | 3300005435 | Agricultural Soil | EALATPGRPGVRVIAKQFGVNPGTVQRISRPFEASAAGL* |
| Ga0070713_1022842862 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | EALATPGRPGIRVIAERFGVNPSTVQRISRPFDGASVAVA* |
| Ga0070711_1011840592 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | PPIAPALEKRIREALATPGRPGIRVIAERFSVNPSTVQRINRPFDGASGAVA* |
| Ga0070663_1000283541 | 3300005455 | Corn Rhizosphere | PIASALEKRIREALATPGRPGIRVIAERFGVNPSTVQRISRPFDGASVAVA* |
| Ga0070678_1021375371 | 3300005456 | Miscanthus Rhizosphere | REALATPGRPGIRVIAERFGVNPSTVQRISRPFDDASVAVA* |
| Ga0068867_1009042692 | 3300005459 | Miscanthus Rhizosphere | PALEKRIREALATPGRPGIRVIAERFGVNPSTVQRISRPFDGASVAVA* |
| Ga0070706_1007635731 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | IAPALEKRIREALATPGRPGIRVIAERFGVNPSTVQRISRPFDGVDVAVA* |
| Ga0070698_1018478172 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | LEKRIREALATPGRPGVRVIAKRFGVDPGTVQRISRPFDGASVAGAAVSTG* |
| Ga0070672_1008436712 | 3300005543 | Miscanthus Rhizosphere | ALATPGRPGIRVIAERFGVNPSTVQRISRPFDVASVAVA* |
| Ga0070665_1000845183 | 3300005548 | Switchgrass Rhizosphere | LATPGRPGIRVIAERFGVNPSTVQRISRPFDGASVAVA* |
| Ga0070704_1013351641 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | ALEKRIREALATPGRPGVRVIAKRFGVNPGTVQRISRPFDGASVAVA* |
| Ga0068855_1018445513 | 3300005563 | Corn Rhizosphere | ALATPGRPGIRVIAERFGVNPSTVQRINRPFDGAGVAVA* |
| Ga0070664_1005695451 | 3300005564 | Corn Rhizosphere | GRPGIRVIAERFGVNPSTVQRVSRPFDGASVAVA* |
| Ga0070664_1005697511 | 3300005564 | Corn Rhizosphere | SALEKRIREALATPGRPGIRVIAERFGVNPSTVQRINRPFDGAGVAVA* |
| Ga0068854_1013932001 | 3300005578 | Corn Rhizosphere | ALEKRIREALATPGRPGIRVIAERVSVNPSTVQRISRPFDGASVAVA* |
| Ga0066691_106870071 | 3300005586 | Soil | PPIAPALEKRIREALATPGRPGIRVIAERFGVNPSTVQRISRPFAAANLAVG* |
| Ga0068852_1002288643 | 3300005616 | Corn Rhizosphere | LEKRIREALATPGRPGIRVIAERFGVNPSTVQRVSRPFDGASVAVA* |
| Ga0066905_1001918514 | 3300005713 | Tropical Forest Soil | GKRLGRPPIAPALEKRIREALATPGRPGVRVIAKQFGVNPGTVQRISRPFEQDAVAL* |
| Ga0066905_1005895292 | 3300005713 | Tropical Forest Soil | ARSEGKRLGRPPLAKATEEAIRAAPSQPGRPGVRVIAKQFGVDPSTVQRISRPFGDQAASAVA* |
| Ga0066905_1008047851 | 3300005713 | Tropical Forest Soil | RIREALATPGRPGVRVIAKRFGVDPGTVQRISRPFEGATVAVA* |
| Ga0066905_1011762412 | 3300005713 | Tropical Forest Soil | GRPGIRVIAERFGVNPSTVQRISRPFDGASVAVA* |
| Ga0066905_1022336441 | 3300005713 | Tropical Forest Soil | RPPIPPTLEKRIREALATPGRPGVRVIAKQFGVDPGTVQRISRPFDGASVAGAAVSTG* |
| Ga0066905_1022551601 | 3300005713 | Tropical Forest Soil | PIAPALEKRIREALATPGRPGVRVIAKQFGVNPGTVQRISRPFEQDAVAL* |
| Ga0068866_101506453 | 3300005718 | Miscanthus Rhizosphere | IAPALEKRIREALATPGRPGIRVIAKRLGVNPSTVQRISRPFDGASVAVA* |
| Ga0068866_111860922 | 3300005718 | Miscanthus Rhizosphere | EALATPGRPGIRVIAERFGVNPSTVQRISRPFDDASVGVA* |
| Ga0066903_1003740501 | 3300005764 | Tropical Forest Soil | IREALATPGRPGVRVIAKQFGVNPGTVQRISRPFEQDAVVRGKR* |
| Ga0066903_1010079774 | 3300005764 | Tropical Forest Soil | APALEKRIREALATPGRPGVRVIAKRFGVNPGTVQRISRPFDRVGVVVA* |
| Ga0066903_1018612501 | 3300005764 | Tropical Forest Soil | APALEKRIREALATPGRPGVRVIAKRFGVDPGTVQRISRPFADLSVIAAVS* |
| Ga0066903_1018790182 | 3300005764 | Tropical Forest Soil | LGRPPLAPALEKRIREALATPGRPGVRVIAKQFGVDPGTVQRISRPFDGASVVAA* |
| Ga0066903_1023831072 | 3300005764 | Tropical Forest Soil | PALEKRIREALATPGRPGVRVIAKQFRVNPGTVQRISRPFEQDAVVL* |
| Ga0066903_1032377811 | 3300005764 | Tropical Forest Soil | ALATPGRPGVRVIAKRFGVDPGTVQRISRPFDGASVAVA* |
| Ga0066903_1050243891 | 3300005764 | Tropical Forest Soil | ATPGRPGVRVIAKQFGVNPGTVQRISRPFEQDAVAL* |
| Ga0066903_1051320832 | 3300005764 | Tropical Forest Soil | ALATPGRPGIRVIAERFGVNPSTVQRISRPFDDASVTVA* |
| Ga0066903_1053158032 | 3300005764 | Tropical Forest Soil | PALEKRIREALATPGRPGVRVIAKQFGVNPGTVQRISRPFEQNAVVL* |
| Ga0066903_1072773332 | 3300005764 | Tropical Forest Soil | ALEKRIREALATPGRPGVRVIAKQFGVNPGTVQRISRPFEDSAVGL* |
| Ga0066903_1078733212 | 3300005764 | Tropical Forest Soil | RIREALATPGRPGVRVIAKRFGVDPGTVQRISRPFDGASVAVA* |
| Ga0066903_1084192671 | 3300005764 | Tropical Forest Soil | LEERIRKALATPGRPGVRKIAERFGVDPGTVQRISRPFEARVADA* |
| Ga0066903_1091240951 | 3300005764 | Tropical Forest Soil | LEERIRKALATPGRPGVRKIAERFGVDPGTVQRISRPFEVSAAGA* |
| Ga0068863_1007130633 | 3300005841 | Switchgrass Rhizosphere | EKRIREALATPGRPGIRVIAERFGVNPSTVQRINRPFDGAGVAVA* |
| Ga0068858_1003186281 | 3300005842 | Switchgrass Rhizosphere | ALEKRIREALATPGRPGIRVIAERFGVNPSTVQRVSRPFDGASVAVA* |
| Ga0068858_1006830772 | 3300005842 | Switchgrass Rhizosphere | PGRPGIRVIAERFGVNPSTVQRINRPFDGAGVAVA* |
| Ga0068860_1003139521 | 3300005843 | Switchgrass Rhizosphere | TPGRPGIRVIAERFGVNPSTVQRISRPFDGASVAVA* |
| Ga0068860_1007458292 | 3300005843 | Switchgrass Rhizosphere | RIREALATPGRPGIRVIAERFGVNPSTVQRINRPFDGAGVAVA* |
| Ga0081455_101361411 | 3300005937 | Tabebuia Heterophylla Rhizosphere | APALEKRIREALATPGRPGVRVIAKQFGVDPGTVQRISRPFDRVGIVAA* |
| Ga0070717_105507861 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | PRIAPALEERIKKALATPGRPGVRVIAKQFGIDPSTVQRISRPFEGGPGAGA* |
| Ga0075365_103284182 | 3300006038 | Populus Endosphere | EKRIREALATPGRPGVRVIAKQFGVNAGTVQRISRPFEASAVAL* |
| Ga0066652_1007924351 | 3300006046 | Soil | PWRPPIVPALEKRIREALATPGRPGVRVIAKQFGVNPGTVQRISRPFEQDAVAL* |
| Ga0075364_107819151 | 3300006051 | Populus Endosphere | PPIAPALEKRIREALATPGRPGVRVIAKHFGVNPGTVQRISRPFEHEVAL* |
| Ga0070712_1003086101 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | GRPPIAPALEKRIREALATPGRLGVRVIAKQFGVNPGTVQRISRPFEQGAVAL* |
| Ga0075367_106936423 | 3300006178 | Populus Endosphere | LGRPPIAPTLEKRIREALATPGRPGIRVIAERLGVNPSTVQRINRPFDGASGAVA* |
| Ga0097621_1001098433 | 3300006237 | Miscanthus Rhizosphere | PGRPGIRVIAERFGVNPSTVQRISRPFDGASVAVA* |
| Ga0097621_1012207773 | 3300006237 | Miscanthus Rhizosphere | EALATPGRPGIRVIAERFGVNPSTVQRINRPFDGASVAVA* |
| Ga0074062_100277183 | 3300006606 | Soil | ALEKRIREALATPGRPGIRVIAERFGVNPSTVQRINRPFDGAGVAVA* |
| Ga0079222_111200431 | 3300006755 | Agricultural Soil | MGGEAVAPALERRFREALATPGSPGVRVIAKQFGVNPGTVQRISPFEQDGVAL* |
| Ga0066653_102702461 | 3300006791 | Soil | ALATPGRPGVRVIAKQFGVNPGTVQRISRPFEQDAVAL* |
| Ga0075428_1027212022 | 3300006844 | Populus Rhizosphere | ELEARIRQALATPGRPGVRKIAERFGVNPGTVQRITRPFEVSAVSA* |
| Ga0075420_1004068153 | 3300006853 | Populus Rhizosphere | APELEERIRKALATPGRPGVRVIAKWFGVDPGTVQRISRPFDGGASGIAA* |
| Ga0075425_1026712721 | 3300006854 | Populus Rhizosphere | EALATPGRPGVRVIAKQFGVNPGTVQRISRPFEQDAVAL* |
| Ga0075434_1026249422 | 3300006871 | Populus Rhizosphere | NSSWAARQVAPALERRFREALATPGSPGVRVIAKQFGVNPGTVQRISPFEQDGVAL* |
| Ga0068865_1000078426 | 3300006881 | Miscanthus Rhizosphere | RIREALATPGRPGIRVIAERFGVNPSTVQRISRPFDGASVAVA* |
| Ga0068865_1016772152 | 3300006881 | Miscanthus Rhizosphere | RIREALATPGRPGIRVIAERFGVNPSTVQRISRPFDGASAAVA* |
| Ga0074063_142339371 | 3300006953 | Soil | REALATPGRPGIRVIAERFGVNPSKVQRISRPFDGASVAVA* |
| Ga0079219_112945502 | 3300006954 | Agricultural Soil | LEKRIREALATPGRPGVRVIAKQFGVNAGTVQRISRPFEASAVAL* |
| Ga0111539_106385351 | 3300009094 | Populus Rhizosphere | EALATPGRPGIRVIAERFGVNPSTVQRINRPFDGAGVAVA* |
| Ga0111539_116899611 | 3300009094 | Populus Rhizosphere | PIASALEKRIREALATPERPGIRVIAERFGVNPSTVQRISRPFDGASVAVA* |
| Ga0105245_100420432 | 3300009098 | Miscanthus Rhizosphere | PPIASALEKRIREALATPGRPGIRVIAERFGVNPSTVQRISRPFDGASVAVA* |
| Ga0105245_105155482 | 3300009098 | Miscanthus Rhizosphere | PPIASALEKRIREALATPGRPGIRVIAERFGVNPSTVQRINRPFDGAGVAVA* |
| Ga0075418_123861652 | 3300009100 | Populus Rhizosphere | EERIKKALATPGRPGVRKIAERFGVDPGTVQRISRPFEASAGGA* |
| Ga0105247_100546015 | 3300009101 | Switchgrass Rhizosphere | SEGKRLGPPPIAPALEKRIREALATPGRPGIRVIAQRFGVNPSTVQRISRPFDGASVAVA |
| Ga0105247_103448732 | 3300009101 | Switchgrass Rhizosphere | PIAAALEKRIREALATPGRPGIRVIAERFGVNPSTVQRINRPFDGAGVAVA* |
| Ga0105247_112127212 | 3300009101 | Switchgrass Rhizosphere | AAELEARIRKALAIPGRPGVRKIAEQFGVDPGTVQRISRPFVTCEAVA* |
| Ga0111538_104878861 | 3300009156 | Populus Rhizosphere | TPGRPGIRVIAERFGVNPSTVQRISRPFDDASVAVA* |
| Ga0111538_109686642 | 3300009156 | Populus Rhizosphere | KRIREALATPGRPGIRVIAERFGVNPSTVQRINRPFDGAGVAVA* |
| Ga0111538_114634211 | 3300009156 | Populus Rhizosphere | IREALATPGRPGIRVIAERFGVNPSTVQRISRPFDGASVAVA* |
| Ga0111538_133969322 | 3300009156 | Populus Rhizosphere | MEERIRKALATPGRPGVRVIAKQFGVDPGTVQRISRPFEGGAGAVAA* |
| Ga0105241_116580232 | 3300009174 | Corn Rhizosphere | APALEKRIREALATPGRPGIRVIAERFGVNPSTVQRVSRPFDGASVAVA* |
| Ga0105242_100959901 | 3300009176 | Miscanthus Rhizosphere | GVAFSPCLEKPIREALTTLGRPRHTTITERFGVNPSTVQRVSRPFDGASVAVA* |
| Ga0105242_118021711 | 3300009176 | Miscanthus Rhizosphere | MAYADTRQLEKRIREALATPGRPSIRVIAERFGVNPSTVQRISRPFDGASVAVA* |
| Ga0105248_118202072 | 3300009177 | Switchgrass Rhizosphere | ATPGRPGIRVIAERFGVNPSTVQRISRPFDGASVAVA* |
| Ga0105249_102203403 | 3300009553 | Switchgrass Rhizosphere | PIAATLEKRICEALATPGRPGIRVIAERFGVNPSTVQRVSRPFDGASVAVA* |
| Ga0105249_113739502 | 3300009553 | Switchgrass Rhizosphere | LATPGRPGIRVIAERFGVNPSTVQRINRPFDGAGVAVA* |
| Ga0126374_110552561 | 3300009792 | Tropical Forest Soil | LATPGRPGVRVIAKRFGVDPGTVQRISRPFDGASVAVA* |
| Ga0105072_10079814 | 3300009818 | Groundwater Sand | EKRIREALATRGRPGIRVIAERFGVNPSTVQRISRPFDGVDVAVA* |
| Ga0126380_105709341 | 3300010043 | Tropical Forest Soil | RLGRPPIAPALEKRIRDALATPGRPGIRVIAERFGVNPSTVQRISRPFDGASVAVA* |
| Ga0126384_102947571 | 3300010046 | Tropical Forest Soil | IREALATPGRPGVRVIAKQFGVDPGTVQRISRPFDRVGVVVA* |
| Ga0126384_114166161 | 3300010046 | Tropical Forest Soil | LAKATEEAIRAAPSQPGRPGVRVIAKQFGVDPSTVQRISSPFGDQAASAVA* |
| Ga0126384_119081011 | 3300010046 | Tropical Forest Soil | PIGPALEKRIREALATPGRPGVRVIAKQFGVNPGTVQRISRPFDGASVAVA* |
| Ga0126384_120801331 | 3300010046 | Tropical Forest Soil | ALEKRIREALATPGRPGVRVIAKRFGVDPGTVQRISRPFEQDAVAL* |
| Ga0126382_124180862 | 3300010047 | Tropical Forest Soil | LATPGRPGVRVIAKRFGVDPGTVQRISRPFASASVVAAV* |
| Ga0126373_115877581 | 3300010048 | Tropical Forest Soil | IAPALEKRIREALATPGRPGVRVIAKQFRVNPGTVQRISRPFEQSAVVL* |
| Ga0126372_110202942 | 3300010360 | Tropical Forest Soil | EKRIREALATPGRPGIRVIAERFGVNPSTVQRISRPFDGASIAAA* |
| Ga0126372_111091201 | 3300010360 | Tropical Forest Soil | EALATPGRPGIRVIAERFGVNPSTVQRISRPFEGASVAVA* |
| Ga0126378_101427342 | 3300010361 | Tropical Forest Soil | IAPALEKRIREALAAPGRPGVRVIAKRFGVNPGTVQRISRPFQHDAVGVLQ* |
| Ga0126378_102503181 | 3300010361 | Tropical Forest Soil | PGVRVIAKQFGVDPGTVQRISRPFDGASVAGAAVSTG* |
| Ga0126377_114427041 | 3300010362 | Tropical Forest Soil | PPIAPALEKRIREALATPGRPGVRVIAKRFGVNPGTVQRISRPFEQDAVAL* |
| Ga0126379_129034032 | 3300010366 | Tropical Forest Soil | GRPPIAAALEKRIREALATPGRPGVRVIAKRFGVDPGTVQRISRPFAAVSVLAAV* |
| Ga0134125_120822511 | 3300010371 | Terrestrial Soil | EGIRAALAVPGRPGVRVIARQFGVNPGTVQRISASRPFEASVVAGLG* |
| Ga0105239_113124363 | 3300010375 | Corn Rhizosphere | PGRPGIRVIAERLGVNPSTAQRISRPFDGASVAVA* |
| Ga0105239_113195781 | 3300010375 | Corn Rhizosphere | KRIREALATPGRPGIRVIAERFGVNPSTVQRISRPFDGASVAVA* |
| Ga0105239_129672441 | 3300010375 | Corn Rhizosphere | GKDADLEKAIRKALNEPGRPGVREIAKQFGVAPGTVQRISRPFEASA* |
| Ga0126381_1012892472 | 3300010376 | Tropical Forest Soil | EALATPGRPGVRVIAKQFGVNPGTVQRISRPFETSAVGAVQ* |
| Ga0126381_1015582271 | 3300010376 | Tropical Forest Soil | PGRPGVGVIAKQFDVDPGTVQRISRPFDGASVAGAAVSTG* |
| Ga0134124_101898272 | 3300010397 | Terrestrial Soil | ALEKRIREALATPGRPGIRVIGDRFGVNPSTVQRISHSFDGAGVAVA* |
| Ga0124850_10017115 | 3300010863 | Tropical Forest Soil | IREALATPGRPDVRVIAKQFGVNPGTVQRISRPFEQDAVAL* |
| Ga0124844_10283561 | 3300010868 | Tropical Forest Soil | RIPIAPALEKRIREALATPGRPGVRVIAKRFGIDPGTVQRISRPFDRVGVVVA* |
| Ga0138505_1000338802 | 3300010999 | Soil | LEERIRKALAIPGRPGVRKIAEQFGVDPGTVQRISRPFETCELVA* |
| Ga0105246_100636596 | 3300011119 | Miscanthus Rhizosphere | PPIAPALEKRIREALATPGRPGIRVIAERFGVNPSTAQRISRPFDGASGAVA* |
| Ga0105246_101261951 | 3300011119 | Miscanthus Rhizosphere | KRLGPPPIAPALEKRIREALATPGRPGIRVIAERFGVNPSTVQRISRPFDGASVAVT* |
| Ga0105246_101904831 | 3300011119 | Miscanthus Rhizosphere | ARSEGKRLGRPPIAAALEKRIREALATPGRPGIRVIAERFGVNPSTVQRINRPFDGAGVAVA* |
| Ga0105246_102280831 | 3300011119 | Miscanthus Rhizosphere | KRLGPPPIAPALEKRIREALATPGRPGIRVIAERFGVNPSTVQRISRPFDGAGVAVA* |
| Ga0105246_108844642 | 3300011119 | Miscanthus Rhizosphere | SALEKRIREALATPGRPGIRVIAERFGVNPSTVQRISRPFDDASVSVA* |
| Ga0137392_115889671 | 3300011269 | Vadose Zone Soil | PIALALEKRIREALATPGRPGVRVIAKRFGVNPGTVQRIGRPFDGASVAVA* |
| Ga0137363_106665432 | 3300012202 | Vadose Zone Soil | LEKRIREALATPGRPGVRVIAKQFGVDPGTVQRISRPFDSVGVVVA* |
| Ga0137374_108121422 | 3300012204 | Vadose Zone Soil | EALATPRRPGVRVIAKQFGVDPGTVQRISRPFEDVGVVLA* |
| Ga0137362_107091841 | 3300012205 | Vadose Zone Soil | RSEGKRFGRPPIAPSLEKRIREALATPGRPGVRVIAKQFGVDPGTVQRISRPFAAASVAIG* |
| Ga0137376_100659414 | 3300012208 | Vadose Zone Soil | GRPPIATALEKRIREATPGRPGVRVAKQFEVDPGTVQRISRPFAAASVAAAVP* |
| Ga0137377_102579603 | 3300012211 | Vadose Zone Soil | NRPGVRVIAKRFGVNPGTVQRISRPFSEASVGAA* |
| Ga0137377_109193131 | 3300012211 | Vadose Zone Soil | RGRPGIRVIAERFGVNPSTVQRISRPFDGASVAVA* |
| Ga0137372_101524491 | 3300012350 | Vadose Zone Soil | LATPGRPGMRVTAKQFGVNPGTVQRISRPFDGVGVAVA* |
| Ga0137386_106191481 | 3300012351 | Vadose Zone Soil | IREALATPGRPGIRVIAERFGVNPSTVQRISRPFGGVDVAVA* |
| Ga0137371_100726531 | 3300012356 | Vadose Zone Soil | MAKGWVPAGIRVIAERFGVTVQRISRPFDGASVAVA* |
| Ga0137361_111543632 | 3300012362 | Vadose Zone Soil | PGRPGVRVIAKQFGVDPGTVQRISRPFVAPSVVAAAP* |
| Ga0137373_101144981 | 3300012532 | Vadose Zone Soil | APALEKRIREALATPGRPGIRVIAERFGVNPSTVQRISRPFDGASVAVA* |
| Ga0137373_107117931 | 3300012532 | Vadose Zone Soil | KPPRVASDDALATPGWPGVRVIAKRFGVDPGTMQRISRPFEDVGVVLA* |
| Ga0137359_102921032 | 3300012923 | Vadose Zone Soil | MAAKRLRAAPTRLAPATPGRPGVRIIAKRFGVNPGTVQRISRPFDGASVAVA* |
| Ga0162650_1000661251 | 3300012939 | Soil | LEERIKKALATPGRPGVRKIAERFGVDPGTVQRISRPFEDRELVA* |
| Ga0126375_107717992 | 3300012948 | Tropical Forest Soil | VASDSPALEKRIREALAAPGRPGVRVIAKQFGVDPGTVQRISRPFDRVGVVVA |
| Ga0164300_101438552 | 3300012951 | Soil | SALEKRIREALATPGRPGIRVIAERFGVNPSTVQRISRPFDGASVAVA* |
| Ga0164298_102509572 | 3300012955 | Soil | ATPGRPGIRVIAERFGVNPSTVQRINRPFDGAGVAVA* |
| Ga0164299_106128001 | 3300012958 | Soil | RAKREGKHVGRPPIAPELEERIRAALAVPGRPGVRVIARQFGVNPGTVQRISASRPFEASVVAGLG* |
| Ga0164302_101499311 | 3300012961 | Soil | SREGKRLGRPPIAPALEKRIREALETPGRPGIRVIAERFGVNPSTVQRVSRPFDAASVAVA* |
| Ga0126369_122600692 | 3300012971 | Tropical Forest Soil | LEKRIREALATPGRPGIRVIAERFGVNSSTVQRISRPFDGASVAGAAVSSG* |
| Ga0134087_105068372 | 3300012977 | Grasslands Soil | LEKRIREALATPGRPGVRVIAKQFGVNPGTVQRISRPFEQDAVAL* |
| Ga0164309_106693941 | 3300012984 | Soil | GRPGIRVIAERFGVNPSTVQRISRPFDDASVAVA* |
| Ga0164309_110262631 | 3300012984 | Soil | RAKREGKHVGRPPIAPELEERIRAALAVPGRPGVRVIARQFGVNPGTVQRISISRPFEASVVAA* |
| Ga0164304_103009742 | 3300012986 | Soil | TPGRPGIRVIAERFGVNPSTVQRINRPFDGAGVAVA* |
| Ga0164304_109336101 | 3300012986 | Soil | EGKRLGRPPIAPALEKRIREALATPGRPGVRVIAEQFGVNPGTVQRISRPFEASAAGL* |
| Ga0164304_117367441 | 3300012986 | Soil | LEKRIREALATPGRPGIRVIVERFGVNPSTVQRISRPFDGARAAVE* |
| Ga0164307_106290411 | 3300012987 | Soil | ATPGRPGIRVIAERLGVNPSTVQRISRPFDGASVAVA* |
| Ga0164306_102987363 | 3300012988 | Soil | MAYADTRQLEKRIREALATPGRPGVRVIAERFGVNPSTVQRISRPFDGASVA |
| Ga0164306_111786191 | 3300012988 | Soil | IREALATPGRAGIRVIAERFGVNPSTVQRINRPFDGASVAMA* |
| Ga0157378_100249073 | 3300013297 | Miscanthus Rhizosphere | PPIAPALEKRIREALATPGRPGIRGIAERFGVNPSTVQRISRPFDGASVAVA* |
| Ga0163162_101629611 | 3300013306 | Switchgrass Rhizosphere | RSEGKRLGRPPIAAALEKRIREALATPGRPGLRVIAERFGVNPSTVQRISRPFDDASVAVA* |
| Ga0157375_117987862 | 3300013308 | Miscanthus Rhizosphere | PPIAPALEKRIREALATPGRPGIRVIAERFGVNPSKVQRISRPFDGASVAVA* |
| Ga0157375_130415231 | 3300013308 | Miscanthus Rhizosphere | LEKPIREALATPGRPAIRVIAARLAVNPSTVQRISRPFDDASVGVA* |
| Ga0157376_100619782 | 3300014969 | Miscanthus Rhizosphere | LGRPPIASALEKRIREALATPGRPGIRVIAERFCVNPSTVQRISRPFDGASVAVA* |
| Ga0132258_103794951 | 3300015371 | Arabidopsis Rhizosphere | PALEKRIREALATPGRPGIRVIAERLGVNPSTVQRISRPFEGASVAVA* |
| Ga0132257_1000948511 | 3300015373 | Arabidopsis Rhizosphere | ALEKRIREALATPGRPGIRVIAERLGVNPSTVQRISRPFEGASVAVA* |
| Ga0132257_1034284822 | 3300015373 | Arabidopsis Rhizosphere | REALATPGRPGIRVIAERFGVNPSTVQRISRPFEGASVAVA* |
| Ga0132257_1035732341 | 3300015373 | Arabidopsis Rhizosphere | PCLVDALAKHGRPGARKIAERFGVDPGTVQRTNHRPFEVASVQA* |
| Ga0132255_1002037584 | 3300015374 | Arabidopsis Rhizosphere | GEAAWPASETPALEKRIREALATPGRPGIRVIAERLGVNPSTVQRISRPFEGASVAVA* |
| Ga0132255_1030966061 | 3300015374 | Arabidopsis Rhizosphere | PGRPSIRIIAERFGVNPSTVQRISRPFDGASVAVA* |
| Ga0182036_113918812 | 3300016270 | Soil | ADLEKRIQAALNKPGRTEGVRKIAERFGVNPSTVQRISRPFDEASAPANG |
| Ga0182036_115981012 | 3300016270 | Soil | EKRIREALAAPGRPGVRVIAKQFGVDPGTVQRISRPFAAASVAIG |
| Ga0182041_102005982 | 3300016294 | Soil | ATPGRPGVRVIAKRFGVDPGTVQRISRPFDGASVAVA |
| Ga0182041_117213792 | 3300016294 | Soil | LATPGRPGVRVIAKQFGVNPGTVQRISRPFEQDAVAL |
| Ga0182035_116172452 | 3300016341 | Soil | ALATPGRPGVRVIAKQFGVNPGTVQRISRPFEQDAVAL |
| Ga0182035_117654391 | 3300016341 | Soil | KRVREALATPGRPGVRVIAKQFGVDPATVQRISHPFAAASVVVG |
| Ga0182034_114423502 | 3300016371 | Soil | ATPGRPGVRVIAKQFGVNPGTVQRISRPFEQDAVAL |
| Ga0182040_104188902 | 3300016387 | Soil | TPGRPGIRVIAERFGVNPSTVQRISRPFDGASVAVA |
| Ga0182037_100686853 | 3300016404 | Soil | RSEGKRLGRPPIAAALEKRIREALATPGRPGIRVIAERFGVNPSTVQRISRPFDGASVVAAVP |
| Ga0182037_110775251 | 3300016404 | Soil | KRLGRLPIAPTLEKRVREALATPGRPGVRVIAKQFGVDPATVQRISHPFAAASVVVG |
| Ga0182037_117862751 | 3300016404 | Soil | GKRLGRPPIAPALEKRIREALATPGRPGVRVIAKRFGADPGTVQRISRPFDASAAAV |
| Ga0182038_110081862 | 3300016445 | Soil | EKRIREALAVPGRPGVRVIAKQFGVDPGTVQRISRPFAAASVAAG |
| Ga0163161_100271581 | 3300017792 | Switchgrass Rhizosphere | LGRPPIASALEKRIREALATPGRPGIRVIAERFGVNPSTVQRISRPFDGASVAVA |
| Ga0163161_108928712 | 3300017792 | Switchgrass Rhizosphere | IREALATPGRPGIRVIAERFGVNPSTVQRINRPFDGAGVAVA |
| Ga0184634_103025552 | 3300018031 | Groundwater Sediment | EKRIREALATPGRPGIRVIAERLGVNPSTVQRISRPFDGASVAVA |
| Ga0184617_12078901 | 3300018066 | Groundwater Sediment | EARIKKALAIPGRPGVRKIAEQFGVDPGTVQRISRPIGTCELVA |
| Ga0184611_10451291 | 3300018067 | Groundwater Sediment | EALATPGRPGIRVIAERFGVNPSTVQRINRPFDGASVAVA |
| Ga0184611_11665601 | 3300018067 | Groundwater Sediment | APALEKRIREALATPGRPGIRVIAGRFGVNPSTAQRISRPFDGASVAVA |
| Ga0184624_104026562 | 3300018073 | Groundwater Sediment | ALEKRIREALATPGRPGIRVIAERFGVNPSTVQRISRPFDGASVAVA |
| Ga0184609_105252301 | 3300018076 | Groundwater Sediment | GRPGVRKIAERFGVNPSTVQRISHSPFGGGVSDEGASAAVA |
| Ga0184639_105509671 | 3300018082 | Groundwater Sediment | PALEKRIREALATPGRPGIRVIAERLGVNPSTVQRISRPFDGASVAVA |
| Ga0190265_101683936 | 3300018422 | Soil | GRPSSAPELEAKIQTALARPGRPGVRKIAAQFGVDPGTVQRISRPLEVVAVAA |
| Ga0066667_102669662 | 3300018433 | Grasslands Soil | ATPGRPGVRVLAKQLGVNVSTVQRISRPFEAVVVGQ |
| Ga0190270_113161772 | 3300018469 | Soil | GRPGIRVIAERFGVNPSTVQRISRPFDGASVAVALQ |
| Ga0190270_120101672 | 3300018469 | Soil | PTAPALEKRIREALATPGRPGIRVIAERFGVNPSTVQRISRPFDGASVAVA |
| Ga0190274_107895472 | 3300018476 | Soil | MEERIRKALAIPGRPGVRVIAKPFGVDPGTVQRISRPFENVASVV |
| Ga0190271_132134422 | 3300018481 | Soil | EALNKPDRPGVRVIAKHFGVAVNTVQRIRRPFVGGPSVAA |
| Ga0173481_101354773 | 3300019356 | Soil | ALEKRIREALATPGRPGIRVIAERFGVNPSTVQRISRPFDGASAAVA |
| Ga0210380_100084304 | 3300021082 | Groundwater Sediment | PALEKRIREALATPGRPGIRVIAERFGVNPSTVQRISRPFDGASAAVA |
| Ga0210402_118936451 | 3300021478 | Soil | RAKTPGRTDGVRKIAKQFGVDPGTVQRISRPFDRASVAL |
| Ga0126371_113019002 | 3300021560 | Tropical Forest Soil | VTAVTATVPPIAPAVEKRIRDALATPGRPGVRVIAKQFGVNPGTVQRISRPFEQ |
| Ga0222623_102604602 | 3300022694 | Groundwater Sediment | ALATPGRPGVRKIAAQFGVDPGTVQRISRPFETRELVA |
| Ga0222623_103196071 | 3300022694 | Groundwater Sediment | LATPGRPGVRKIAENFGVDPGTVQRISRPFEASAADA |
| Ga0207692_109341401 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | RIREALATPGRPGIRVIAERFGVNPSTVQRISRPFDGASVAVA |
| Ga0207710_101991911 | 3300025900 | Switchgrass Rhizosphere | EALATPGRPGIRVIAERFGVNPSTVQRISRPFDGASVAVA |
| Ga0207647_101203842 | 3300025904 | Corn Rhizosphere | ATLEKRICEALATPGRPGIRVIAERFGVNPSTVQRISRPFDGASVAVA |
| Ga0207647_102500072 | 3300025904 | Corn Rhizosphere | PALEKRIRKALATPGRPGIRVIAERFGVNPSTVQRINRPFDGAGVAVA |
| Ga0207643_102720062 | 3300025908 | Miscanthus Rhizosphere | KRIREALATPGRPGIRVIAERFGVNPSTVQRINRPFDGAGVAVA |
| Ga0207671_102942451 | 3300025914 | Corn Rhizosphere | LATPGRPGIRVIAERFGVNPSTVQRISRPFDGASVAVA |
| Ga0207693_101446054 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | GRPPIAPALEKRIREALATPGRPGVRVIAKQFGVNPGTVQRISRPFEQDAVAL |
| Ga0207693_106053122 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | KRIREALATPGRPGVRVIAKRFGVDPGTVQRISRPFEQDTVAL |
| Ga0207662_103066351 | 3300025918 | Switchgrass Rhizosphere | ARARSVGKRLGRPPIASALEKRIREALATPGRPGIRVIAERFGVNPSTVQRINRPFDGAGVAVA |
| Ga0207657_100374073 | 3300025919 | Corn Rhizosphere | EALATPGRPGLRVIAERFGVNPSTVQRISRPFDGASVAVA |
| Ga0207649_114299091 | 3300025920 | Corn Rhizosphere | ASAEVQRIRALSTPGRPGIRVIAERFGVNPSTVQRVSHPFDGASVAVA |
| Ga0207694_106617531 | 3300025924 | Corn Rhizosphere | RIREALATPGRPGIRVIAERFGVNPSTVQRINRPFDGAGVAVA |
| Ga0207700_109347181 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | LGRPPIALALEKRIREALATPGRPGVRVIAKRFGVNPGTVQRISRPFDGASVAVA |
| Ga0207664_107653751 | 3300025929 | Agricultural Soil | RLGRPPIAPALEKRIREALATPGRPGVRVIAKQFGVNPGTVQRISRPFEASAAGL |
| Ga0207670_102172661 | 3300025936 | Switchgrass Rhizosphere | RSEGKRLGRPIAPALEKRIREALATPGRPGIRVIAERFGVNPSTVQRISRPFDGASVAVA |
| Ga0207704_108751642 | 3300025938 | Miscanthus Rhizosphere | APALEKRIREALATPGRPGIRVIAERFGVNPSTVQRISRPFDGASVAVA |
| Ga0207651_102802311 | 3300025960 | Switchgrass Rhizosphere | IREALATPGRPGIRVIAERFGVNPSTVQRISRPFDGASVAVA |
| Ga0207651_119465931 | 3300025960 | Switchgrass Rhizosphere | PGRPGIRVIAERFGVNPSTVQRISRPFDGASVAVA |
| Ga0207712_109080842 | 3300025961 | Switchgrass Rhizosphere | LATPGRPGIRVIAERFGVNPSTVQRINRPFDGAGVAVA |
| Ga0207640_105038191 | 3300025981 | Corn Rhizosphere | EVQRIRALSTPGRPGIRVIAERFGVNPSTVQRVSRPFDGASVAVA |
| Ga0207677_103700361 | 3300026023 | Miscanthus Rhizosphere | PIAPALEKRIREALATPGRPGIRVIAERLGVNPSTAQRISRPFDGASVAVA |
| Ga0207677_116825911 | 3300026023 | Miscanthus Rhizosphere | PPIAPALEKRIREALATPGRPGIRVIAERLGVNPSTVQRISRPFDSASVAVA |
| Ga0207703_100332692 | 3300026035 | Switchgrass Rhizosphere | LEKRICEALATPGRPGIRVIAERFGVNPSTVQRISRPFDGASVAVA |
| Ga0207641_119573861 | 3300026088 | Switchgrass Rhizosphere | PIAAALEKRIREALATPGRPGIRVIAERFGVNPSTVQRINRPFDGAGVAVA |
| Ga0207648_105647461 | 3300026089 | Miscanthus Rhizosphere | SEGKRLGRPPIAPALEKRIREALATPGRPGIRVIAERFGVNPSTVQRISRPFDGASVAVA |
| Ga0207676_102546173 | 3300026095 | Switchgrass Rhizosphere | ALATPGRPGIRVIAERFGVNPSTVQRISRPFDGASVAVA |
| Ga0207675_1007106181 | 3300026118 | Switchgrass Rhizosphere | ARSVGKRLGRPPIASALEKRIREALATPGRPGIRVIAERFGVNPSTVQRINRPFDGAGVAVA |
| Ga0207683_102675522 | 3300026121 | Miscanthus Rhizosphere | REALATPGRPGIRVIAERLGVNPSTVQRISRPFDGASVAVA |
| Ga0207683_104522941 | 3300026121 | Miscanthus Rhizosphere | ALATPGRPGIRVIAERFGVNPSTVQRISRPFDDASVAVA |
| Ga0207698_106897681 | 3300026142 | Corn Rhizosphere | IRALSTPGRPGIRVIAERFGVNPSTVQRVSRPFDGASVAVA |
| Ga0209158_12310371 | 3300026333 | Soil | RARAEGKRVGRPPIATALEKRIREATPGRPGVRVAKQFEVDPGTVQRISRPFAAASVAAAVP |
| Ga0209331_11685692 | 3300027603 | Forest Soil | EDAIRKALSTPGRTEGVRKIAARFGVDPGTVQRISRPFDGVSVAVG |
| Ga0209488_104834582 | 3300027903 | Vadose Zone Soil | ALAQSGRPGVRKIAVEFGVDPGTVQRISRPLKSANVAVV |
| Ga0209382_111335822 | 3300027909 | Populus Rhizosphere | LEKRIRQALATPGRPGIRVIAERFGVNPSTVQRISRPFEESVAAA |
| Ga0209382_112581221 | 3300027909 | Populus Rhizosphere | EERIRKALAASGRPGVRKLAERFGVNVSTVQRISASPFEVAAAAVQVGDILSA |
| Ga0209382_118933921 | 3300027909 | Populus Rhizosphere | ALAVPGRPGVRKIAERFGVDPGTVQRISRPFEARAVDG |
| Ga0268264_101730782 | 3300028381 | Switchgrass Rhizosphere | ASALEKRLATPGRPGIRVIAERFGVNPSTVQRISRPFDGASVAVA |
| Ga0307298_101782921 | 3300028717 | Soil | HGFVSPIAPALEKRIREALATPGRPGIRVIAERFGVNPSTVQRISRPFDGASVAVA |
| Ga0307307_102611042 | 3300028718 | Soil | PELEERIRKALSIPGRPGVRKIAEQFGVDPGTVQRISRPVGTCELVS |
| Ga0307317_101733992 | 3300028720 | Soil | LVGLPIAPALEKRIREALATPGRPGIRVIAERLGVNPSTVQRISRPFDGASVAVA |
| Ga0307288_101014483 | 3300028778 | Soil | DDGLRWRLRLALEKRIREALATPGRPGIRVIAERFGVNASTVQRINRPFDGASVAVA |
| Ga0307282_100757953 | 3300028784 | Soil | ALATPGRPGIRVIAERLGVNPSTVQRISRPFDGASGAEA |
| Ga0307282_104140831 | 3300028784 | Soil | IAPALEKRILEALATPGRPGVRVIAKQFGVNPGTVQRISRPFEQDAVAL |
| Ga0247824_106430481 | 3300028809 | Soil | WRNESREALATPGRPGIRVIAERFGVNPSTVQRISRPFDGASVAVA |
| Ga0307296_101165403 | 3300028819 | Soil | MMDCEGAYASRWRNESVRLWPTPGRPGIRVIAERLGVNPSTVQRISRPFDGASVAVA |
| Ga0307296_105763212 | 3300028819 | Soil | RIAPELEARIRKALATPGRPGVRKIATQLGVDPGTVQRISRPFEASAVDA |
| Ga0307310_105055992 | 3300028824 | Soil | ALATPGRPGVRVIAKRFGVDPGTVQRISRPFDGVGVLVT |
| Ga0307312_100921181 | 3300028828 | Soil | EALATPGRPGIRVIAERLGVNPSTVQRISRPFDGASVAVA |
| Ga0307312_110451841 | 3300028828 | Soil | RIREALATPGRPGIRVIAERFGVNPSTVQRVSRPFDGASVAVA |
| Ga0307289_101193481 | 3300028875 | Soil | ALATPGRPGIRVIAERLGVNPSTVQRISRPFDGASVAVA |
| Ga0307289_103620271 | 3300028875 | Soil | ERIRKALSIPGRPGVRKIAEQFGVDPGTVQRISRPIGTCELVA |
| Ga0307277_100123404 | 3300028881 | Soil | IAPALEKRIREALATPGRPGVRVIAKQFGVNPGTVQRISRPFEQDAVAL |
| Ga0307277_100595201 | 3300028881 | Soil | IAPALEKRIREALATPGRPGVRVIAKQFGVNPGTVQRISRPFEQDAVAP |
| Ga0307277_103931542 | 3300028881 | Soil | GEGKRLGRPPIAPALEKRIREALATPGRPGVRVIAKQFGVNPGTVQRISRPFEQDAVAL |
| Ga0318516_106480041 | 3300031543 | Soil | SGLVGRPIAPALEKRIREALATPGRPGIRVIAERFGVNPSTVQRISRPFDGANVAVA |
| Ga0318541_100114721 | 3300031545 | Soil | SEGKRLGRPPIAAALEKRIREALATPGRPGIRVIAERFGVNPLTVQRISRPFDGASVVAAVP |
| Ga0318541_104760702 | 3300031545 | Soil | KRIREALATPGRPGIRVIAERFGVNPSTVQRISRPFDGASVAVA |
| Ga0318541_105615571 | 3300031545 | Soil | ALEKRIREALATPGRPGVRVIAKQFGVNPGTVQRISRPFEQDAVAL |
| Ga0310915_111729951 | 3300031573 | Soil | RPPIASALEKRIREALATPGRPGVRVIAKRFGVDPGTVQRISRPFVGASVVAAV |
| Ga0318555_100133781 | 3300031640 | Soil | PGIRVIAERFGVNPSTVQRISRPFDGAGVAVAVSAR |
| Ga0318561_101135203 | 3300031679 | Soil | LGRPPIAPALEKRIREALATPGRPGIRVIAERFGVNPSTVQRISRPFDGASVAVA |
| Ga0318560_102720012 | 3300031682 | Soil | PALEKRIREALATPGRPGIRVIAERFGVNPSTVQRISRPFDGASVAVA |
| Ga0318560_105517602 | 3300031682 | Soil | PPIAAALEKRIREALATPGRPGIRVIAERFGVNPSTVQRISRPFDGASVVAAVP |
| Ga0306917_109857983 | 3300031719 | Soil | GKENAWAPIAPALEKRIREALATPGRPGVRVIAKQFGVDPGTVQRISRPFAAASVAAAVP |
| Ga0318493_107123971 | 3300031723 | Soil | LEKRIREALAAPGRPGVRVIAKRFGVNPGTVQRISRPFQHGGVGVLQ |
| Ga0318500_100109651 | 3300031724 | Soil | GRPPIAAALEKRIREALATPGRPGIRVIAERFGVNPSTVQRISRPFDGAGVAVAVSAR |
| Ga0318500_105588522 | 3300031724 | Soil | GEGKRLGRLPIAPTLEKRVREALATPGRPGVRVIAKQFGVDPATVQRISHPFAAASVVVG |
| Ga0306918_112544231 | 3300031744 | Soil | SALEKRIREALATPGRPGVRVIAKRFGVDPGTVQRISRPFVAPSVVAAVP |
| Ga0306918_114944151 | 3300031744 | Soil | GEGKRLGRPPIAPALEKRIREALAIPGRPGVRVIAKQFGVNPGTVQRISRPFEQDAVAL |
| Ga0318492_107219651 | 3300031748 | Soil | PIAPALEKRIREALATPGRPGIRVIAERFGVNPSTVQRISRPFDGANVAVA |
| Ga0318535_102667781 | 3300031764 | Soil | PGRPGVRVIAKRFGIDPGTVQRISRPFDREGVVVA |
| Ga0318554_103606011 | 3300031765 | Soil | KRLGRPPIAAALEKRIREALATPGRPGIRVIAERFGVNPSTVQRISRPFDGASVAVA |
| Ga0318546_103980963 | 3300031771 | Soil | IREALAVPGRPGVRVIAKQFGVDPGTVQRISRPFAAASVAAG |
| Ga0318566_104529502 | 3300031779 | Soil | AAALEKRIREALATPGRPGIRVIAERFGVNPSTVQRISCPFDGASVVAAVP |
| Ga0318508_10655141 | 3300031780 | Soil | PSIAPALEKRIREALALPGRPGVRVIAKQFGVNPGTVQRISRPFAAASIGGLT |
| Ga0318550_104460531 | 3300031797 | Soil | RGEGKRLGRPPIAPALEKRIREALATPGRPGVRVIAKQFGVNPGTVQRISRPFEQDAVAL |
| Ga0318550_105780441 | 3300031797 | Soil | REALAAPGRPGVRVIAKQFGVDPGTVQRISRPFAAASVAIG |
| Ga0318568_100267341 | 3300031819 | Soil | GKRLGRPPIAAALEKRIREALATPGRPGIRVIAERFGVNPSTVQRISRPFDGAGVAVAVSAR |
| Ga0318511_103443312 | 3300031845 | Soil | ALAVPGRPGVRVIAKQFGVDPGTVQRISRPFAAASVAAG |
| Ga0318527_100065011 | 3300031859 | Soil | REGKRLGRPPIAAALEKRIREALATPGRPGIRVIAERFGVNPSTVQRISRPFDGAGVAVAVSAR |
| Ga0306919_101084944 | 3300031879 | Soil | GRPPIAPALEKRILEALATPGRPGVRVIAKRFGVDPGTVQQISRPFDSVGVVVA |
| Ga0306919_111545341 | 3300031879 | Soil | EALATPGRPGVRVIAKQFGVDPGTVQRISRPFDVASVAMA |
| Ga0306923_101311961 | 3300031910 | Soil | LAAPGRPGVRVIAKRFGVNPGTVQRISRPFQHGAVGVLQ |
| Ga0306923_113909661 | 3300031910 | Soil | IREALATPGRPGIRVIAERFGVNPSTVQRISRPFDGASVVAAVP |
| Ga0310912_100389395 | 3300031941 | Soil | GRPPIAPALEKRIRKALAAPGRPGVRVIAKRFGVNPGTVQRISRPFQHGAVGVLQ |
| Ga0310912_107668492 | 3300031941 | Soil | LEKRIREALATPGRPGVRVIAKRFGVDPGTVQRISRPFAGASVVAAV |
| Ga0310916_103688191 | 3300031942 | Soil | AWAPIAPALEKRIREALATPGRPGVRVIAKQFGVDPGTVQRISRPFAAASVAAAVP |
| Ga0310910_108338602 | 3300031946 | Soil | GRPRIAPEPEERIRKALATPGRPGVRKIAERFGVDPGTVQRISRPFEQDAVAL |
| Ga0310910_111072602 | 3300031946 | Soil | LRAGRPGIRVIAERFGVNPSTVQRISRPFDGASVAVA |
| Ga0310909_110535802 | 3300031947 | Soil | IAPALEKRIREALATPGRPGIRVIAERFGVNPSTVQRISRPFDGASVAVA |
| Ga0306926_129901502 | 3300031954 | Soil | LEKRIREALATPGRPGVRVIAKRFGVDPGTVQRISRPFDGATVAVA |
| Ga0318563_100833792 | 3300032009 | Soil | GIRVIAERFGVNPSTVQRISRPFDGAGVAVAVSAR |
| Ga0318575_107041992 | 3300032055 | Soil | PIAPALEKRIREALATPGRPGVRVIAKRFGVDPGTVQRISRPFAGASVVAAV |
| Ga0318533_101551771 | 3300032059 | Soil | KRLGRPPIAPALEKRIREALATPGRPGIRVIAERLGVNPSTVQRISRPFEQDAVAL |
| Ga0318533_107375951 | 3300032059 | Soil | EALATPGRPGVRVIAKRFGVDPGTVQRISRPFVAPSVVAAVP |
| Ga0318504_101471573 | 3300032063 | Soil | EALAAPGRPGVRVIAKQFGVDPGTVQRISRPFAAASVAIG |
| Ga0318553_100113521 | 3300032068 | Soil | EGKRLGRPPIAAALEKRIREALATPGRPGIRVIAERFGVNPSTVQRISRPFDGAGVAVAVSAR |
| Ga0318518_105560542 | 3300032090 | Soil | ALATPGRPGIRVIAERFGVNPSTVQRISRPFDGASVVAAVP |
| Ga0318518_105580711 | 3300032090 | Soil | IKAELEKGIQAALNKPGRTEGVRKIAERFGVNPSTVQRISRPFDEASAPANG |
| Ga0318518_106607871 | 3300032090 | Soil | RAPPKIREALATPGRPGVRVIAKQFGVDPGTVQRISRPFDGASVAVA |
| Ga0318540_101059171 | 3300032094 | Soil | LGRPPIAPTLEKRIREALATPGRPGVRVIAKRFGVNPGTVQRISRPFDRVGVVVA |
| Ga0318540_104589801 | 3300032094 | Soil | LATPGRPGIRVIAERFGVNPSTVQRISRPFDGASVVAAVP |
| Ga0318540_104660802 | 3300032094 | Soil | EKGIQAALNKPGRTEGVRKIAERFGVNPSTVQRISRPFDEASAPANG |
| Ga0306920_1006966831 | 3300032261 | Soil | RIREALATPGRCGVRVIAKWFGVNPGTVQRISRPFDRVGVVVA |
| Ga0306920_1023265471 | 3300032261 | Soil | RPPIAPALEKRIREALATPGRPGVRVIAKRFGVDPGTVQRISRPFDGATVAVA |
| Ga0306920_1030699482 | 3300032261 | Soil | ALAAPNRPGVRVIAKRFGVNPGTVQRISRPFSAASVGAA |
| Ga0310914_102783311 | 3300033289 | Soil | EALATPRRPGVRVIAKQFGVDPGTVQRISRPFDGGSVAVA |
| ⦗Top⦘ |