 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F008389 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 334 |
| Average Sequence Length | 37 residues |
| Representative Sequence | MKIKLEIEIDTENEQDLNTIEEVIEKLRELKELMYE |
| Number of Associated Samples | 172 |
| Number of Associated Scaffolds | 334 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 71.86 % |
| % of genes near scaffold ends (potentially truncated) | 15.87 % |
| % of genes from short scaffolds (< 2000 bps) | 61.08 % |
| Associated GOLD sequencing projects | 143 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (53.892 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (22.156 % of family members) |
| Environment Ontology (ENVO) | Unclassified (55.389 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (85.329 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.38% β-sheet: 0.00% Coil/Unstructured: 65.62% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 334 Family Scaffolds |
|---|---|---|
| PF01467 | CTP_transf_like | 29.94 |
| PF07883 | Cupin_2 | 12.87 |
| PF00136 | DNA_pol_B | 12.87 |
| PF00970 | FAD_binding_6 | 7.78 |
| PF03332 | PMM | 4.79 |
| PF03104 | DNA_pol_B_exo1 | 3.29 |
| PF01370 | Epimerase | 3.29 |
| PF04820 | Trp_halogenase | 2.99 |
| PF02668 | TauD | 2.40 |
| PF04325 | DUF465 | 1.80 |
| PF08030 | NAD_binding_6 | 1.50 |
| PF03721 | UDPG_MGDP_dh_N | 1.50 |
| PF00156 | Pribosyltran | 1.50 |
| PF01230 | HIT | 0.60 |
| PF05433 | Rick_17kDa_Anti | 0.30 |
| PF01844 | HNH | 0.30 |
| PF02739 | 5_3_exonuc_N | 0.30 |
| PF11953 | DUF3470 | 0.30 |
| PF02773 | S-AdoMet_synt_C | 0.30 |
| PF03851 | UvdE | 0.30 |
| PF00881 | Nitroreductase | 0.30 |
| PF14890 | Intein_splicing | 0.30 |
| PF00303 | Thymidylat_synt | 0.30 |
| PF00166 | Cpn10 | 0.30 |
| PF00004 | AAA | 0.30 |
| PF03235 | DUF262 | 0.30 |
| PF03819 | MazG | 0.30 |
| PF00984 | UDPG_MGDP_dh | 0.30 |
| PF05050 | Methyltransf_21 | 0.30 |
| PF00521 | DNA_topoisoIV | 0.30 |
| PF02511 | Thy1 | 0.30 |
| PF00550 | PP-binding | 0.30 |
| COG ID | Name | Functional Category | % Frequency in 334 Family Scaffolds |
|---|---|---|---|
| COG0417 | DNA polymerase B elongation subunit | Replication, recombination and repair [L] | 16.17 |
| COG0561 | Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases | Coenzyme transport and metabolism [H] | 4.79 |
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 2.40 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 1.80 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 1.80 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 1.50 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 1.50 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 1.50 |
| COG0188 | DNA gyrase/topoisomerase IV, subunit A | Replication, recombination and repair [L] | 0.30 |
| COG0192 | S-adenosylmethionine synthetase | Coenzyme transport and metabolism [H] | 0.30 |
| COG0207 | Thymidylate synthase | Nucleotide transport and metabolism [F] | 0.30 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.30 |
| COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 0.30 |
| COG1351 | Thymidylate synthase ThyX, FAD-dependent family | Nucleotide transport and metabolism [F] | 0.30 |
| COG1479 | DNAse/DNA nickase specific for phosphorothioated or glycosylated phage DNA, GmrSD/DndB/SspE family, contains DUF262 and HNH nuclease domains | Defense mechanisms [V] | 0.30 |
| COG4294 | UV DNA damage repair endonuclease | Replication, recombination and repair [L] | 0.30 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 53.89 % |
| All Organisms | root | All Organisms | 46.11 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 22.16% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 13.47% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 8.68% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 6.89% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 5.69% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 3.29% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.29% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 2.69% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.69% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.99% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 2.99% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 2.99% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 1.80% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 1.80% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.80% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 1.20% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.20% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 1.20% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.20% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 1.20% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 1.50% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 1.50% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.90% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.90% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.90% |
| Marine | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine | 0.90% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.60% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.60% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 0.60% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.30% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.30% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.30% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.30% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Freshwater And Marine | 0.30% |
| Estuarine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Estuarine | 0.30% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.30% |
| Polar Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine | 0.30% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000224 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 34 06/16/09 10m | Environmental | Open in IMG/M |
| 3300000265 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_A_09_P04_10 | Environmental | Open in IMG/M |
| 3300000867 | Estuary microbial communities from the Columbia River - metatranscriptome 5 PSU | Environmental | Open in IMG/M |
| 3300000928 | Marine plume microbial communities from the Columbia River - 25 PSU | Environmental | Open in IMG/M |
| 3300000929 | Marine plume microbial communities from the Columbia River - 15 PSU | Environmental | Open in IMG/M |
| 3300000947 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92 | Host-Associated | Open in IMG/M |
| 3300002132 | Marine microbial communities from the Baltic Sea, analyzing arctic terrigenous carbon compounds - M2t6BS2 (105f) | Environmental | Open in IMG/M |
| 3300002140 | Marine microbial communities from the Baltic Sea, analyzing arctic terrigenous carbon compounds - M2t2FKB2 (112f) | Environmental | Open in IMG/M |
| 3300003216 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA | Environmental | Open in IMG/M |
| 3300003345 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNA | Environmental | Open in IMG/M |
| 3300003346 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_74LU_5_DNA | Environmental | Open in IMG/M |
| 3300003409 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_161SG_22_DNA | Environmental | Open in IMG/M |
| 3300003410 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_153SG_22_DNA | Environmental | Open in IMG/M |
| 3300003427 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA | Environmental | Open in IMG/M |
| 3300003474 | Estuarine microbial communities from the Sarno estuary, Gulf of Naples, Italy - Sample Station 4 | Environmental | Open in IMG/M |
| 3300003592 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_10m_DNA | Environmental | Open in IMG/M |
| 3300003620 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300005912 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKD | Environmental | Open in IMG/M |
| 3300005913 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK1 | Environmental | Open in IMG/M |
| 3300005931 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK9 | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
| 3300006352 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNA | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007231 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007516 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 | Environmental | Open in IMG/M |
| 3300007519 | Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-03 | Environmental | Open in IMG/M |
| 3300007522 | Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-01 | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007554 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709 | Environmental | Open in IMG/M |
| 3300007557 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715 | Environmental | Open in IMG/M |
| 3300007558 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.733 | Environmental | Open in IMG/M |
| 3300007609 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_H2O_MG | Environmental | Open in IMG/M |
| 3300007653 | Estuarine microbial communities from the Columbia River estuary - metaG 1546C-3 | Environmental | Open in IMG/M |
| 3300007715 | Estuarine microbial communities from the Columbia River estuary - metaG S.751 | Environmental | Open in IMG/M |
| 3300007725 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009003 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725 | Environmental | Open in IMG/M |
| 3300009049 | Estuarine microbial communities from the Columbia River estuary - metaG 1558A-02 | Environmental | Open in IMG/M |
| 3300009052 | Estuarine microbial communities from the Columbia River estuary - metaG 1550A-02 | Environmental | Open in IMG/M |
| 3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
| 3300009080 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 | Environmental | Open in IMG/M |
| 3300009086 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009409 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
| 3300009441 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome | Environmental | Open in IMG/M |
| 3300009467 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 | Environmental | Open in IMG/M |
| 3300009495 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 | Environmental | Open in IMG/M |
| 3300009496 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300009526 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 | Environmental | Open in IMG/M |
| 3300009544 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300012418 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA12.A_72.20151113 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
| 3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017949 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017952 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017957 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018036 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018049 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018413 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018428 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020052 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011503CT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020053 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041401AS metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020055 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101411CT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020185 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1 | Environmental | Open in IMG/M |
| 3300020191 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041410US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020253 | Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX555982-ERR598945) | Environmental | Open in IMG/M |
| 3300020266 | Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX556082-ERR598951) | Environmental | Open in IMG/M |
| 3300020336 | Marine microbial communities from Tara Oceans - TARA_E500000081 (ERX289008-ERR315860) | Environmental | Open in IMG/M |
| 3300020347 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994) | Environmental | Open in IMG/M |
| 3300020352 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556084-ERR599144) | Environmental | Open in IMG/M |
| 3300020382 | Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX556058-ERR599059) | Environmental | Open in IMG/M |
| 3300020440 | Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX555952-ERR599043) | Environmental | Open in IMG/M |
| 3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
| 3300021368 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550 | Environmental | Open in IMG/M |
| 3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
| 3300021379 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247 | Environmental | Open in IMG/M |
| 3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300022822 | Saline water microbial communities from Ace Lake, Antarctica - #293 | Environmental | Open in IMG/M |
| 3300022900 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG | Environmental | Open in IMG/M |
| 3300022926 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG | Environmental | Open in IMG/M |
| 3300022937 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG | Environmental | Open in IMG/M |
| 3300023081 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG | Environmental | Open in IMG/M |
| 3300023109 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MG | Environmental | Open in IMG/M |
| 3300023119 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG | Environmental | Open in IMG/M |
| 3300024191 | Seawater microbial communities from Monterey Bay, California, United States - 45D | Environmental | Open in IMG/M |
| 3300024236 | Seawater microbial communities from Monterey Bay, California, United States - 67D | Environmental | Open in IMG/M |
| 3300024255 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MG | Environmental | Open in IMG/M |
| 3300024267 | Seawater microbial communities from Monterey Bay, California, United States - 28D | Environmental | Open in IMG/M |
| 3300024296 | Seawater microbial communities from Monterey Bay, California, United States - 36D | Environmental | Open in IMG/M |
| 3300024329 | Seawater microbial communities from Monterey Bay, California, United States - 39D | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025083 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025085 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025276 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes) | Environmental | Open in IMG/M |
| 3300025502 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKJ (SPAdes) | Environmental | Open in IMG/M |
| 3300025570 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025608 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_161SG_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025617 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_153SG_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025626 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes) | Environmental | Open in IMG/M |
| 3300025636 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025658 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_10m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025684 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_74LU_5_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025695 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025767 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025849 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes) | Environmental | Open in IMG/M |
| 3300025870 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026097 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026483 | Seawater microbial communities from Monterey Bay, California, United States - 23D | Environmental | Open in IMG/M |
| 3300027413 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_54_BLW_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027612 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_125SG_5_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027687 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300027704 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027751 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 (SPAdes) | Environmental | Open in IMG/M |
| 3300027752 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300027757 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 (SPAdes) | Environmental | Open in IMG/M |
| 3300027780 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes) | Environmental | Open in IMG/M |
| 3300027788 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes) | Environmental | Open in IMG/M |
| 3300027810 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027832 | Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027833 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027976 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes) | Environmental | Open in IMG/M |
| 3300031141 | Marine microbial communities from water near the shore, Antarctic Ocean - #351 | Environmental | Open in IMG/M |
| 3300031143 | Marine microbial communities from water near the shore, Antarctic Ocean - #422 | Environmental | Open in IMG/M |
| 3300031510 | Marine microbial communities from water near the shore, Antarctic Ocean - #129 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031523 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SI3L | Environmental | Open in IMG/M |
| 3300031569 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2 | Environmental | Open in IMG/M |
| 3300031594 | Marine microbial communities from Western Arctic Ocean, Canada - CB9_20m | Environmental | Open in IMG/M |
| 3300031626 | Marine microbial communities from Western Arctic Ocean, Canada - CB21_surface | Environmental | Open in IMG/M |
| 3300031656 | Marine microbial communities from water near the shore, Antarctic Ocean - #67 | Environmental | Open in IMG/M |
| 3300031695 | Marine microbial communities from water near the shore, Antarctic Ocean - #233 | Environmental | Open in IMG/M |
| 3300031702 | Marine microbial communities from David Island wharf, Antarctic Ocean - #37 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100125407 | 3300000101 | Marine | LILETKMKIKFEAEIDTENAQDLNTIEELIAMLKNLAENYYEE* |
| DelMOSum2010_100591232 | 3300000101 | Marine | LISENKVKIKLEIEIDTENDQDLNTIEEVIEKLRELKEMME* |
| DelMOSum2010_101356222 | 3300000101 | Marine | MKIKFEAEIDTENDQDLNTIEELITLLKQLAENYYEE* |
| DelMOSum2010_101611652 | 3300000101 | Marine | MKIKLEIEIDTESEQDLNTIEEVIEKITELKELMYESTD* |
| SI34jun09_10mDRAFT_10044192 | 3300000224 | Marine | MKIKFEAEIDTDNEQDLNTIEELISMLKQLAENYYEE* |
| SI34jun09_10mDRAFT_10059243 | 3300000224 | Marine | MKIKLEIEIDTENDQDLNTIEEVIEKLRELKEMME* |
| SI34jun09_10mDRAFT_10222612 | 3300000224 | Marine | MKIKFEAEIDTENDQDLNTIEELIAMLRALADNYLDE* |
| LP_A_09_P04_10DRAFT_10010683 | 3300000265 | Marine | MKIKFEAEIDTDNEQDLNTIEELISMLRQLAENYYEE* |
| LP_A_09_P04_10DRAFT_10023437 | 3300000265 | Marine | LILETKMKIKFEAEIDTENAQDLNTIEELIAMLRNLAENYYEE* |
| LP_A_09_P04_10DRAFT_10093466 | 3300000265 | Marine | MKIKMEVEIDTDNNQDLNTIEELIAMLRNLAENYYEE* |
| LP_A_09_P04_10DRAFT_10417782 | 3300000265 | Marine | MKIKMEVEIDTDNNQDLNTIEELIAMLRNLAENYYED* |
| EsTDRAFT_10007002 | 3300000867 | Freshwater And Marine | MKIKLEVEIDTEKEQDLNTIEEVVAILKELADNYQEE* |
| OpTDRAFT_100062633 | 3300000928 | Freshwater And Marine | SENKMKIKMEVEIDTDNNQDLNTIEELIAMLRNLAENYYEE* |
| OpTDRAFT_100199273 | 3300000928 | Freshwater And Marine | MKIKFEAEIDTENAQDLNTIEELITLLRELADNYIED* |
| OpTDRAFT_101388892 | 3300000928 | Freshwater And Marine | MKIKMEVEIDTDNDQDLNTIEELIAMLRNLAENYYEE* |
| NpDRAFT_100679384 | 3300000929 | Freshwater And Marine | ENKMKIKFEAEIDTDNEQDLNTIEELISMLKQLAENYYEE* |
| BBAY92_101804362 | 3300000947 | Macroalgal Surface | MKIKLEIEIDTESEHDLDTIEELIEMLKQLAENMQ* |
| M2t6BS2_10960093 | 3300002132 | Marine | VKIKLEVEVDTDNQDDLNTIEQLIEMLKGLVEQMQ* |
| M2t6BS2_12432085 | 3300002132 | Marine | MKIKLEVEIDTESEQDLNTIEELIELLKGLSEQMQ* |
| M2t2FKB2_18081559 | 3300002140 | Marine | MKIKLEVEIDTESEQDLNTIEELIDLLKGLAEQMR* |
| JGI26079J46598_10051743 | 3300003216 | Marine | LTSENNVKIKLEIEIDTENEQDLNTIEEVIEKLKELAEMMR* |
| JGI26079J46598_10058902 | 3300003216 | Marine | LTSENKMKIKLEIEIDTESEQDLNTIEEVIEKLVELKEIMNEI* |
| JGI26079J46598_10205212 | 3300003216 | Marine | LTLETKMKIKLEVEIDTESQQDLNTIEEIIELLKGLAEQMR* |
| JGI26079J46598_10441162 | 3300003216 | Marine | LISENNMKIKMEVEIDTDNDQDLNTIEELITMLRQLAENYYEE* |
| JGI26079J46598_10730242 | 3300003216 | Marine | LISENKVKIKLEIEIDTENEQDLNTIEEVIEKLRELKEMME* |
| JGI26080J50196_10198554 | 3300003345 | Marine | LNSETNMKIKVELEIDTESQQDLNTIEELIEKLKELVEYMQ* |
| JGI26081J50195_10211982 | 3300003346 | Marine | LTLETKMKIKVEVEIDTDNADDLNTIEELIAMLKQLAGQMK* |
| JGI26088J50261_10037165 | 3300003409 | Marine | LTLESDMKIKLEIEIDTESEQDLNTIEELIEKLKELAEDMQ* |
| JGI26088J50261_10316963 | 3300003409 | Marine | LTLETEMKIKVEVEIDTENDHDLNTIEELIEMLKQLAARMQE* |
| JGI26086J50260_10258462 | 3300003410 | Marine | LTSENKVKIKIELEIDTENEQDLNTIEEVIEKLKELAEMMR* |
| JGI26084J50262_11123432 | 3300003427 | Marine | LTLENNMKIKIELEIDTENQQDLNTIEEVIEKLVELKEMLE* |
| JGI26084J50262_11164491 | 3300003427 | Marine | LTLETKMKIKVEVEIDTDNEDDLNTIEQLIEMLKQLAGKMK* |
| NAP4_10604592 | 3300003474 | Estuarine | LEVKMKIKMEVEIDTENTQDLNTIEELIAVLRNLAESYYEE* |
| JGI26246J51724_10251012 | 3300003592 | Marine | LENKMKIKFEAEIDTDNEQDLNTIEELISMLRQLAENYYEE* |
| JGI26246J51724_10870362 | 3300003592 | Marine | LISENKMKIKMEVEIDTDNNQDLNTIEELIAMLRNLAENYYED* |
| JGI26246J51724_10885022 | 3300003592 | Marine | LISENKMKIKFEAEIDTDNEQDLNTIEELISMLKQLAENYYEE* |
| JGI26273J51734_100250242 | 3300003620 | Marine | LNLETKMKIKFEAEIDTENAQDLNTIEELIAMLRNLAENYYEE* |
| JGI26273J51734_101503221 | 3300003620 | Marine | LILENKMKIKFEAEIDTDNEQDLNTIEELISMLXQLAEXYYEE* |
| Ga0055584_1009949972 | 3300004097 | Pelagic Marine | LISETKMKIKMEVEIDTENNQDLNTIEELIAMLRNLAENYYEE* |
| Ga0055584_1012745532 | 3300004097 | Pelagic Marine | LNSENKVKIKLEIEIDTENEQDLNTIEEVIEKLRELKEMMG* |
| Ga0055584_1014545171 | 3300004097 | Pelagic Marine | LILENKMKIKMEVEIDTDNSQDLNTIEELIAMLKQLAENYYEE* |
| Ga0049083_101815802 | 3300005580 | Freshwater Lentic | MKIKIEVEIDTALQSDLDTIEELIAMLKELAERMQ** |
| Ga0049082_103311652 | 3300005584 | Freshwater Lentic | NMKIKIEVEIDTALQSDLDTIEELIAMLKELAERMQ* |
| Ga0078893_101974852 | 3300005837 | Marine Surface Water | LISETKMKIKFEAEIDTENTQDLNTIEELIALLRNLAENYYEE* |
| Ga0075109_10037963 | 3300005912 | Saline Lake | VKIKIEIEIDTENEQDLNTIEEVIKKLRELKEMMG* |
| Ga0075109_10089512 | 3300005912 | Saline Lake | LTLESKMKIKLEIEIDTENEQDLNTIEELMEKLRELKELMYE* |
| Ga0075108_100049228 | 3300005913 | Saline Lake | MKIKLEIEIDTENEQDLNTIEELMEKLRELKELMYE* |
| Ga0075119_10386132 | 3300005931 | Saline Lake | LTLETKMKIKLEIEIDTESDQDLNTIEELIEMLKGLVEQMQ* |
| Ga0070743_1000211913 | 3300005941 | Estuarine | MKIKFEAEIDTENAQDLNTIEELIAMLRNLAENYYEE* |
| Ga0070743_100044917 | 3300005941 | Estuarine | MKIKFEAEIDTDNEQDLNTIEELISMLRQLAENYYE |
| Ga0070743_100052666 | 3300005941 | Estuarine | MKIKMEVEIDTDNDQDLNTIEELIAMLRNLAENYYED* |
| Ga0070743_100080682 | 3300005941 | Estuarine | MKIKMEVEIDTDNDQDLNTIEELITMLRQLAENYYEE* |
| Ga0070743_100091483 | 3300005941 | Estuarine | MKIKMEVEIDTENDQDLNTIEELIAMLRNLAENYYEE* |
| Ga0070743_100191326 | 3300005941 | Estuarine | IKFEAEIDTDNEQDLNTIEELISMLKQLAENYYEE* |
| Ga0070743_100224121 | 3300005941 | Estuarine | LISENKMKIKFEAEIDTDNEQDLNTIEELISMLKQLA |
| Ga0075441_100067042 | 3300006164 | Marine | MKIKLEIEIDTENEQDLNTIEEIIEKLQELKESLS* |
| Ga0075441_100206173 | 3300006164 | Marine | MKIKLEIEIDTDNEQDRNTIEEIIQKLVELQEMME* |
| Ga0075441_100406494 | 3300006164 | Marine | MKIKLELEIDTENEQDLNTIEELIEKLRDLKELMNE* |
| Ga0075441_100496742 | 3300006164 | Marine | MKIKLEIEIDTESEHDLNTIEEIIEKLQELKESLS* |
| Ga0075441_100561523 | 3300006164 | Marine | LTLASNMKIKIEIEIDTESEHDLNTIDEIIENLQKLTENIE* |
| Ga0075441_101080654 | 3300006164 | Marine | MKIKIEVEIDTESEQDLNTIEEIVEKLQDLAEIFHTTD* |
| Ga0075441_102246183 | 3300006164 | Marine | MKIKLEIEIDTENEQDLNTIEELIEKLRELKEIIG* |
| Ga0075448_100297345 | 3300006352 | Marine | LTSESKMKIKLEIEIDTENEQDLNTIEELMEKLRELKELMYE* |
| Ga0075448_102643722 | 3300006352 | Marine | MKIKLEIEIDTENEQDLNTIEELMEKLRELKELMYK* |
| Ga0098048_10043852 | 3300006752 | Marine | MKIKMEVEIDTENNQDLNTIEELIAMLRNLAENYYEE* |
| Ga0098048_10107282 | 3300006752 | Marine | MKIKFEAEIDTENDQDLNTIEELIRLLRELADNYNEE* |
| Ga0098048_10295693 | 3300006752 | Marine | MKIKFEAEIDTENDQDLNTIEELIALLRELADNYSDE* |
| Ga0098048_10443152 | 3300006752 | Marine | MKVKVEVEIDTDNNQDLNTIEELIAMLRSLAENYYED* |
| Ga0098048_11542902 | 3300006752 | Marine | MKIKLEIEIDTENDQDLNTIEEIIEKLRELKEVIECE* |
| Ga0098055_10364872 | 3300006793 | Marine | LISETKMKIKLEMEIDTDNGQDLNTIEELIAMLRSLAENYYED* |
| Ga0098055_11875362 | 3300006793 | Marine | MKIKLEIEIDTENDQDLNTIEEIIEKLRELKEVIECE |
| Ga0075481_102585412 | 3300006868 | Aqueous | MKIKMEVEIDTDNSQDLNTIEELIAMLKQLAENYYEE* |
| Ga0075477_100366873 | 3300006869 | Aqueous | MKIKFEVEIDTESEHDLNTIEELIEMLKELAERMK* |
| Ga0075479_101941751 | 3300006870 | Aqueous | KMKIKMEVEIDTDNSQDLNTIEELIAMLKQLAENYYEE* |
| Ga0098045_10098442 | 3300006922 | Marine | LISENNMKVKVEVEIDTDNNQDLNTIEELIAMLRSLAENYYED* |
| Ga0098045_10735552 | 3300006922 | Marine | LENKMKIKFEAEIDTENDQDLNTIEELIRLLRELADNYNEE* |
| Ga0075444_100271742 | 3300006947 | Marine | MKIKIEIEIDTESEHDLNTIDEIIENLQKLTENIE* |
| Ga0075468_100044498 | 3300007229 | Aqueous | VKIKLEIEIDTENDQDLNTIEEVIEKLRELKEMME* |
| Ga0075468_100225183 | 3300007229 | Aqueous | MKIKLEIEIDTESEQDLNTIEEVIEKLQDLAEIMNEI* |
| Ga0075469_100328941 | 3300007231 | Aqueous | VKIKLEIEIDTENEQDLNTIEEVIEKLRELKEMMG* |
| Ga0105050_100330617 | 3300007516 | Freshwater | MKIKLEIEIDTESDQDLNTIEELIKMLKGLVEQMQ* |
| Ga0105050_105870692 | 3300007516 | Freshwater | MKIKLEVEIDTESNQDLNTIEELIEMLKGLAEQMR* |
| Ga0105055_100675332 | 3300007519 | Freshwater | MKIKLEIEIDTESDQDLNTIEELIEMLKGLAEQMR* |
| Ga0105053_100001684 | 3300007522 | Freshwater | MKIKLEIEIDTESDQDLNTIEELIEMLKGLVEQMQ* |
| Ga0099847_11640071 | 3300007540 | Aqueous | CLNSETNMKIKVEVEIDTENDQDLNTIEELIEKLRELKEMME* |
| Ga0102820_10170015 | 3300007554 | Estuarine | VCLISENKMKIKFEAEIDTDNEQDLNTIEELISMLKQLAENYYEE* |
| Ga0102820_10416321 | 3300007554 | Estuarine | KMKIKFEAEIDTDNEQDLNTIEELIAMLKQLAENYYEE* |
| Ga0102821_10992493 | 3300007557 | Estuarine | VVCLISENNMKIKMEVEIDTDNDQDLNTIEELITMLRQLAENYYEE* |
| Ga0102821_11625482 | 3300007557 | Estuarine | VKIKLEIEIDTENEQDLNTIEEVIEKLRELKEMME* |
| Ga0102822_10370064 | 3300007558 | Estuarine | MKIKFEAEIDTDNEQDLNTIEELIAMLKQLAENYYEE* |
| Ga0102822_10516312 | 3300007558 | Estuarine | MKIKFEAEIDTENAHDLNTIEELIAMLRNLAENYYEE* |
| Ga0102945_10052963 | 3300007609 | Pond Water | MKIKIEIEIDTESEQDLNTIEELIEKLKDLAEYMNKCEY* |
| Ga0102868_10666802 | 3300007653 | Estuarine | MKIKFEAEIDTDNNQDLNTIEELIAMLRNLAENYYEE* |
| Ga0102827_11195551 | 3300007715 | Estuarine | KMKIKFEAEIDTDNEQDLNTIEELISMLKQLAENYYEE* |
| Ga0102951_10537152 | 3300007725 | Water | MKIKVEVEIDTDNEDDLNTIEQLIEMLKQLAGKMK* |
| Ga0102951_11492872 | 3300007725 | Water | MKIKFEVEVDTENQHDLNTIEELIEMLKELAERMQK* |
| Ga0102960_10512933 | 3300009000 | Pond Water | MKLKVEIEIDTESEHDLNTIEELIEMLKELAERMK* |
| Ga0102960_12416711 | 3300009000 | Pond Water | GNFMKVKLEIEVDTESEQDVKTIEDLIEVLKKLIEKI* |
| Ga0102963_11629421 | 3300009001 | Pond Water | MKVKLEIEVDTESEQDVKTIEDLIEVLKKLIEKI* |
| Ga0102813_100155721 | 3300009003 | Estuarine | SENKMKIKFEAEIDTDNEQDLNTIEELISMLKQLAENYYEE* |
| Ga0102813_10293052 | 3300009003 | Estuarine | MKIKFEAEIDTENAQDLNTIEELIAMLRNLAENYYED* |
| Ga0102813_11767121 | 3300009003 | Estuarine | IKFEAEIDTDNEQDLNTIEELISMLRQLAENYYEE* |
| Ga0102911_10930362 | 3300009049 | Estuarine | MKIKMEVEIDTENDQDLNTIEELIAMLRNLAENYYED* |
| Ga0102886_10306484 | 3300009052 | Estuarine | MKIKFEAEIDTENAHDLNTIEELIAMLRNLAENYYED* |
| Ga0102814_101084631 | 3300009079 | Estuarine | KIKFEAEIDTDNEQDLNTIEELISMLKQLAENYYEE* |
| Ga0102814_106030532 | 3300009079 | Estuarine | MKIKLEVEIDTEKEQDLNNIEEVVAILKELADNYQEE* |
| Ga0102815_100457961 | 3300009080 | Estuarine | KFEAEIDTDNEQDLNTIEELISMLKQLAENYYEE* |
| Ga0102815_108400442 | 3300009080 | Estuarine | MKIKLEIEIDTENEQDLNTIEEVIEKLRELKEMME* |
| Ga0102812_101098612 | 3300009086 | Estuarine | MKIKLEIEIVTENEQDLNTIEEVIEKLRELKEMME* |
| Ga0102812_103950821 | 3300009086 | Estuarine | NKMKIKFEAEIDTDNEQDLNTIEELISMLRQLAENYYEE* |
| Ga0114995_1000420016 | 3300009172 | Marine | VNKMKIKLEIEIDTENEQDLNTIEEIIEKLRELKEIM* |
| Ga0114995_100055619 | 3300009172 | Marine | MKIKLEIEIDTENEQDLNTIEELMEKLRELKELMYESNY* |
| Ga0114995_100089339 | 3300009172 | Marine | LKIKIELEIDTEVEQDLNTIEELIEKLRELAEYME* |
| Ga0114995_100129565 | 3300009172 | Marine | MKIKLEIEIDTENEQDLNTIEEVIEKITELKELMHESTD* |
| Ga0114995_100193534 | 3300009172 | Marine | MKIKIEIEIDTESEHDLNTIDEIIEKLQELTENIK* |
| Ga0114995_100259325 | 3300009172 | Marine | MKIKIEIEIDTENKQDLNTIEEVIKKLTEIAEMME* |
| Ga0114995_101344373 | 3300009172 | Marine | VKIKVEVEIDTDNTDDLNTIEQLIEMLKQLAGQMQ* |
| Ga0114995_102732782 | 3300009172 | Marine | MKIKIELEIDTESEQDLSTIEELIEALKRLSEYIE* |
| Ga0114993_111568151 | 3300009409 | Marine | NMKIKLEIEIDTENEQDLNTIEEVIEKITELKELMHESTD* |
| Ga0114994_100102797 | 3300009420 | Marine | MKIKIEVEIDTEVEDDLNTIEQLIEALKELAGKLK* |
| Ga0114994_100489302 | 3300009420 | Marine | MRIKVEAEIDTDNANDLNTIEELIQLLRSLAENYED* |
| Ga0114994_103537381 | 3300009420 | Marine | MKIKLEIEIDTENEQDLNTIEEVIEKLRELKELMYE* |
| Ga0114994_106217134 | 3300009420 | Marine | YCKLRQNMKIKLEIEIDTENEQDLNTIEEVIEKITELKELMYESTD* |
| Ga0114994_106707202 | 3300009420 | Marine | MKIKLEIEIDTENEQDLNTIEELMEKLRELKETLE* |
| Ga0114997_102839432 | 3300009425 | Marine | VNKMKIKLEIEIDTENEQDLNTIEELMEKLRELKELMYE* |
| Ga0115008_100051435 | 3300009436 | Marine | MKIKFEAEIDTDNEQDLNTIEELISMLKKLAENYYEE* |
| Ga0115008_100125669 | 3300009436 | Marine | MKIKLEIEIDTENEQDLNTIEEVIEKLVELKEMMNEI* |
| Ga0115008_100286078 | 3300009436 | Marine | MKIKLEVEIDTEKEQDLNTIEEVVAILKELADNYREE* |
| Ga0115008_100921972 | 3300009436 | Marine | MKIKMEVEIDTENNQDLNTIEELIAMLKNLAENYYEE* |
| Ga0115008_101154362 | 3300009436 | Marine | MKIKLEIEIDTENEQDLNTIEEVIEKLRDLKEMME* |
| Ga0115008_101204472 | 3300009436 | Marine | MKIKVELDIDTENSQDLDTIEELISMLRQLAESYED* |
| Ga0115008_101694754 | 3300009436 | Marine | MKIKLEIEIDTESEQDLNTIEEVIEKITELKELMYESTN* |
| Ga0115008_101856401 | 3300009436 | Marine | IKFEAEIDTENDQDLNTIEELITLLKQLAENYYEE* |
| Ga0115008_102812532 | 3300009436 | Marine | MKIKFEAEIDTDNEQDLNTIEELIAMLRKLAENYYEE* |
| Ga0115007_103381003 | 3300009441 | Marine | VKIKLEIEIDTENEQDLNTIEEVIEKLRELKETME* |
| Ga0115007_104863271 | 3300009441 | Marine | MKIKLEIEIDTESEQDLNTIEEVIEKITELKELMHESTD* |
| Ga0115565_104661212 | 3300009467 | Pelagic Marine | VKIKLEIEIDTENEQDLNIIEEVIEKLRELKEMME* |
| Ga0115571_11305692 | 3300009495 | Pelagic Marine | MKIKVEAEIDTDNANDLNTIEELIQLLRSLAENYED* |
| Ga0115571_12433812 | 3300009495 | Pelagic Marine | VCLISETKMKIKFEAEIDTENTQDLNTIEELIALLKNLAENYYEE* |
| Ga0115570_102740232 | 3300009496 | Pelagic Marine | MKIKMEVEIDTDNDQDLNTIEELIAMLRALADNYLDE* |
| Ga0115572_101882204 | 3300009507 | Pelagic Marine | MKIKMEVEIDTDNDQDLNTIEELIAMLKQLAENYYEE* |
| Ga0115572_102917371 | 3300009507 | Pelagic Marine | MKIKFEAEIDTENTQDLNTIEELIALLKNLAENYYEE* |
| Ga0115572_103105942 | 3300009507 | Pelagic Marine | MKIKVELDIDTENSQDLNTIEELISMLRQLAESYED* |
| Ga0115003_100477905 | 3300009512 | Marine | NKMKIKLEIEIDTENEQDLNTIEEIIEKLRELKEIM* |
| Ga0115003_104093922 | 3300009512 | Marine | MNMKIKLEIEIDTENEQDLNTIEEVIEKLRELKELMYE* |
| Ga0115004_100749173 | 3300009526 | Marine | MKIKLEIEIDTDNEQDLNTIEEVIEKITELKELMHESTD* |
| Ga0115006_105899592 | 3300009544 | Marine | MKIKLEIEIDTENEQDLNTIEELMEKLRELKELL* |
| Ga0098049_10597665 | 3300010149 | Marine | LLVCLILENKMKIKFEAEIDTENDQDLNTIEELIRLLRELADNYNEE* |
| Ga0098049_12837072 | 3300010149 | Marine | MKIKLEMEIDTDNGQDLNTIEELIAMLRSLAENYYED* |
| Ga0098056_11809441 | 3300010150 | Marine | MKIKMEVEIDTDNNQDLNTIEELIAMLRQLAESYEE* |
| Ga0129333_102398204 | 3300010354 | Freshwater To Marine Saline Gradient | MKIKIEVEVDTENDHDLNTIEELIQLLKELANKMKS* |
| Ga0138261_16333712 | 3300012418 | Polar Marine | MKIKLEIEIDTESEHDLNTSEEIIEKLQELKESLS* |
| Ga0129327_100403152 | 3300013010 | Freshwater To Marine Saline Gradient | MKIKVEVEIDTDNADDLNTIEELIEVLKQLAGQLK* |
| Ga0129327_102162802 | 3300013010 | Freshwater To Marine Saline Gradient | MKIKLEVELDTERDHDLNTIEELIEILKGLAEKMR* |
| Ga0129327_102738632 | 3300013010 | Freshwater To Marine Saline Gradient | VKIKLEIEIDTENQQDLNTIEELIEMLKQLAENMQ* |
| Ga0129327_103318261 | 3300013010 | Freshwater To Marine Saline Gradient | KENNMKIKVEAEIDTDNANDLNTIEELIQLLRSLAENYED* |
| Ga0129327_105325072 | 3300013010 | Freshwater To Marine Saline Gradient | VKIKVEVEIDTDNADDLNTIEELIEMLKQLAGQMK* |
| Ga0180120_100534112 | 3300017697 | Freshwater To Marine Saline Gradient | MKIKVEVEIDTDNADDLNTIEELIEVLKQLAGQLK |
| Ga0180120_100638172 | 3300017697 | Freshwater To Marine Saline Gradient | MKIKVEVEIDTENDQDLNTIEELIEKLRELKEMME |
| Ga0180120_100880002 | 3300017697 | Freshwater To Marine Saline Gradient | MKIKVELEIDTESQQDLNTIEELIEKLKELVEHMQ |
| Ga0180120_102287732 | 3300017697 | Freshwater To Marine Saline Gradient | MKIKLEVELDTESDHDLNTIEELIEILKGLAEKMR |
| Ga0180120_103598582 | 3300017697 | Freshwater To Marine Saline Gradient | MKLKVEVEIDTDNADDLNTIEELIEVLKQLAGQLK |
| Ga0181390_10373961 | 3300017719 | Seawater | TKMKIKLEMEIDTDNGQDLNTIEELIAMLRSLAENYYED |
| Ga0187219_11331362 | 3300017751 | Seawater | MKIKFEVEIDTNDNQDLNNIEELIAMLKELAENYYEE |
| Ga0181380_10627192 | 3300017782 | Seawater | MKIKFEAEIDTENAQDLNTIEELIAMLRDLAENYNEE |
| Ga0181379_12716942 | 3300017783 | Seawater | MKIKLEMEIDTDNGQDLNTIEELIAMLRNLAENYYED |
| Ga0181565_1000003194 | 3300017818 | Salt Marsh | MKVKMEIEIDTERDQDLATIRELIEMLRALAENYEVD |
| Ga0181565_100346052 | 3300017818 | Salt Marsh | MKVKLELEIDTDNSSDLNTIEELIAMLKELAERMHDE |
| Ga0181565_101952822 | 3300017818 | Salt Marsh | MKIKMEIEIDTERDQDLNTIQELIEMLKALAENYNFEG |
| Ga0181565_104041471 | 3300017818 | Salt Marsh | MKIKIEVEIDTDKQNDLQTIEELIAMLRQLAENYED |
| Ga0181552_100910122 | 3300017824 | Salt Marsh | MKVNIQVEIDTDNNQDLNTIEELIAMLRQLAENYEE |
| Ga0181552_102134491 | 3300017824 | Salt Marsh | MKIKVEVEIDTDNADDLNTIEELIEMLKQLAGQMK |
| Ga0181584_101046092 | 3300017949 | Salt Marsh | MKVKMEIEIDTERDQDLNTIQELIEMLKALAENYNFEG |
| Ga0181607_101518823 | 3300017950 | Salt Marsh | MKIKVEVEIDTEIEQDLNTIEELIAVLKQLAGQLK |
| Ga0181607_102958193 | 3300017950 | Salt Marsh | MKIKFEVEIDTESEHDLNTIEELIEMLKELAERMK |
| Ga0181607_104022462 | 3300017950 | Salt Marsh | MKIKVEVEIDTQNEHDLNTIEELIEMLKELAARMQE |
| Ga0181607_104396642 | 3300017950 | Salt Marsh | VKIKVEVEIDTDNADDLNTIEELIEMLKQLAGQLK |
| Ga0181577_105195442 | 3300017951 | Salt Marsh | MKIKMEIEIDTERDQDLNTIQELIEILKALAENYNFEG |
| Ga0181583_100283599 | 3300017952 | Salt Marsh | MKIKMEIEIDTERQQDLDTIQELIAMLKQLAENYNYED |
| Ga0181571_100724802 | 3300017957 | Salt Marsh | MKIKMEIEIDTERDQDLNTIQELIAMLKQLAENYEYED |
| Ga0181600_102076622 | 3300018036 | Salt Marsh | MKIKLEIEIDTENELDIHTIEELIEKLKQLAEYTT |
| Ga0181600_104112842 | 3300018036 | Salt Marsh | MKIKIEVEIDTESQQDLNTIEEVIEKLKELAEMMR |
| Ga0181600_104378472 | 3300018036 | Salt Marsh | MKVKLELEIDTENEHDLNTIEDLLELLQKLKDSMK |
| Ga0181572_107866072 | 3300018049 | Salt Marsh | MKVKMEIEIDTENNQDLNTIQELIDLLKQLAENYNYED |
| Ga0181560_105482673 | 3300018413 | Salt Marsh | LIVCLTLENKMKVNIQVEIDTDNNQDLNTIEELIAMLRQLAENYEE |
| Ga0181568_101656291 | 3300018428 | Salt Marsh | IKMEIEIDTERDQDLNTIQELIAMLKQLAENYEYED |
| Ga0181554_13136621 | 3300020052 | Salt Marsh | LETNVKIKVEVEIDTDNADDLNTIEELIEMLKQLAGQ |
| Ga0181595_104089952 | 3300020053 | Salt Marsh | MKIKVEVEIDTENEQDKHTIEELIEKLKELVEYMQ |
| Ga0181575_101160712 | 3300020055 | Salt Marsh | MKIKMEVEIDTDNSTDLNTIEELIAMLKQLAENYNYDEE |
| Ga0206131_100486614 | 3300020185 | Seawater | MKIKVEAEIDTDNANDLNTIEELIQLLRSLAENYED |
| Ga0206131_101603162 | 3300020185 | Seawater | MKIKIEIEIDTENEQDLNTIEEVIEKLRELKEMME |
| Ga0206131_102214052 | 3300020185 | Seawater | VKIKLEIEIDTENEQDLNTIEEVIEKLRELKEMME |
| Ga0181604_100323182 | 3300020191 | Salt Marsh | MKIKFEVEINTESEHDLNTIEELIEMLKELAERMK |
| Ga0211685_10070452 | 3300020253 | Marine | MKIKLEIEIDTESEHDLNTIEEIIEKLQELKESLS |
| Ga0211519_10004326 | 3300020266 | Marine | MKIKMEVEIDTENTQDLNTIEELIAVLRNLAESYYEE |
| Ga0211510_10801951 | 3300020336 | Marine | KMKINVQVEIDTENNQDLNTIEELIAMLRQLAEMYEE |
| Ga0211504_10363552 | 3300020347 | Marine | MKVKVEVEIDTDNNQDLNTIEELIAMLRNLAENYYED |
| Ga0211504_11345972 | 3300020347 | Marine | MKIKLEIEIDTESQQDLNTVEELIEKLRELKEIME |
| Ga0211505_10081365 | 3300020352 | Marine | MKIKFEAEIDTENDQDLNTIEELIRLLRELADNYIEE |
| Ga0211686_100265551 | 3300020382 | Marine | TNMKIKLEIEIDTENEQDLNTIEELIEKLRELKEIIG |
| Ga0211518_100206382 | 3300020440 | Marine | MKINVQVEIDTENNQDLNTIEELIAMLRQLAEMYEE |
| Ga0206677_100373584 | 3300021085 | Seawater | MKIKMEVEIDTDNNQDLNTIEELIAMLRNLAENYYEE |
| Ga0206677_103874182 | 3300021085 | Seawater | MKIKFEAEIDTENAQDLNTIEELIAMLRNLAENYYEE |
| Ga0213860_100088597 | 3300021368 | Seawater | MKVKMEIEIDTERDQDLNTIQELIAMLKQLAENYYED |
| Ga0213865_100056182 | 3300021373 | Seawater | MKIKMEVEIDTDNSQDLNTIEELIAMLRQLAENYYEE |
| Ga0213864_105233763 | 3300021379 | Seawater | YSISETKMKIKMEIEIDTERDQDLNTIQELIAMLKQLAENYEYED |
| Ga0213920_10885012 | 3300021438 | Freshwater | MKIKVEVEIDTSEPSDLDTIEQLIEMLRELAAKMQN |
| Ga0194048_1000047410 | 3300021519 | Anoxic Zone Freshwater | MKIKVEVEIDTAEQSDLDTIEELIAMLKELAERMR |
| Ga0222717_100030285 | 3300021957 | Estuarine Water | MKIKFEAEIDTENAQDLNTIEELITLLRELADNYIED |
| Ga0222717_100871122 | 3300021957 | Estuarine Water | MKIKMEVEIDTDNNQDLNTIEELIAMLRNLAENYYED |
| Ga0222717_104284412 | 3300021957 | Estuarine Water | MKIKFEAEIDTDNEQDLNTIEELISMLRQLAENYYEE |
| Ga0222716_1000000298 | 3300021959 | Estuarine Water | MKVKVEIEIDTESEHDLNTIEELIEMLKQLAENIK |
| Ga0222716_106121822 | 3300021959 | Estuarine Water | MKLKVEIEIDTESEHDLNTIEELIEMLKELAERMQ |
| Ga0222715_100573745 | 3300021960 | Estuarine Water | MKLKVEIEIDTESEHDLNTIEELIEMLKELAERMK |
| Ga0222715_101032964 | 3300021960 | Estuarine Water | MKIKVEAEIDTDNAKDLNTIEELIELLRSLAENYED |
| Ga0222719_1000351717 | 3300021964 | Estuarine Water | MKIKFEVEVDTENQHDLNTIEELIEMLKELAERMQK |
| Ga0222719_104007552 | 3300021964 | Estuarine Water | MKIKVEVEIDTENDHDLNTIEELIEMLKQLAARMQE |
| Ga0222719_106797462 | 3300021964 | Estuarine Water | MKIKVEVEIDTENQHDLNTIEELIEMLKELAARMQE |
| Ga0222719_107035802 | 3300021964 | Estuarine Water | MKVKLELEIDTDNANDLNTIEELIEMLKQLALRIEEGED |
| Ga0196887_11069412 | 3300022178 | Aqueous | VKIKLEIEIDTENDQDLNTIEEVIEKLRELKEMME |
| Ga0222646_1083122 | 3300022822 | Saline Water | MKIKLEIEIDTESDQDLNTIEELIEMLKGLVEQMQ |
| Ga0222646_1250283 | 3300022822 | Saline Water | MKIKLEIEIDTENEQDLNTIEELMEKLRELKELMYE |
| Ga0255771_10878372 | 3300022900 | Salt Marsh | VKIKVEVEIDTDNADDLNTIEELIEMLKQLAGQMK |
| Ga0255753_13461491 | 3300022926 | Salt Marsh | MKIKVEVEIDTDNNDDLNTIEELIAVLKQLAGQLK |
| Ga0255770_104216183 | 3300022937 | Salt Marsh | IKMEIEIDTERQQDLDTIQELIAMLKQLAENYNYED |
| Ga0255764_100008409 | 3300023081 | Salt Marsh | MKVKMEIEIDTERDQDLNTIQELIEILKALAENYNFEG |
| (restricted) Ga0233432_1000003989 | 3300023109 | Seawater | MKVKLEIEIDTENEQDLNTIEEVIEKLKQLKDQLYYEDEE |
| (restricted) Ga0233432_1000468217 | 3300023109 | Seawater | MKIKFEAEIDTDNEQDLNTIEELISMLKQLAENYYEE |
| (restricted) Ga0233432_100119542 | 3300023109 | Seawater | MKIKMEVEIDTDNDQDLNTIEELITMLRQLAENYYEE |
| Ga0255762_100676132 | 3300023119 | Salt Marsh | MEVEIDTDNSTDLNTIEELIAMLKQLAENYNYDEE |
| Ga0228636_10359004 | 3300024191 | Seawater | MKVNIQLEIDTDNSQDLNTIEELIAMLRQLAENYED |
| Ga0228655_10228283 | 3300024236 | Seawater | MKIKFEAEIDTENTQDLNTIEELIALLKNLADNYYEE |
| (restricted) Ga0233438_102003482 | 3300024255 | Seawater | MKIKLEVEIDTEKEQDLNTIEEVVAILKELADNYQEE |
| Ga0228623_10821561 | 3300024267 | Seawater | IACLTLENKMKVNIQLEIDTDNSQDLNTIEELIAMLRQLAENYED |
| Ga0228629_11438041 | 3300024296 | Seawater | CLILETKMKIKFEAEIDTENAQDLNTIEELIAMLRNLAENYYEE |
| Ga0228631_10590872 | 3300024329 | Seawater | MKIKMEVEIDTDNNQDLNTIEELIAMLRQLAENYED |
| Ga0244777_100854854 | 3300024343 | Estuarine | MKIKMEVEIDTDNDQDLNTIEELIAMLRNLAENYYED |
| Ga0244777_102266212 | 3300024343 | Estuarine | MKIKFEAEIDTENAHDLNTIEELIAMLRNLAENYYEE |
| Ga0244775_100572914 | 3300024346 | Estuarine | MKIKMEVEIDTENDQDLNTIEELIAMLRNLAENYYEE |
| Ga0244775_105107592 | 3300024346 | Estuarine | MKIKVEVEIDTDNKDDLNTIEQLIEMLKQLATKIQ |
| Ga0208667_100100620 | 3300025070 | Marine | MKIKLEMEIDTDNGQDLNTIEELIAMLRSLAENYYED |
| Ga0208667_10108372 | 3300025070 | Marine | MKIKMEVEIDTENNQDLNTIEELIAMLRNLAENYYEE |
| Ga0208667_10284562 | 3300025070 | Marine | MKIKFEAEIDTENDQDLNTIEELIRLLRELADNYNEE |
| Ga0208791_10060862 | 3300025083 | Marine | MKVKVEVEIDTDNNQDLNTIEELIAMLRSLAENYYED |
| Ga0208792_10602442 | 3300025085 | Marine | MKIKFEAEIDTENDQDLNTIEELIALLRELADNYSDE |
| Ga0208793_11472601 | 3300025108 | Marine | NMKVKVEVEIDTDNNQDLNTIEELIAMLRSLAENYYED |
| Ga0208814_100083512 | 3300025276 | Deep Ocean | MKIKLEIEIDTENEQDLNTIEELIEKLRELKEIIG |
| Ga0208814_10117822 | 3300025276 | Deep Ocean | MKIKLEIEIDTENEQDLNTIEELMEKLRELKELMYK |
| Ga0208814_10268134 | 3300025276 | Deep Ocean | MKIKLEIEIDTENEQDLNTIEEIIEKLQELKESLS |
| Ga0208814_10318112 | 3300025276 | Deep Ocean | MKIKLEIEIDTENEQDLSTIEELIEKLRELKESLC |
| Ga0208814_10408452 | 3300025276 | Deep Ocean | MKIKLELEIDTENEQDLNTIEELIEKLRDLKELMNE |
| Ga0208814_10941502 | 3300025276 | Deep Ocean | MKIKIEIEIDTESEHDLNTIDEIIENLQKLTENIE |
| Ga0208903_10031298 | 3300025502 | Saline Lake | VKIKIEIEIDTENEQDLNTIEEVIKKLRELKEMMG |
| Ga0208660_10172363 | 3300025570 | Aqueous | MKIKLEIEIDTESEQDLNTIEEVIEKLQDLAEIMNEI |
| Ga0208660_10894412 | 3300025570 | Aqueous | VKIKLEIEIDTENEQDLNTIEEVIEKLRELKEMMG |
| Ga0209654_100011316 | 3300025608 | Marine | LTLESDMKIKLEIEIDTESEQDLNTIEELIEKLKELAEDMQ |
| Ga0209654_10252832 | 3300025608 | Marine | MKVKLELEIDTENTNDLNTIEELIAMLRELAERMQEE |
| Ga0209138_100005017 | 3300025617 | Marine | MKIKLEIEIDTESEQDLNTIEELIEKLKELAEDMQ |
| Ga0209138_100594813 | 3300025617 | Marine | VKIKIELEIDTENEQDLNTIEEVIEKLKELAEMMR |
| Ga0209138_10141117 | 3300025617 | Marine | MKIKVELEIDTESQQDLNTIEELIEKLKELVEYMQ |
| Ga0209138_10354382 | 3300025617 | Marine | MKIKLEVEIDTESQQDLNTIEEIIELLKGLAEQMR |
| Ga0209716_11706322 | 3300025626 | Pelagic Marine | CLNSENKVKIKLEIEIDTENEQDLNTIEEVIEKLRELKEMME |
| Ga0209136_100069312 | 3300025636 | Marine | MKIKLEIEIDTESEQDLNTIEEVIEKLVELKEIMNEI |
| Ga0209136_10014803 | 3300025636 | Marine | VKIKLEIEIDTENEQDLNTIEEVIEKLKELAEMMR |
| Ga0209136_10088143 | 3300025636 | Marine | MKIKIEVEIDTENENDLNTIEELIKKLQNLVEYME |
| Ga0209136_10554802 | 3300025636 | Marine | VKIKLEIEIDTENEQDLNTIEEVIEKLRELKEMIG |
| Ga0209136_11050084 | 3300025636 | Marine | ENKMKIKFEAEIDTDNEQDLNTIEELISMLRQLAENYYEE |
| Ga0209136_11106143 | 3300025636 | Marine | LENKVKIKLEIEIDTENEQDLNTIEELIEKLRELKEMMQ |
| Ga0209659_100287614 | 3300025658 | Marine | LISENKMKIKFEAEIDTDNEQDLNTIEELISMLKQLAEN |
| Ga0209659_11792191 | 3300025658 | Marine | ETSSMKIKIEIEIDTENEQDLNTIEEVIEKLRELKEMME |
| Ga0209652_10544604 | 3300025684 | Marine | MKIKVEVEIDTDNADDLNTIEELIAMLKQLAGQMK |
| Ga0209653_10826192 | 3300025695 | Marine | MKVKLEVEIDTESEHDLNTIEELIEMLKELAARMQ |
| Ga0209653_11571082 | 3300025695 | Marine | MKIKVEVEIDTDNTDDLNTIEELIEMLKQLAGQMK |
| Ga0209653_11617012 | 3300025695 | Marine | MKIKVEVEIDTDNEDDLNTIEQLIEMLKQLAGKMK |
| Ga0209137_10304862 | 3300025767 | Marine | LTLENNMKIKIELEIDTENQQDLNTIEEVIEKLVELKEMLE |
| Ga0209603_11363522 | 3300025849 | Pelagic Marine | MKIKMEVEIDTDNDQDLNTIEELIAMLKQLAENYYEE |
| Ga0209603_12740762 | 3300025849 | Pelagic Marine | MKIKVELDIDTENSQDLNTIEELISMLRQLAESYED |
| Ga0209666_10064131 | 3300025870 | Marine | KIKFEAEIDTENAQDLNTIEELIAMLRNLAENYYEE |
| Ga0209666_10269704 | 3300025870 | Marine | MKIKFEAEIDTENAQDLNTIEELIAMLRNLAENYNEE |
| Ga0209666_10433875 | 3300025870 | Marine | ISENKMKIKMEVEIDTDNNQDLNTIEELIAMLRNLAENYYED |
| Ga0209953_10121993 | 3300026097 | Pond Water | KIKIEIEIDTESEQDLNTIEELIEKLKDLAEYMNKCEY |
| Ga0228620_10074642 | 3300026483 | Seawater | MKIKFEAEIDTENDQDLNTIEELIAMLRALADNYLDE |
| Ga0208950_10899801 | 3300027413 | Marine | KIKLEVEIDTEKEQDLNTIEEVVAILKELADNYQEE |
| Ga0209037_100059210 | 3300027612 | Marine | VKIKIELEIDTESKQDLNTIEEVIEKLKELAEMMR |
| Ga0209037_10011607 | 3300027612 | Marine | MKIKVEVEIDTDNTDDLNTIEQLIEMLKQLAGQMK |
| Ga0208951_11166442 | 3300027621 | Freshwater Lentic | MKIKIEVEIDTALQSDLDTIEELIAMLKELAERMQX |
| Ga0209710_10005585 | 3300027687 | Marine | VNKMKIKLEIEIDTENEQDLNTIEEIIEKLRELKEIM |
| Ga0209710_10448606 | 3300027687 | Marine | MKIKLEIEIDTENEQDLNTIEELMEKLRELKELMYESNY |
| Ga0209710_11097522 | 3300027687 | Marine | MKIKIEIEIDTESEHDLNTIDEIIEKLQELTENIK |
| Ga0209816_10653305 | 3300027704 | Marine | NMKIKLEIEIDTENEQDLNTIEELIEKLRELKEIIG |
| Ga0208304_100269241 | 3300027751 | Estuarine | IKFEAEIDTDNEQDLNTIEELISMLRQLAENYYEE |
| Ga0209192_100043258 | 3300027752 | Marine | MKIKLEIEIDTDNEQDLNTIEEVIEKITELKELMHESTD |
| Ga0209192_100256295 | 3300027752 | Marine | MKIKIEIEIDTENKQDLNTIEEVIKKLTEIAEMME |
| Ga0209192_100943624 | 3300027752 | Marine | MRIKVEAEIDTDNANDLNTIEELIQLLRSLAENYED |
| Ga0209192_100957041 | 3300027752 | Marine | LKIKIELEIDTEVEQDLNTIEELIEKLRELAEYME |
| Ga0209192_101498822 | 3300027752 | Marine | MKIKIELEIDTESEQDLSTIEELIEALKRLSEYIE |
| Ga0208671_101064503 | 3300027757 | Estuarine | MKIKFEAEIDTENDQDLNTIEELIAMLRNLAENYYEE |
| Ga0209502_100381703 | 3300027780 | Marine | MKIKIEVEIDTEVEDDLNTIEQLIEALKELAGKLK |
| Ga0209502_103846262 | 3300027780 | Marine | MKIKLEIEIDTENEQDLNTIEEVIEKLRELKEMME |
| Ga0209711_100169701 | 3300027788 | Marine | KMKIKLEIEIDTENEQDLNTIEELMEKLRELKELMYESNY |
| Ga0209302_100030365 | 3300027810 | Marine | MKIKLEIEIDTENEQDLNTIEEVIEKITELKELMHESTD |
| Ga0209302_1000917010 | 3300027810 | Marine | VKIKLEIEIDTENEQDLNTIEEVIEKLRELKETME |
| Ga0209302_103448122 | 3300027810 | Marine | MKIKLEIEIDTESEQDLNTIEEVIEKITELKELMYESTD |
| Ga0209302_103888363 | 3300027810 | Marine | ESKMKIKLEIEIDTENEQDLNTIEELMEKLRELKELMYE |
| Ga0209491_1000719514 | 3300027832 | Freshwater | MKIKLEIEIDTESDQDLNTIEELIEMLKGLAEQMR |
| Ga0209092_1000032354 | 3300027833 | Marine | MKIKFEAEIDTDNEQDLNTIEELISMLKKLAENYYEE |
| Ga0209092_1000117932 | 3300027833 | Marine | MKIKLEIEIDTESEQDLNTIEEVIEKITELKELMYESTN |
| Ga0209092_100018944 | 3300027833 | Marine | MKIKLEIEIDTENEQDLNTIEEVIEKLVELKEMMNEI |
| Ga0209092_1000270411 | 3300027833 | Marine | MKIKLEVEIDTEKEQDLNTIEEVVAILKELADNYREE |
| Ga0209092_1000497412 | 3300027833 | Marine | MKIKFEAEIDTDNEQDLNTIEELIAMLRKLAENYYEE |
| Ga0209092_100166693 | 3300027833 | Marine | MKVKVELEIDTDNEQDLNTIEEVIKWLMQLKESME |
| Ga0209092_100717073 | 3300027833 | Marine | MKIKLEIEIDTENEQDLNTIEEVIEKLRDLKEMME |
| Ga0209092_100823712 | 3300027833 | Marine | MKIKMEVEIDTENNQDLNTIEELIAMLKNLAENYYEE |
| Ga0209092_100948342 | 3300027833 | Marine | MKIKVELDIDTENSQDLDTIEELISMLRQLAESYED |
| Ga0209702_1000812710 | 3300027976 | Freshwater | MKIKLEIEIDTESDQDLNTIEELIKMLKGLVEQMQ |
| Ga0308021_100009964 | 3300031141 | Marine | MKIKLEIEIDTENEQDLNTIEELIEKLRELKESLC |
| Ga0308025_10279245 | 3300031143 | Marine | TNMKIKIEVEIDTESEQDLNTIEEIVEKLQDLAEIFHTTD |
| Ga0308010_11141903 | 3300031510 | Marine | MKIKLEIEIDTENEQDLNTIEEVIEKITELKELMHESTN |
| Ga0307488_1000120414 | 3300031519 | Sackhole Brine | MKIKFEAEIDTENDQDLNTIEELITLLKQLAENYYEE |
| Ga0307488_100017609 | 3300031519 | Sackhole Brine | MKIKLEIEIDTESEQDLNTIEEVIEKITELKEIMYESTD |
| Ga0307488_100106814 | 3300031519 | Sackhole Brine | MKIKLEVEIDTESEQDLNTIEELIDLLKGLAEQMR |
| Ga0307488_100257802 | 3300031519 | Sackhole Brine | VGLEMKIKIEIEIDTENEQDLSAIEEVIEKLKELDYE |
| Ga0307488_100646613 | 3300031519 | Sackhole Brine | MFKMKIKLEVEVDTDNQDDLNTIEQLIEMLKGLVEQMR |
| Ga0307488_100875485 | 3300031519 | Sackhole Brine | MKIKLEIEIDTENEQDLNTIEELMEKLRELKETLE |
| Ga0307488_101883672 | 3300031519 | Sackhole Brine | MKIKLEIEIDTENEQDLNTIEEVIEKLRELKELMYE |
| Ga0307488_101927532 | 3300031519 | Sackhole Brine | MKIKLEIEIDTESQHDLNTIEELIEKLKELAEMIR |
| Ga0307488_102804022 | 3300031519 | Sackhole Brine | VKIKLEVEVDTDNQDDLNTIEQLIEMLKGLVEQMR |
| Ga0307492_100108226 | 3300031523 | Sea-Ice Brine | KIEVEIDTESEQDLNTIEEIVEKLQDLAEIFHTTD |
| Ga0307489_107078452 | 3300031569 | Sackhole Brine | MNMKIKLEIEIDTENEQDLNTIEEVIEKLRELKELMYE |
| Ga0302131_12233661 | 3300031594 | Marine | KMKIKLELEIDTENEQDLNTIEELIEKLRDLKELMNE |
| Ga0302121_100588531 | 3300031626 | Marine | LVNKMKIKLEIEIDTENEQDLNTIEEIIEKLRELKEIM |
| Ga0308005_100358835 | 3300031656 | Marine | ETNMKIKLEIEIDTENEQDLNTIEELMEKLRELKELMYE |
| Ga0308016_100286813 | 3300031695 | Marine | MKIKLEIEIDTENEQDLNTIEELMEKLRELKEIIG |
| Ga0307998_12502472 | 3300031702 | Marine | VVIRSKSMKIKLEIEIDTENEQDLNTIEEVIEKLQELAESIQ |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |