| Basic Information | |
|---|---|
| Family ID | F008378 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 334 |
| Average Sequence Length | 40 residues |
| Representative Sequence | PAPYGSVGVDINCAVIGFTAKAPTANLAEPAPNSQFPPR |
| Number of Associated Samples | 245 |
| Number of Associated Scaffolds | 334 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.20 % |
| % of genes near scaffold ends (potentially truncated) | 98.80 % |
| % of genes from short scaffolds (< 2000 bps) | 91.02 % |
| Associated GOLD sequencing projects | 228 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.20 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (84.132 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (16.168 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.545 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (41.916 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.20 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 334 Family Scaffolds |
|---|---|---|
| PF04248 | NTP_transf_9 | 9.58 |
| PF03358 | FMN_red | 5.09 |
| PF00578 | AhpC-TSA | 4.79 |
| PF03640 | Lipoprotein_15 | 2.69 |
| PF01227 | GTP_cyclohydroI | 2.40 |
| PF00196 | GerE | 1.80 |
| PF00106 | adh_short | 1.50 |
| PF04199 | Cyclase | 1.20 |
| PF07992 | Pyr_redox_2 | 1.20 |
| PF03176 | MMPL | 1.20 |
| PF13191 | AAA_16 | 0.90 |
| PF02518 | HATPase_c | 0.90 |
| PF03992 | ABM | 0.90 |
| PF04264 | YceI | 0.90 |
| PF00903 | Glyoxalase | 0.90 |
| PF13561 | adh_short_C2 | 0.90 |
| PF14224 | DUF4331 | 0.60 |
| PF00561 | Abhydrolase_1 | 0.60 |
| PF02467 | Whib | 0.60 |
| PF14534 | DUF4440 | 0.60 |
| PF04542 | Sigma70_r2 | 0.60 |
| PF00440 | TetR_N | 0.60 |
| PF01927 | Mut7-C | 0.60 |
| PF01145 | Band_7 | 0.60 |
| PF02627 | CMD | 0.60 |
| PF05988 | DUF899 | 0.30 |
| PF03965 | Penicillinase_R | 0.30 |
| PF03631 | Virul_fac_BrkB | 0.30 |
| PF00296 | Bac_luciferase | 0.30 |
| PF08125 | Mannitol_dh_C | 0.30 |
| PF11774 | Lsr2 | 0.30 |
| PF06689 | zf-C4_ClpX | 0.30 |
| PF13508 | Acetyltransf_7 | 0.30 |
| PF10282 | Lactonase | 0.30 |
| PF13683 | rve_3 | 0.30 |
| PF11716 | MDMPI_N | 0.30 |
| PF07883 | Cupin_2 | 0.30 |
| PF08240 | ADH_N | 0.30 |
| PF00202 | Aminotran_3 | 0.30 |
| PF07690 | MFS_1 | 0.30 |
| PF04185 | Phosphoesterase | 0.30 |
| PF09948 | DUF2182 | 0.30 |
| PF01915 | Glyco_hydro_3_C | 0.30 |
| PF03807 | F420_oxidored | 0.30 |
| PF03466 | LysR_substrate | 0.30 |
| PF00126 | HTH_1 | 0.30 |
| PF13490 | zf-HC2 | 0.30 |
| PF14104 | DUF4277 | 0.30 |
| PF00072 | Response_reg | 0.30 |
| PF06441 | EHN | 0.30 |
| PF06725 | 3D | 0.30 |
| PF02852 | Pyr_redox_dim | 0.30 |
| PF06736 | TMEM175 | 0.30 |
| PF06965 | Na_H_antiport_1 | 0.30 |
| PF00496 | SBP_bac_5 | 0.30 |
| PF08281 | Sigma70_r4_2 | 0.30 |
| PF12680 | SnoaL_2 | 0.30 |
| PF01569 | PAP2 | 0.30 |
| PF00107 | ADH_zinc_N | 0.30 |
| PF04964 | Flp_Fap | 0.30 |
| PF00892 | EamA | 0.30 |
| PF00486 | Trans_reg_C | 0.30 |
| PF01494 | FAD_binding_3 | 0.30 |
| PF03473 | MOSC | 0.30 |
| PF13280 | WYL | 0.30 |
| PF13177 | DNA_pol3_delta2 | 0.30 |
| PF05088 | Bac_GDH | 0.30 |
| PF00378 | ECH_1 | 0.30 |
| PF03372 | Exo_endo_phos | 0.30 |
| PF01135 | PCMT | 0.30 |
| COG ID | Name | Functional Category | % Frequency in 334 Family Scaffolds |
|---|---|---|---|
| COG2343 | Uncharacterized conserved protein, DUF427 family | Function unknown [S] | 9.58 |
| COG4315 | Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown) | Function unknown [S] | 2.69 |
| COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 1.20 |
| COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 1.20 |
| COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 1.20 |
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 0.90 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.60 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.60 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.60 |
| COG1656 | Uncharacterized conserved protein, contains PIN-related Mut7-C RNAse domain | General function prediction only [R] | 0.60 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.60 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.60 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 0.60 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.60 |
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.30 |
| COG0246 | Mannitol-1-phosphate/altronate dehydrogenases | Carbohydrate transport and metabolism [G] | 0.30 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.30 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.30 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.30 |
| COG3847 | Flp pilus assembly protein, pilin Flp | Extracellular structures [W] | 0.30 |
| COG3682 | Transcriptional regulator, CopY/TcrY family | Transcription [K] | 0.30 |
| COG3548 | Uncharacterized membrane protein | Function unknown [S] | 0.30 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.30 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.30 |
| COG2902 | NAD-specific glutamate dehydrogenase | Amino acid transport and metabolism [E] | 0.30 |
| COG2519 | tRNA A58 N-methylase Trm61 | Translation, ribosomal structure and biogenesis [J] | 0.30 |
| COG1472 | Periplasmic beta-glucosidase and related glycosidases | Carbohydrate transport and metabolism [G] | 0.30 |
| COG0596 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold | Coenzyme transport and metabolism [H] | 0.30 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.30 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.30 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.30 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.30 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.30 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.30 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 84.13 % |
| Unclassified | root | N/A | 15.87 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459005|F1BAP7Q02FQ7GY | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 539 | Open in IMG/M |
| 2209111022|2221208372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus opacus | 982 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c0739307 | All Organisms → cellular organisms → Bacteria | 1795 | Open in IMG/M |
| 3300000956|JGI10216J12902_101931269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2560 | Open in IMG/M |
| 3300000956|JGI10216J12902_105901866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 913 | Open in IMG/M |
| 3300000956|JGI10216J12902_106305644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 564 | Open in IMG/M |
| 3300000956|JGI10216J12902_111223541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_20CM_4_53_11 | 693 | Open in IMG/M |
| 3300001867|JGI12627J18819_10267156 | Not Available | 688 | Open in IMG/M |
| 3300002568|C688J35102_119340692 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300005183|Ga0068993_10054679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1173 | Open in IMG/M |
| 3300005434|Ga0070709_10000935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 16205 | Open in IMG/M |
| 3300005434|Ga0070709_11618717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_20CM_4_53_11 | 527 | Open in IMG/M |
| 3300005435|Ga0070714_101741649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 608 | Open in IMG/M |
| 3300005437|Ga0070710_10045152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2448 | Open in IMG/M |
| 3300005445|Ga0070708_101422668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 647 | Open in IMG/M |
| 3300005455|Ga0070663_100514652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_20CM_4_53_11 | 996 | Open in IMG/M |
| 3300005467|Ga0070706_100978111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium | 781 | Open in IMG/M |
| 3300005467|Ga0070706_101294682 | Not Available | 668 | Open in IMG/M |
| 3300005468|Ga0070707_100585111 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
| 3300005468|Ga0070707_101087448 | Not Available | 765 | Open in IMG/M |
| 3300005468|Ga0070707_101744678 | Not Available | 590 | Open in IMG/M |
| 3300005471|Ga0070698_100577927 | Not Available | 1064 | Open in IMG/M |
| 3300005471|Ga0070698_101737326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 576 | Open in IMG/M |
| 3300005471|Ga0070698_101968250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 537 | Open in IMG/M |
| 3300005518|Ga0070699_101848418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 553 | Open in IMG/M |
| 3300005526|Ga0073909_10672203 | Not Available | 517 | Open in IMG/M |
| 3300005534|Ga0070735_10368998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 861 | Open in IMG/M |
| 3300005535|Ga0070684_100993631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 787 | Open in IMG/M |
| 3300005540|Ga0066697_10636721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 588 | Open in IMG/M |
| 3300005542|Ga0070732_10573164 | Not Available | 685 | Open in IMG/M |
| 3300005556|Ga0066707_11022559 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 503 | Open in IMG/M |
| 3300005557|Ga0066704_10382782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 938 | Open in IMG/M |
| 3300005557|Ga0066704_10679242 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300005557|Ga0066704_10881975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 554 | Open in IMG/M |
| 3300005559|Ga0066700_10991767 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300005560|Ga0066670_10331878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 926 | Open in IMG/M |
| 3300005561|Ga0066699_11247573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus opacus | 510 | Open in IMG/M |
| 3300005575|Ga0066702_10729770 | Not Available | 590 | Open in IMG/M |
| 3300005576|Ga0066708_10317877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter | 998 | Open in IMG/M |
| 3300005616|Ga0068852_101893955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus opacus | 619 | Open in IMG/M |
| 3300005764|Ga0066903_101362655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1330 | Open in IMG/M |
| 3300005764|Ga0066903_105049643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 700 | Open in IMG/M |
| 3300005764|Ga0066903_106029570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 635 | Open in IMG/M |
| 3300005843|Ga0068860_102184334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus opacus | 574 | Open in IMG/M |
| 3300006028|Ga0070717_10184531 | All Organisms → cellular organisms → Bacteria | 1820 | Open in IMG/M |
| 3300006028|Ga0070717_10865843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 822 | Open in IMG/M |
| 3300006028|Ga0070717_11215797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 686 | Open in IMG/M |
| 3300006028|Ga0070717_11645167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 581 | Open in IMG/M |
| 3300006032|Ga0066696_10257205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1129 | Open in IMG/M |
| 3300006046|Ga0066652_102065725 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300006173|Ga0070716_100029508 | All Organisms → cellular organisms → Bacteria | 2966 | Open in IMG/M |
| 3300006175|Ga0070712_100296233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_20CM_4_53_11 | 1308 | Open in IMG/M |
| 3300006175|Ga0070712_100647539 | Not Available | 898 | Open in IMG/M |
| 3300006175|Ga0070712_101270735 | Not Available | 641 | Open in IMG/M |
| 3300006358|Ga0068871_100755306 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
| 3300006755|Ga0079222_10266572 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300006796|Ga0066665_11463065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 531 | Open in IMG/M |
| 3300006800|Ga0066660_11580401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 519 | Open in IMG/M |
| 3300006804|Ga0079221_10885422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 653 | Open in IMG/M |
| 3300006806|Ga0079220_10125799 | All Organisms → cellular organisms → Bacteria | 1374 | Open in IMG/M |
| 3300006844|Ga0075428_100367144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1544 | Open in IMG/M |
| 3300006852|Ga0075433_10106215 | All Organisms → cellular organisms → Bacteria | 2488 | Open in IMG/M |
| 3300006852|Ga0075433_11188993 | Not Available | 662 | Open in IMG/M |
| 3300006854|Ga0075425_100346358 | Not Available | 1711 | Open in IMG/M |
| 3300006854|Ga0075425_102100535 | Not Available | 630 | Open in IMG/M |
| 3300006871|Ga0075434_100456655 | All Organisms → cellular organisms → Bacteria | 1299 | Open in IMG/M |
| 3300006903|Ga0075426_10166591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1592 | Open in IMG/M |
| 3300006903|Ga0075426_10667751 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300006903|Ga0075426_11245032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_20CM_4_53_11 | 564 | Open in IMG/M |
| 3300006903|Ga0075426_11253589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_20CM_4_53_11 | 563 | Open in IMG/M |
| 3300006903|Ga0075426_11340865 | Not Available | 543 | Open in IMG/M |
| 3300006904|Ga0075424_100256751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1858 | Open in IMG/M |
| 3300006904|Ga0075424_101580029 | Not Available | 696 | Open in IMG/M |
| 3300006904|Ga0075424_102804649 | Not Available | 508 | Open in IMG/M |
| 3300006954|Ga0079219_10081020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1525 | Open in IMG/M |
| 3300009012|Ga0066710_100462703 | All Organisms → cellular organisms → Bacteria | 1904 | Open in IMG/M |
| 3300009038|Ga0099829_10767551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 801 | Open in IMG/M |
| 3300009038|Ga0099829_10837876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 763 | Open in IMG/M |
| 3300009088|Ga0099830_10834925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 761 | Open in IMG/M |
| 3300009090|Ga0099827_10296903 | All Organisms → cellular organisms → Bacteria | 1366 | Open in IMG/M |
| 3300009090|Ga0099827_10731971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus opacus | 855 | Open in IMG/M |
| 3300009090|Ga0099827_11316433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 629 | Open in IMG/M |
| 3300009100|Ga0075418_11803654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_20CM_4_53_11 | 665 | Open in IMG/M |
| 3300009137|Ga0066709_101345697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_20CM_4_53_11 | 1043 | Open in IMG/M |
| 3300009143|Ga0099792_10141444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1316 | Open in IMG/M |
| 3300009143|Ga0099792_10823102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_20CM_4_53_11 | 610 | Open in IMG/M |
| 3300009147|Ga0114129_10113101 | All Organisms → cellular organisms → Bacteria | 3744 | Open in IMG/M |
| 3300009147|Ga0114129_11657295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_20CM_4_53_11 | 781 | Open in IMG/M |
| 3300009147|Ga0114129_11727493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_20CM_4_53_11 | 763 | Open in IMG/M |
| 3300009162|Ga0075423_10539660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1228 | Open in IMG/M |
| 3300009162|Ga0075423_13212596 | Not Available | 501 | Open in IMG/M |
| 3300009174|Ga0105241_10927335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 810 | Open in IMG/M |
| 3300009174|Ga0105241_11025803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus opacus | 773 | Open in IMG/M |
| 3300009177|Ga0105248_10928715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Catellatospora | 983 | Open in IMG/M |
| 3300009522|Ga0116218_1161376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus opacus | 1016 | Open in IMG/M |
| 3300009698|Ga0116216_10149940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1434 | Open in IMG/M |
| 3300009698|Ga0116216_10774709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 575 | Open in IMG/M |
| 3300009792|Ga0126374_11343429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora ureilytica | 579 | Open in IMG/M |
| 3300009809|Ga0105089_1025388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 822 | Open in IMG/M |
| 3300009816|Ga0105076_1102816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → Candidatus Frankia alpina | 556 | Open in IMG/M |
| 3300010040|Ga0126308_11252535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 526 | Open in IMG/M |
| 3300010043|Ga0126380_11611708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 580 | Open in IMG/M |
| 3300010045|Ga0126311_10447148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1002 | Open in IMG/M |
| 3300010046|Ga0126384_11452885 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300010048|Ga0126373_12122858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_20CM_4_53_11 | 623 | Open in IMG/M |
| 3300010048|Ga0126373_12765653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 548 | Open in IMG/M |
| 3300010048|Ga0126373_12781554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora | 546 | Open in IMG/M |
| 3300010360|Ga0126372_11445977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora ureilytica | 721 | Open in IMG/M |
| 3300010360|Ga0126372_13067112 | Not Available | 518 | Open in IMG/M |
| 3300010361|Ga0126378_12111965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 642 | Open in IMG/M |
| 3300010371|Ga0134125_10388734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1547 | Open in IMG/M |
| 3300010371|Ga0134125_11551133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 721 | Open in IMG/M |
| 3300010373|Ga0134128_11050361 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 900 | Open in IMG/M |
| 3300010375|Ga0105239_11247584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 857 | Open in IMG/M |
| 3300010375|Ga0105239_12509061 | Not Available | 601 | Open in IMG/M |
| 3300010376|Ga0126381_102574597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 728 | Open in IMG/M |
| 3300010379|Ga0136449_101214939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus opacus | 1185 | Open in IMG/M |
| 3300010396|Ga0134126_12173982 | Not Available | 605 | Open in IMG/M |
| 3300010398|Ga0126383_13592443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_20CM_4_53_11 | 506 | Open in IMG/M |
| 3300010401|Ga0134121_10128538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2145 | Open in IMG/M |
| 3300010876|Ga0126361_10250680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 582 | Open in IMG/M |
| 3300011270|Ga0137391_10161628 | All Organisms → cellular organisms → Bacteria | 1952 | Open in IMG/M |
| 3300012045|Ga0136623_10040405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2028 | Open in IMG/M |
| 3300012096|Ga0137389_11833826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SG8_40 | 502 | Open in IMG/M |
| 3300012199|Ga0137383_10128405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidiferrimicrobium → unclassified Acidiferrimicrobium → Acidiferrimicrobium sp. IK | 1851 | Open in IMG/M |
| 3300012199|Ga0137383_10268011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Thermosporotrichaceae → Thermosporothrix | 1251 | Open in IMG/M |
| 3300012199|Ga0137383_10701686 | Not Available | 739 | Open in IMG/M |
| 3300012199|Ga0137383_11037637 | Not Available | 596 | Open in IMG/M |
| 3300012200|Ga0137382_10034084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3071 | Open in IMG/M |
| 3300012200|Ga0137382_10474700 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 887 | Open in IMG/M |
| 3300012200|Ga0137382_11303404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 513 | Open in IMG/M |
| 3300012201|Ga0137365_10025680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4548 | Open in IMG/M |
| 3300012201|Ga0137365_10164922 | All Organisms → cellular organisms → Bacteria | 1661 | Open in IMG/M |
| 3300012201|Ga0137365_10448620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Catellatospora | 950 | Open in IMG/M |
| 3300012202|Ga0137363_11736444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 517 | Open in IMG/M |
| 3300012203|Ga0137399_10497081 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
| 3300012204|Ga0137374_10344348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1204 | Open in IMG/M |
| 3300012206|Ga0137380_11609564 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300012207|Ga0137381_10914191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 758 | Open in IMG/M |
| 3300012209|Ga0137379_11508274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 573 | Open in IMG/M |
| 3300012209|Ga0137379_11515483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 571 | Open in IMG/M |
| 3300012210|Ga0137378_10195660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidiferrimicrobium → unclassified Acidiferrimicrobium → Acidiferrimicrobium sp. IK | 1881 | Open in IMG/M |
| 3300012210|Ga0137378_10961202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus opacus | 768 | Open in IMG/M |
| 3300012211|Ga0137377_10161773 | Not Available | 2147 | Open in IMG/M |
| 3300012211|Ga0137377_10345716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1424 | Open in IMG/M |
| 3300012211|Ga0137377_11267885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_20CM_4_53_11 | 667 | Open in IMG/M |
| 3300012211|Ga0137377_11270915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 666 | Open in IMG/M |
| 3300012212|Ga0150985_117928695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 511 | Open in IMG/M |
| 3300012350|Ga0137372_10661982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 760 | Open in IMG/M |
| 3300012351|Ga0137386_10060747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2624 | Open in IMG/M |
| 3300012351|Ga0137386_10283392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1192 | Open in IMG/M |
| 3300012356|Ga0137371_10151528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1818 | Open in IMG/M |
| 3300012357|Ga0137384_10705071 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300012358|Ga0137368_10082670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2554 | Open in IMG/M |
| 3300012358|Ga0137368_10222106 | All Organisms → cellular organisms → Bacteria | 1326 | Open in IMG/M |
| 3300012360|Ga0137375_11363899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 531 | Open in IMG/M |
| 3300012362|Ga0137361_10422244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1225 | Open in IMG/M |
| 3300012362|Ga0137361_10434921 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
| 3300012362|Ga0137361_11125720 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300012362|Ga0137361_11461645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 606 | Open in IMG/M |
| 3300012363|Ga0137390_11244216 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300012532|Ga0137373_10941631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 630 | Open in IMG/M |
| 3300012678|Ga0136615_10485757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → environmental samples → uncultured Acidimicrobiales bacterium | 531 | Open in IMG/M |
| 3300012884|Ga0157300_1115740 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 512 | Open in IMG/M |
| 3300012915|Ga0157302_10445921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 546 | Open in IMG/M |
| 3300012927|Ga0137416_10559470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 992 | Open in IMG/M |
| 3300012930|Ga0137407_10148619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2068 | Open in IMG/M |
| 3300012930|Ga0137407_10686583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 964 | Open in IMG/M |
| 3300012951|Ga0164300_11172645 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300012955|Ga0164298_10118382 | Not Available | 1434 | Open in IMG/M |
| 3300012975|Ga0134110_10398763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_20CM_4_53_11 | 610 | Open in IMG/M |
| 3300012976|Ga0134076_10197616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 842 | Open in IMG/M |
| 3300012984|Ga0164309_11533128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 570 | Open in IMG/M |
| 3300012988|Ga0164306_11937259 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300013105|Ga0157369_11633420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Catellatospora | 655 | Open in IMG/M |
| 3300013296|Ga0157374_10492084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1230 | Open in IMG/M |
| 3300013306|Ga0163162_11050409 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus opacus | 922 | Open in IMG/M |
| 3300013307|Ga0157372_12576546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 584 | Open in IMG/M |
| 3300014301|Ga0075323_1087655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 654 | Open in IMG/M |
| 3300014497|Ga0182008_10124872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1281 | Open in IMG/M |
| 3300014745|Ga0157377_11039584 | Not Available | 623 | Open in IMG/M |
| 3300015084|Ga0167654_1056366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 516 | Open in IMG/M |
| 3300015264|Ga0137403_10435045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1188 | Open in IMG/M |
| 3300015372|Ga0132256_100890481 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
| 3300016270|Ga0182036_11308479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 605 | Open in IMG/M |
| 3300016371|Ga0182034_10049731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella | 2761 | Open in IMG/M |
| 3300017928|Ga0187806_1090552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 968 | Open in IMG/M |
| 3300017936|Ga0187821_10344544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 600 | Open in IMG/M |
| 3300017937|Ga0187809_10330972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 567 | Open in IMG/M |
| 3300017940|Ga0187853_10339782 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300017942|Ga0187808_10299846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 724 | Open in IMG/M |
| 3300017973|Ga0187780_11036216 | Not Available | 599 | Open in IMG/M |
| 3300017974|Ga0187777_10648148 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300018018|Ga0187886_1293414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 607 | Open in IMG/M |
| 3300018026|Ga0187857_10228755 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 861 | Open in IMG/M |
| 3300018032|Ga0187788_10536669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_20CM_4_53_11 | 510 | Open in IMG/M |
| 3300018038|Ga0187855_10746302 | Not Available | 570 | Open in IMG/M |
| 3300018433|Ga0066667_10108664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1866 | Open in IMG/M |
| 3300018433|Ga0066667_11009335 | Not Available | 718 | Open in IMG/M |
| 3300019881|Ga0193707_1203595 | Not Available | 503 | Open in IMG/M |
| 3300019887|Ga0193729_1039248 | All Organisms → cellular organisms → Bacteria | 1964 | Open in IMG/M |
| 3300019890|Ga0193728_1000495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 19063 | Open in IMG/M |
| 3300020579|Ga0210407_10459261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 996 | Open in IMG/M |
| 3300020580|Ga0210403_11138624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Catellatospora | 604 | Open in IMG/M |
| 3300021088|Ga0210404_10007881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4302 | Open in IMG/M |
| 3300021170|Ga0210400_10346697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus opacus | 1223 | Open in IMG/M |
| 3300021170|Ga0210400_11619780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 511 | Open in IMG/M |
| 3300021171|Ga0210405_11110968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 590 | Open in IMG/M |
| 3300021362|Ga0213882_10059041 | Not Available | 1525 | Open in IMG/M |
| 3300021363|Ga0193699_10213932 | Not Available | 801 | Open in IMG/M |
| 3300021377|Ga0213874_10279324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_20CM_4_53_11 | 623 | Open in IMG/M |
| 3300021388|Ga0213875_10109152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1292 | Open in IMG/M |
| 3300021401|Ga0210393_11257712 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300021407|Ga0210383_10196196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora ureilytica | 1725 | Open in IMG/M |
| 3300021407|Ga0210383_10929319 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300021432|Ga0210384_10192760 | All Organisms → cellular organisms → Bacteria | 1831 | Open in IMG/M |
| 3300021478|Ga0210402_10550239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Catellatospora | 1071 | Open in IMG/M |
| 3300021479|Ga0210410_10188610 | All Organisms → cellular organisms → Bacteria | 1845 | Open in IMG/M |
| 3300021510|Ga0222621_1119612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 560 | Open in IMG/M |
| 3300021559|Ga0210409_10087491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2880 | Open in IMG/M |
| 3300021559|Ga0210409_10140314 | All Organisms → cellular organisms → Bacteria | 2217 | Open in IMG/M |
| 3300022561|Ga0212090_10285348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Brevibacteriaceae → Brevibacterium | 1297 | Open in IMG/M |
| 3300024330|Ga0137417_1382751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1231 | Open in IMG/M |
| 3300025321|Ga0207656_10354465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus opacus | 733 | Open in IMG/M |
| 3300025580|Ga0210138_1141339 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300025898|Ga0207692_10585017 | Not Available | 716 | Open in IMG/M |
| 3300025898|Ga0207692_10847399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Catellatospora | 599 | Open in IMG/M |
| 3300025906|Ga0207699_10746844 | Not Available | 718 | Open in IMG/M |
| 3300025906|Ga0207699_11332457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 531 | Open in IMG/M |
| 3300025906|Ga0207699_11458054 | Not Available | 506 | Open in IMG/M |
| 3300025911|Ga0207654_10697785 | Not Available | 729 | Open in IMG/M |
| 3300025915|Ga0207693_10175310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1687 | Open in IMG/M |
| 3300025915|Ga0207693_10270978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1330 | Open in IMG/M |
| 3300025915|Ga0207693_10651646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium | 818 | Open in IMG/M |
| 3300025915|Ga0207693_11031747 | Not Available | 627 | Open in IMG/M |
| 3300025922|Ga0207646_10169274 | All Organisms → cellular organisms → Bacteria | 1973 | Open in IMG/M |
| 3300025928|Ga0207700_10496995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1079 | Open in IMG/M |
| 3300025928|Ga0207700_11588528 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300025928|Ga0207700_11650064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 566 | Open in IMG/M |
| 3300025929|Ga0207664_10225940 | All Organisms → cellular organisms → Bacteria | 1625 | Open in IMG/M |
| 3300025929|Ga0207664_10289962 | All Organisms → cellular organisms → Bacteria | 1438 | Open in IMG/M |
| 3300025939|Ga0207665_10022628 | Not Available | 4137 | Open in IMG/M |
| 3300025939|Ga0207665_10298540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1203 | Open in IMG/M |
| 3300025949|Ga0207667_11880517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 561 | Open in IMG/M |
| 3300025961|Ga0207712_10217017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1527 | Open in IMG/M |
| 3300025981|Ga0207640_10126232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1842 | Open in IMG/M |
| 3300026035|Ga0207703_10479288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1166 | Open in IMG/M |
| 3300026041|Ga0207639_10431129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus opacus | 1194 | Open in IMG/M |
| 3300026067|Ga0207678_11046542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 723 | Open in IMG/M |
| 3300026121|Ga0207683_10671511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus opacus | 960 | Open in IMG/M |
| 3300026312|Ga0209153_1298993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 515 | Open in IMG/M |
| 3300026508|Ga0257161_1068535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Tenggerimyces → Tenggerimyces flavus | 726 | Open in IMG/M |
| 3300026524|Ga0209690_1210814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 614 | Open in IMG/M |
| 3300026527|Ga0209059_1243441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 603 | Open in IMG/M |
| 3300026551|Ga0209648_10175630 | All Organisms → cellular organisms → Bacteria | 1663 | Open in IMG/M |
| 3300026911|Ga0209620_1028823 | Not Available | 509 | Open in IMG/M |
| 3300027034|Ga0209730_1001862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_20CM_4_53_11 | 1538 | Open in IMG/M |
| 3300027297|Ga0208241_1000650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3679 | Open in IMG/M |
| 3300027696|Ga0208696_1286413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 506 | Open in IMG/M |
| 3300027725|Ga0209178_1023371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1927 | Open in IMG/M |
| 3300027765|Ga0209073_10152557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 854 | Open in IMG/M |
| 3300027775|Ga0209177_10273947 | Not Available | 633 | Open in IMG/M |
| 3300027821|Ga0209811_10152024 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300027875|Ga0209283_10358973 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_20CM_4_53_11 | 955 | Open in IMG/M |
| 3300027903|Ga0209488_10207949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1474 | Open in IMG/M |
| 3300028047|Ga0209526_10476708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 817 | Open in IMG/M |
| 3300030056|Ga0302181_10463877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 538 | Open in IMG/M |
| 3300030523|Ga0272436_1050253 | All Organisms → cellular organisms → Bacteria | 2012 | Open in IMG/M |
| 3300031233|Ga0302307_10458222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 647 | Open in IMG/M |
| 3300031234|Ga0302325_10151986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4137 | Open in IMG/M |
| 3300031452|Ga0272422_1065470 | All Organisms → cellular organisms → Bacteria | 1702 | Open in IMG/M |
| 3300031452|Ga0272422_1092471 | All Organisms → cellular organisms → Bacteria | 1233 | Open in IMG/M |
| 3300031472|Ga0272437_1167824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1245 | Open in IMG/M |
| 3300031549|Ga0318571_10105218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 929 | Open in IMG/M |
| 3300031564|Ga0318573_10375790 | Not Available | 763 | Open in IMG/M |
| 3300031573|Ga0310915_10399302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 976 | Open in IMG/M |
| 3300031681|Ga0318572_10006725 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5199 | Open in IMG/M |
| 3300031681|Ga0318572_10033140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2701 | Open in IMG/M |
| 3300031681|Ga0318572_10747613 | Not Available | 582 | Open in IMG/M |
| 3300031708|Ga0310686_100808673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1164 | Open in IMG/M |
| 3300031708|Ga0310686_113421042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 670 | Open in IMG/M |
| 3300031715|Ga0307476_10709505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_20CM_4_53_11 | 745 | Open in IMG/M |
| 3300031718|Ga0307474_10042107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3368 | Open in IMG/M |
| 3300031720|Ga0307469_10103698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 2006 | Open in IMG/M |
| 3300031720|Ga0307469_12437019 | Not Available | 511 | Open in IMG/M |
| 3300031723|Ga0318493_10640418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 594 | Open in IMG/M |
| 3300031724|Ga0318500_10335428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 745 | Open in IMG/M |
| 3300031736|Ga0318501_10274008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 897 | Open in IMG/M |
| 3300031770|Ga0318521_10253705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1027 | Open in IMG/M |
| 3300031770|Ga0318521_11000599 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300031779|Ga0318566_10653765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_20CM_4_53_11 | 510 | Open in IMG/M |
| 3300031781|Ga0318547_10491230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 758 | Open in IMG/M |
| 3300031794|Ga0318503_10227103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 606 | Open in IMG/M |
| 3300031795|Ga0318557_10588496 | Not Available | 511 | Open in IMG/M |
| 3300031799|Ga0318565_10071302 | Not Available | 1640 | Open in IMG/M |
| 3300031799|Ga0318565_10602452 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_20CM_4_53_11 | 528 | Open in IMG/M |
| 3300031805|Ga0318497_10421163 | Not Available | 747 | Open in IMG/M |
| 3300031819|Ga0318568_10102405 | Not Available | 1716 | Open in IMG/M |
| 3300031819|Ga0318568_10804497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 583 | Open in IMG/M |
| 3300031821|Ga0318567_10124960 | Not Available | 1409 | Open in IMG/M |
| 3300031823|Ga0307478_10920743 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300031833|Ga0310917_10034841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3002 | Open in IMG/M |
| 3300031833|Ga0310917_10212435 | Not Available | 1296 | Open in IMG/M |
| 3300031845|Ga0318511_10216557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus jeojiense | 854 | Open in IMG/M |
| 3300031894|Ga0318522_10074107 | Not Available | 1236 | Open in IMG/M |
| 3300031901|Ga0307406_11860283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 536 | Open in IMG/M |
| 3300031912|Ga0306921_11310190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 801 | Open in IMG/M |
| 3300031912|Ga0306921_11578335 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300031954|Ga0306926_11679371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_20CM_4_53_11 | 726 | Open in IMG/M |
| 3300031954|Ga0306926_12618649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 550 | Open in IMG/M |
| 3300031962|Ga0307479_11802275 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300031981|Ga0318531_10318556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 703 | Open in IMG/M |
| 3300032001|Ga0306922_10396991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1477 | Open in IMG/M |
| 3300032001|Ga0306922_10505287 | Not Available | 1288 | Open in IMG/M |
| 3300032010|Ga0318569_10182876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora ureilytica | 970 | Open in IMG/M |
| 3300032025|Ga0318507_10451135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 560 | Open in IMG/M |
| 3300032052|Ga0318506_10079757 | Not Available | 1372 | Open in IMG/M |
| 3300032054|Ga0318570_10566865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 518 | Open in IMG/M |
| 3300032060|Ga0318505_10603033 | Not Available | 516 | Open in IMG/M |
| 3300032063|Ga0318504_10033867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2050 | Open in IMG/M |
| 3300032066|Ga0318514_10394669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 734 | Open in IMG/M |
| 3300032068|Ga0318553_10055595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1958 | Open in IMG/M |
| 3300032068|Ga0318553_10189573 | Not Available | 1071 | Open in IMG/M |
| 3300032074|Ga0308173_11347566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 669 | Open in IMG/M |
| 3300032076|Ga0306924_12303516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 546 | Open in IMG/M |
| 3300032180|Ga0307471_101116536 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
| 3300032180|Ga0307471_103256971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 575 | Open in IMG/M |
| 3300032205|Ga0307472_102091228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_20CM_4_53_11 | 569 | Open in IMG/M |
| 3300032261|Ga0306920_101007780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1212 | Open in IMG/M |
| 3300032261|Ga0306920_101424551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_20CM_4_53_11 | 992 | Open in IMG/M |
| 3300032261|Ga0306920_103308318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 601 | Open in IMG/M |
| 3300032898|Ga0335072_10209760 | All Organisms → cellular organisms → Bacteria | 2296 | Open in IMG/M |
| 3300032898|Ga0335072_10329061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1689 | Open in IMG/M |
| 3300033158|Ga0335077_10584038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1168 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 16.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.97% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 10.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.59% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.59% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.29% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.69% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.10% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.20% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.20% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.20% |
| Rock | Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock | 1.20% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.50% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.50% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.50% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.50% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.50% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.50% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.90% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.90% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.90% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.90% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.90% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.60% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.60% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.60% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.60% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.60% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.60% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.60% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.60% |
| Glacier Valley | Environmental → Aquatic → Freshwater → Ice → Glacier → Glacier Valley | 0.30% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.30% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.30% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.30% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.30% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.30% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.30% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.30% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.30% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.30% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.30% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.30% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.30% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.30% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.30% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.30% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.30% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 2209111022 | Grass soil microbial communities from Rothamsted Park, UK - Chitin enrichment | Environmental | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300005183 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009809 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40 | Environmental | Open in IMG/M |
| 3300009816 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012045 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06) | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012678 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ288 (22.06) | Environmental | Open in IMG/M |
| 3300012884 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014301 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015084 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-5a, rocky medial moraine) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021510 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022561 | Borup_combined assembly | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025580 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026911 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027034 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027297 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes) | Environmental | Open in IMG/M |
| 3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030523 | Rock endolithic microbial communities from Victoria Land, Antarctica - Richard Nunatak white sandstone | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031452 | Rock endolithic microbial communities from Victoria Land, Antarctica - Mt New Zealand nord | Environmental | Open in IMG/M |
| 3300031472 | Rock endolithic microbial communities from Victoria Land, Antarctica - Richard Nunatak red sandstone | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E41_06614700 | 2170459005 | Grass Soil | PRPVAYERRTGQPAPYGAWGVDINCAVIGFIDKAPTANLADPVANSQFPPR |
| 2222044158 | 2209111022 | Grass Soil | VNPATGQPAPYGSVGVDINCAVIGFTAAAPTANLAPPAPNSQFPPR |
| ICChiseqgaiiDRAFT_07393071 | 3300000033 | Soil | GTGEPAPYGSVGVDINCAVLGFIDKAPKANLADPVAGSQFPPR* |
| JGI10216J12902_1019312691 | 3300000956 | Soil | YGSVGVDINCAVIGFTDKAPTANLADPAPNSQFPPR* |
| JGI10216J12902_1059018662 | 3300000956 | Soil | VDPATGKPAPYGSVGVDINCAVIGFTNKAPTANLADPLPNSQFPPR* |
| JGI10216J12902_1063056441 | 3300000956 | Soil | GPGGAPYGATGTDINCAVIGFIDKAPTENLADPVPNSQFPPR* |
| JGI10216J12902_1112235411 | 3300000956 | Soil | VDPATGQPAPYGSVGVDINCAVIGFTAEPPTANLAQPLPNSQFPPR* |
| JGI12627J18819_102671563 | 3300001867 | Forest Soil | GSAGVDINCAVIGYTAQAPTANLAPNVPGSQFPPR* |
| C688J35102_1193406922 | 3300002568 | Soil | GGAPYGAAGVDINCAVIGFTSKAPAKNLAAPVPNSQFPPR* |
| Ga0068993_100546791 | 3300005183 | Natural And Restored Wetlands | PATGEPAPYGSVGVDINCAVIGWTDKPPTANLADPVPNSQFPPR* |
| Ga0070709_1000093515 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | TGQPAPYGASGVDINCAVIGFTLKAPTANLAPPAPHSQFEPR* |
| Ga0070709_116187172 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | GQPAPYGATGVDINCAVIGFTNKAPTANLANPVPNSQFPPR* |
| Ga0070714_1017416491 | 3300005435 | Agricultural Soil | PAPYGSAGVDINCAVIGFTAAAPTANLAPPAPNSQFPPR* |
| Ga0070710_100451521 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | NPATGQPAPYGASGVDINCAVIGFTLKAPTANLAPPAPHSQFEPR* |
| Ga0070708_1014226682 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | TGPGGAPYGSVGIDINCAVIGFTDEAPTANLVAPVPNSQFPPR* |
| Ga0070663_1005146522 | 3300005455 | Corn Rhizosphere | GAPYGAAGVDINCAVIGFTDKAPTANLAQPVPGSQFPPR* |
| Ga0070706_1009781111 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | GQPAPYGADGVNINCAVIGYTATAPTANLAPPAPNSQFPPR* |
| Ga0070706_1012946821 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | GQPAAYGASGVDINCAVIGFTAKAPTANLAAPVPNSQFPPR* |
| Ga0070707_1005851111 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | GQPAPYGADGVNINCAVIGYTAQAPTANLAPPAPLSQFPPR* |
| Ga0070707_1010874482 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | TGQPAAYGASGVDINCAVIGFTAKAPTANLAAPVPNSQFPPR* |
| Ga0070707_1017446781 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | ATGQPAPYGATGVDINCAVIGFTDKAPTANLANPLPNSQFPPR* |
| Ga0070698_1005779273 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | GQPAPYGASGVDINCAVIGFTAHAPTANLAPPAPHSQFPPR* |
| Ga0070698_1017373263 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | QPAPYGAAGVDINCAVLGFTAKAPTANLAPPAPNSQFPPR* |
| Ga0070698_1019682501 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | TGPGGAPYGSVGIDINCAVIGFTAKAPTANLVTPAPNSQFPPR* |
| Ga0070699_1018484182 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | QPAPYGASGVDINCAVIGFTAHAPTANLAPPAPHSQFEPR* |
| Ga0073909_106722031 | 3300005526 | Surface Soil | ATGQPAPYGASGVDINCAVIGFTAKAPTANLATPLPNSQFPPR* |
| Ga0070735_103689982 | 3300005534 | Surface Soil | PATGQPQLYGSVGVDINCAVIGFTATAPTTPGPPNLPGSQFPPR* |
| Ga0070684_1009936312 | 3300005535 | Corn Rhizosphere | GQPAPYGSVGVDINCAVIGFIDKAPTANLEDPVPDSQFPPR* |
| Ga0066697_106367212 | 3300005540 | Soil | TGNPAPYGSVGVDINCAVIGFIDKAPAANLADPVPNSQFPPR* |
| Ga0070732_105731643 | 3300005542 | Surface Soil | ATGVDINCAVIGFTDKPPTQNLANPLPNSQFPPR* |
| Ga0066707_110225591 | 3300005556 | Soil | ATGEPAPYGSVGVDINCAVIGFTADAPTANLAEPVANSQFPPL* |
| Ga0066704_103827821 | 3300005557 | Soil | VDPATGKPAPYGSVGVDINCAVIGFTDKAPTANLADPVPNSQFPPR* |
| Ga0066704_106792422 | 3300005557 | Soil | ITGPGGAPYGSVGIDINCAVIGFTNDAPTANLAAPVPNSQFPPR* |
| Ga0066704_108819751 | 3300005557 | Soil | GTVGIDINCAVIGFTANAPTANLVAPVPNSQFPPR* |
| Ga0066700_109917673 | 3300005559 | Soil | PYGSVGIDINCAVIGFIDEAPTANLVEPAPNSQFPPR* |
| Ga0066670_103318781 | 3300005560 | Soil | GSVGVDINCAVIGFIDKAPATNLADPVPNSQFPPR* |
| Ga0066699_112475732 | 3300005561 | Soil | PYGSAGVDINCAVIGFTAAAPTANLAPPAPNSQFPPR* |
| Ga0066702_107297701 | 3300005575 | Soil | EPYGSAGVDINCAVIAYTADAPTANLAAPVPGSQFPPR* |
| Ga0066708_103178771 | 3300005576 | Soil | PAPYGASGVDINCAVIGFTAKAPTANLAAPVPNSQFPPR* |
| Ga0068852_1018939552 | 3300005616 | Corn Rhizosphere | YGSVGVDINCAVIGFTAAAPTANLAPPAPNSQFPPR* |
| Ga0066903_1013626553 | 3300005764 | Tropical Forest Soil | SVGVDINCAVIGFTDKAPKANLADPAPNSQFPPR* |
| Ga0066903_1050496431 | 3300005764 | Tropical Forest Soil | YGSVGVDINCAVIGFIDKAPTANLADPAPNSQFPPR* |
| Ga0066903_1060295702 | 3300005764 | Tropical Forest Soil | PAPYGSVGVDINCAVIGFTDKAPTANLADPAPGSQFPPR* |
| Ga0068860_1021843341 | 3300005843 | Switchgrass Rhizosphere | APYGSVGVDINCAVIGFTAAAPTANLAPPAANSQFPPR* |
| Ga0070717_101845313 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | GTVGIDINCAVIGFTDLAPTANLVTPAPNSQFPPR* |
| Ga0070717_108658432 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | NPATGQPAPYGASGVDINCAVIGFTLKAPTANLAPPAPNSPFEPR* |
| Ga0070717_112157971 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | PAPYGSAGVDINCAVIGFTAAAPTANLAPPAPDSQFPPR* |
| Ga0070717_116451672 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | SAGVDINCAVIGFTAAAPTANLAPPAPNSQFPPR* |
| Ga0066696_102572051 | 3300006032 | Soil | AAPYGASGVDINCAVIGFTDQAPTANLATPVPNSQFPPR* |
| Ga0066652_1020657251 | 3300006046 | Soil | SVGVDINCAVIGFTAKAPTANLADPVPNSQFPPR* |
| Ga0070716_1000295081 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | NPATGQPAAYGASGVDINCAVIGFTAKAPTANLAAPVPNSQFPPR* |
| Ga0070712_1002962332 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | AAGVDINCAVIGFTAMAPTANLATPVPNSQFPPR* |
| Ga0070712_1006475392 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | YGAAGVDINCAVLGFTAHAPTANLAPPAPHSQFEPR* |
| Ga0070712_1012707351 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | APYGAAGVDINCAVIGFTADAPTANLAEPVANSQFPPL* |
| Ga0068871_1007553063 | 3300006358 | Miscanthus Rhizosphere | PYGSVGVDINCAVIGFTDKAPTANLADPVPGSQFPPR* |
| Ga0079222_102665723 | 3300006755 | Agricultural Soil | AQYGATAVDINCAVIGFTNKAPTANLANPVPNSQFPPR* |
| Ga0066665_114630651 | 3300006796 | Soil | PYGASGVDINCAVIGFTDQAPTANLATPVPNSQFPPR* |
| Ga0066660_115804012 | 3300006800 | Soil | APYGAAGVDINCAVLGFTNQAPTENLAEPAPNSQFPPR* |
| Ga0079221_108854221 | 3300006804 | Agricultural Soil | PAPYGSAGVDINCAVIGFTAAAPTANLAPPAANSQFPPR* |
| Ga0079220_101257991 | 3300006806 | Agricultural Soil | GSVGIDINCAVIGFTAKAPTANLVTPAPNSQFPPR* |
| Ga0075428_1003671441 | 3300006844 | Populus Rhizosphere | PATGKPAPYGSVGVDINCAVIGFTAEPPTANLAQPLPNSQFPPR* |
| Ga0075433_101062151 | 3300006852 | Populus Rhizosphere | PYGAAGVDINCAVIGFTDKAPTANLAQPVPGSQFPPR* |
| Ga0075433_111889931 | 3300006852 | Populus Rhizosphere | ATGVDINCAVIGFTAKAPTANLANPLPNSQFPPR* |
| Ga0075425_1003463584 | 3300006854 | Populus Rhizosphere | AAGVDINCAVIGFTAHAPTANLAPPAPHSQFPPR* |
| Ga0075425_1021005351 | 3300006854 | Populus Rhizosphere | PATGQPAPYGSAGVDINCAVIGFTAHAPTANLAPPAPHSQFPPR* |
| Ga0075434_1004566554 | 3300006871 | Populus Rhizosphere | APYGATGVDINCAVIGFTDKAPTANLAQPLPNSQFPPR* |
| Ga0075426_101665911 | 3300006903 | Populus Rhizosphere | NPATGQPAAYGATGVDINCAVIGFTHEAPTANLANPLPNSQFPPR* |
| Ga0075426_106677511 | 3300006903 | Populus Rhizosphere | GPGGAPYGSVGIDINCAVIGFTAKAPTENLVTPAPNSQFPPR* |
| Ga0075426_112450322 | 3300006903 | Populus Rhizosphere | VNPATGQPAPYGSAGVDINCAVIGFTAHAPTANLAPPAPHSQFPPR* |
| Ga0075426_112535891 | 3300006903 | Populus Rhizosphere | PATGQPAPYGATGVDINCAVIGFTDKAPTANLAQPLPNSQFPPR* |
| Ga0075426_113408652 | 3300006903 | Populus Rhizosphere | GATGVDINCAVIGFTAKAPTANLADPLPNSQFPPR* |
| Ga0075424_1002567511 | 3300006904 | Populus Rhizosphere | AAGVDINCAVIGFTAHAPTANLAAPAANSQFPPR* |
| Ga0075424_1015800291 | 3300006904 | Populus Rhizosphere | ATGVDINCAVIGFTDKAPTANLANPLPNSQFPPR* |
| Ga0075424_1028046491 | 3300006904 | Populus Rhizosphere | GQPAPYGATGVDINCAVIGFTDKAPTANLANPLPNSQFPPR* |
| Ga0079219_100810201 | 3300006954 | Agricultural Soil | YGSAGVDINCAVIGFTAAAPTANLAPPAANSQFPPR* |
| Ga0066710_1004627031 | 3300009012 | Grasslands Soil | GPGGAPYGAAGVDINCAVIGFIDKAPTANLADPVPNSQFPPR |
| Ga0099829_107675511 | 3300009038 | Vadose Zone Soil | GGAPYGAAGVDINCAVIGFTDQAPTANLATPVPNSQFPPR* |
| Ga0099829_108378761 | 3300009038 | Vadose Zone Soil | PYGSAGVDINCAVIGFTASAPTANLAPPAPHSQFPPR* |
| Ga0099830_108349252 | 3300009088 | Vadose Zone Soil | LITAPAGAPYGSVRIATTFAVLAFTTLAPTANLVAPVPNSQFPPR* |
| Ga0099827_102969031 | 3300009090 | Vadose Zone Soil | SVGIDINCAVIGFTDEPPTANLVAPVPNSQFPPR* |
| Ga0099827_107319711 | 3300009090 | Vadose Zone Soil | NPATGQPAPYGSVGVDINCAVIGFTASAPTANLAPPAPNSQFPPR* |
| Ga0099827_113164332 | 3300009090 | Vadose Zone Soil | GAAGVDINCAVIGFTAMAPTVNLATPVPNSQFPPR* |
| Ga0075418_118036541 | 3300009100 | Populus Rhizosphere | DPATGKPAPYGSVGVDINCAVIGFTAEPPTANLAQPLPNSQFPPR* |
| Ga0066709_1013456972 | 3300009137 | Grasslands Soil | GAWGVDINCAVIGFIDKAPTANLADPAPNSQFPPR* |
| Ga0099792_101414441 | 3300009143 | Vadose Zone Soil | PAPYGSVGVDINCAVIGFIDKAPTANLADPIPNSQFPPR* |
| Ga0099792_108231021 | 3300009143 | Vadose Zone Soil | NPATGQPAPYGSAGVDINCAVIAFTAQAPTANLAPPAPHSQFPPR* |
| Ga0114129_101131011 | 3300009147 | Populus Rhizosphere | APYGAVGVDINCAVIGFIDKAPTANLADPAPNSQFPPR* |
| Ga0114129_116572951 | 3300009147 | Populus Rhizosphere | APYGATGVDINCAVIGFTNKAPTANLANPIPNSQFPPR* |
| Ga0114129_117274931 | 3300009147 | Populus Rhizosphere | GATGVDINCAVIGFTDKAPTANLANPSPNSQFPPR* |
| Ga0075423_105396601 | 3300009162 | Populus Rhizosphere | QPAPYGAAGVDINCAVIGFTAHAPTANLAPPAANSQFPPR* |
| Ga0075423_132125961 | 3300009162 | Populus Rhizosphere | GATGVDINCAVIGFTDKAPTANLANPLPNSQFPPR* |
| Ga0105241_109273351 | 3300009174 | Corn Rhizosphere | ITGPGGAPYGAAGVDINCAVIGFTDKAPTANLAQPVPGSQFPPR* |
| Ga0105241_110258031 | 3300009174 | Corn Rhizosphere | YGSAGVDINCAVIGFTAAAPTANLAPPAPNSQFPPR* |
| Ga0105248_109287151 | 3300009177 | Switchgrass Rhizosphere | PYGSVGVDINCAVIGFTAQARTANLAPPAPHSQFPPR* |
| Ga0116218_11613761 | 3300009522 | Peatlands Soil | QPAPYGSVGVDINCAVIGYTAAAPTANLAPPAANSQFPPR* |
| Ga0116216_101499401 | 3300009698 | Peatlands Soil | DPATGQPEPYGSVGVDINCAVIGYTASAPTANLASPAPNSQFPPR* |
| Ga0116216_107747092 | 3300009698 | Peatlands Soil | ATGQPAPYGSVGVDINCAVIGYTAAAPTANLAPPAPNSQFPPR* |
| Ga0126374_113434291 | 3300009792 | Tropical Forest Soil | YGAVGVDINCAVIGFTSQAPTANLATPAPNSQFPPR* |
| Ga0105089_10253881 | 3300009809 | Groundwater Sand | KPAPYGSVGVDMDCAVIGFTNKAPTANLADPIPNSQFPPR* |
| Ga0105076_11028161 | 3300009816 | Groundwater Sand | VNPATGKPAPYGSVGVDINCAVIGFTNKAPTANLADPIPNSQFPPR* |
| Ga0126308_112525351 | 3300010040 | Serpentine Soil | PYGATGVDINCAVIGFLAKPPTANLEAPVRHSQFPPR* |
| Ga0126380_116117081 | 3300010043 | Tropical Forest Soil | QPAPYGSVGVDIDCAVIGFIDQPPTANLAPPAAHSQFPPR* |
| Ga0126311_104471482 | 3300010045 | Serpentine Soil | VDPATGQPAPYGSVGVDINCAVIGFTRRAPKANLADPVPGSQFPPR* |
| Ga0126384_114528851 | 3300010046 | Tropical Forest Soil | YGSVGVDINCAVIGFIDKAPTANLADPVPNSQFPPR* |
| Ga0126373_121228581 | 3300010048 | Tropical Forest Soil | NPATGQPAPYGSVGVDINCAVIGFTAKAPTANLAPPAPNSQFPPR* |
| Ga0126373_127656532 | 3300010048 | Tropical Forest Soil | PQLYGSVGVDINCAVIGYTAKAPTTPGPPNLPGSQFPPR* |
| Ga0126373_127815541 | 3300010048 | Tropical Forest Soil | GQPAPYGSVGVDINCAVLGFTAHAPTANLASPAPHSQFPPR* |
| Ga0126372_114459771 | 3300010360 | Tropical Forest Soil | TGQPAPYGAVGVDINCAVIGFTNQAPTANLATPAPNSQFPPR* |
| Ga0126372_130671122 | 3300010360 | Tropical Forest Soil | SVGVDINCAVIAFTNKAPTANLAAPVPNSQFPPR* |
| Ga0126378_121119651 | 3300010361 | Tropical Forest Soil | YGSVGVDINCAVIGYTAQAPTANLASPVPNSQFPPR* |
| Ga0134125_103887341 | 3300010371 | Terrestrial Soil | TGKPAPYGSAGVDINCAVIGFTAAAPTANLAPPAPNSQFPPR* |
| Ga0134125_115511331 | 3300010371 | Terrestrial Soil | YGSVGVDINCAVIGFTAQAPTANLAPPAPNSQFPPR* |
| Ga0134128_110503613 | 3300010373 | Terrestrial Soil | SVGVDINCAVIGYTAHAPTANLAAPVPGSQFPPR* |
| Ga0105239_112475841 | 3300010375 | Corn Rhizosphere | GPGGAPYGAAGVDINCAVIGFTDKAPTANLAQPVPGSQFPPR* |
| Ga0105239_125090612 | 3300010375 | Corn Rhizosphere | ATGKPAPYGSVGVDINCAVIGFTEKAPKANLADPAPNSQFPPR* |
| Ga0126381_1025745971 | 3300010376 | Tropical Forest Soil | QPEPYGSVGVDINCAVIGFTANAPTANLAQPAPGSQFPPR* |
| Ga0136449_1012149391 | 3300010379 | Peatlands Soil | PYGSVGVDINCAVIGYTAAAPTANLAPPAPNSQFPPR* |
| Ga0134126_121739822 | 3300010396 | Terrestrial Soil | YGATGVDINCAVIGFTDKAPTANLADPLPNSQFPPR* |
| Ga0126383_135924432 | 3300010398 | Tropical Forest Soil | VDPATGQPAPYGAVGVDINCAVIGFTDKAPTANLADPAPNSQFPPR* |
| Ga0134121_101285383 | 3300010401 | Terrestrial Soil | GAAGVDINCAVIGFTDKAPTANLAQPVPGSQFPPR* |
| Ga0126361_102506801 | 3300010876 | Boreal Forest Soil | VNPATGQPEPYGSVGVDINCAVIGFTASAPTANLAQPVPGSQFPPR* |
| Ga0137391_101616284 | 3300011270 | Vadose Zone Soil | GPGGAPYGSVGIDINCAVIGFIDEPPTANLVAPVPNSQFPPR* |
| Ga0136623_100404053 | 3300012045 | Polar Desert Sand | TGRSVGVDINCAVIGFTADPPTADLVDPAPESQFPPR* |
| Ga0137389_118338261 | 3300012096 | Vadose Zone Soil | PYGSVGIDINCAVIGFTNDAPTANLVAPVPNSQFPPR* |
| Ga0137383_101284051 | 3300012199 | Vadose Zone Soil | QPEPYGSAGVDINCAVIGFTLKAPTANLATPAMHSQFPPR* |
| Ga0137383_102680111 | 3300012199 | Vadose Zone Soil | YGAAGVDINCAVIGFTDTAPTANLATPVPNSQFPPR* |
| Ga0137383_107016861 | 3300012199 | Vadose Zone Soil | APYGSVGVDINCAVIGFTAKPPTANLADPLPNSQFPPR* |
| Ga0137383_110376371 | 3300012199 | Vadose Zone Soil | PATGQPAAYGASGVNINCAVIGFIDKAPTANLAKPLPNSQFPPR* |
| Ga0137382_100340841 | 3300012200 | Vadose Zone Soil | PYGSVGVDINCAVIGFIDKAPTANLADPVPNSQFPPR* |
| Ga0137382_104747002 | 3300012200 | Vadose Zone Soil | YGAAGVDINCAVIGFTAAAPTANLEDPVANSQFPPL* |
| Ga0137382_113034041 | 3300012200 | Vadose Zone Soil | QPAPYGSVGVDINCAVIGFTDKAPTANLADPVPNSQFPPR* |
| Ga0137365_100256809 | 3300012201 | Vadose Zone Soil | PATGQPAPYGSVGVDINCAVIGFTAQAPTANLAPPAPNSQFPPR* |
| Ga0137365_101649223 | 3300012201 | Vadose Zone Soil | VNPATGQPAPYGSVGVDINCAVIGFTAKAPTANLADPVPNSQFPPR* |
| Ga0137365_104486202 | 3300012201 | Vadose Zone Soil | VNPATGQPAPYGSVGVDINCAVIGFTAKAPTANLAPPAPHSQFPPR* |
| Ga0137363_117364442 | 3300012202 | Vadose Zone Soil | PAPYGASGVDINCAVIGFTDKAPTANLAEPVPNSQFPPR* |
| Ga0137399_104970812 | 3300012203 | Vadose Zone Soil | LTGLGGAPYGRVGIDINCAVIGFTAIAPTANLVTPAPNSQFPPR* |
| Ga0137374_103443481 | 3300012204 | Vadose Zone Soil | VDPATGKPAPYGAAGVDINCAVIGFTDKAPTANLAAPMPNSQFPPR* |
| Ga0137380_116095641 | 3300012206 | Vadose Zone Soil | YGSAGVDINCAVIGFTANAPTANLATPAPHSQFPPR* |
| Ga0137381_109141912 | 3300012207 | Vadose Zone Soil | GKPAPYGAQGVDINCAVIGFTDKAPTANLATPVPNSQFPPR* |
| Ga0137379_115082743 | 3300012209 | Vadose Zone Soil | TGPGGAPYGTVGIDINCAVIGFTAHAPSANLVTPAPNSQFPPR* |
| Ga0137379_115154831 | 3300012209 | Vadose Zone Soil | PATGKPAPYGSAGVDINCAVIGFTAAAPTANLAPPAPNSPFPPR* |
| Ga0137378_101956604 | 3300012210 | Vadose Zone Soil | PYGSAGVDINCAVIGFTLKAPTANLATPALHSQFPPR* |
| Ga0137378_109612021 | 3300012210 | Vadose Zone Soil | QPTPYGSVGVDINCAVIGFTAHAPTANLAPPAPNSQFPPR* |
| Ga0137377_101617736 | 3300012211 | Vadose Zone Soil | ATGQPAPYGAAGVDINCAVIGFTATAPTANLAPPAPNSQFPPR* |
| Ga0137377_103457162 | 3300012211 | Vadose Zone Soil | LVLLVVVVRPGQYGAAGVDINCAVIGFTANAPTANLEEPVANSQFPPL* |
| Ga0137377_112678851 | 3300012211 | Vadose Zone Soil | ATGQPAPYGAAGVDINCAVIGFTDKAPTANLADPVPNSQFPPR* |
| Ga0137377_112709151 | 3300012211 | Vadose Zone Soil | YGATGVDINCAVIGFIDKAPTANLADPLPNSQFPPR* |
| Ga0150985_1179286952 | 3300012212 | Avena Fatua Rhizosphere | ALPICSVGVDINCAVIGFLDKAPTANLAAPVPNSQSPPL* |
| Ga0137372_106619821 | 3300012350 | Vadose Zone Soil | PYGSVGVDINCAVIGFTDKAPTANLADPAPNSQFPPR* |
| Ga0137386_100607471 | 3300012351 | Vadose Zone Soil | TGQPAPYGSVGVDINCAVIGFTAKPPTANLAEPLPNSQFPPR* |
| Ga0137386_102833923 | 3300012351 | Vadose Zone Soil | YGSAGVDINCAVIGFTLKAPTANLATPALHSQFPPR* |
| Ga0137371_101515281 | 3300012356 | Vadose Zone Soil | APYGSVGVDINCAVIGFTASAPTANLAPPAANSQFPPR* |
| Ga0137384_107050712 | 3300012357 | Vadose Zone Soil | SVGVDINCAVIGFTDKAPTANLADPAPNSQFPPR* |
| Ga0137368_100826708 | 3300012358 | Vadose Zone Soil | PYGSVGVDINCAVIGFTAKAPTANLADPVPNSQFPPR* |
| Ga0137368_102221061 | 3300012358 | Vadose Zone Soil | NPATGQPAPYGSVGVDINCAVIGFTDKAPTANLADPAPNSQFPPR* |
| Ga0137375_113638992 | 3300012360 | Vadose Zone Soil | YGSVGVDINCAVIGFTAKAPTANLADPVANSQFPPR* |
| Ga0137361_104222441 | 3300012362 | Vadose Zone Soil | PAPYGSVGVDINCAVIGFIDKAPTANLDDPVPNSQFPPR* |
| Ga0137361_104349213 | 3300012362 | Vadose Zone Soil | YGATGVDINCAVIGFIDKAPTANLATPAPNSQFPPR* |
| Ga0137361_111257202 | 3300012362 | Vadose Zone Soil | GAPYGAVGIDINCAVIGFTEKAPTANLVAPAPNSQFPPR* |
| Ga0137361_114616452 | 3300012362 | Vadose Zone Soil | GAPYGTVGIDINCAVIGFPANAPSANLVTPAPNSQFPPR* |
| Ga0137390_112442162 | 3300012363 | Vadose Zone Soil | YGSVGVDINCAVIGFTASAPTANLAPPAPNSQFPPR* |
| Ga0137373_109416311 | 3300012532 | Vadose Zone Soil | APYGSVGVDINCAVIGFTDKAPTANLADPAPNSQFPPR* |
| Ga0136615_104857571 | 3300012678 | Polar Desert Sand | MPYGASGVSINGAVIGFTDGPPTANPDPAPNSQFPPR* |
| Ga0157300_11157401 | 3300012884 | Soil | IDPATGKPAPYGSVGVDINCAVIGFTDKAPTTNLAEPVPGSQFPPR* |
| Ga0157302_104459211 | 3300012915 | Soil | TGKPAPYGSVGVDINCAVIGFTDKAPTANLADPVPGSQFPPR* |
| Ga0137416_105594701 | 3300012927 | Vadose Zone Soil | GAPYGSVGIDINCAVIGFTSDAPTANLVAPVPNSQFPPR* |
| Ga0137407_101486191 | 3300012930 | Vadose Zone Soil | KPAPYGSAGVDINCAVIGFTAAAPTANLAPPAPNSQFPPR* |
| Ga0137407_106865832 | 3300012930 | Vadose Zone Soil | SCGSAGVDTNCALTGFTASAPTANPATPAPHSQFPPR* |
| Ga0164300_111726452 | 3300012951 | Soil | QPAPYGAAGVDINCAVIGFTAQAPTANLAPPAPLSQFPPR* |
| Ga0164298_101183821 | 3300012955 | Soil | GSVGVDINCAVIGYTAHAPTANLAAPVPGSQFPPR* |
| Ga0134110_103987632 | 3300012975 | Grasslands Soil | ATGKPAPYGATGVDINCAVIGFVDKAPTANLAEPVANSQFPPR* |
| Ga0134076_101976161 | 3300012976 | Grasslands Soil | NPATGEPAPYGASGVDINCAVIGFTDKAPTANLADPVPNSQFPPR* |
| Ga0164309_115331282 | 3300012984 | Soil | DLITGPGGAPYGSAGVDINCAVIGFIDKAPTANLAEPVPNSQFPPR* |
| Ga0164306_119372592 | 3300012988 | Soil | APYGATGVDINCAVIGYTAQAPTANLANPLPNSQFPPR* |
| Ga0157369_116334201 | 3300013105 | Corn Rhizosphere | DPATGKPAPYGSVGVDINCAVIGFTAQAPTANLAPPAPHSQFPPR* |
| Ga0157374_104920843 | 3300013296 | Miscanthus Rhizosphere | GSVGVDINCAVIGFTAKPPTANLAAPVAGSQFPPR* |
| Ga0163162_110504091 | 3300013306 | Switchgrass Rhizosphere | KPAPYGSVGVDINCAVIGFTAAAPTANLAPPAPNSQFPPR* |
| Ga0157372_125765461 | 3300013307 | Corn Rhizosphere | PATGKPAPYGSVGVDINCAVIGFTDKAPTTNLAEPVPGSQFPPR* |
| Ga0075323_10876551 | 3300014301 | Natural And Restored Wetlands | PAPYGSVGVDINCAVIGFTAKAPTANLAEPAPNSQFPPR* |
| Ga0182008_101248721 | 3300014497 | Rhizosphere | APYGADGVDINCAVIGYINKAPTANLADPVANSQFPPR* |
| Ga0157377_110395841 | 3300014745 | Miscanthus Rhizosphere | DPATGQPAPYGSVGVDINCAVIGYTAHAPTANLAAPVPGSQFPPR* |
| Ga0167654_10563661 | 3300015084 | Glacier Forefield Soil | GAAGVNINCAVIGFTAKAPTANLATPVPNSQFPPR* |
| Ga0137403_104350451 | 3300015264 | Vadose Zone Soil | TGQPAPYGSVGVDINCAVIGFTDKAPTANLADPAPNSQFPPR* |
| Ga0132256_1008904813 | 3300015372 | Arabidopsis Rhizosphere | YGSVGVDINCAVIGFTEKAPKANLADPAPNSQFPPR* |
| Ga0182036_113084792 | 3300016270 | Soil | PYGSVGVDINCAVIGYTNKAPTANLAPPAPNSQFPPR |
| Ga0182034_100497311 | 3300016371 | Soil | PYGSVGVDINCAVIGYTAKAPTANLAPPAPNSQFPPR |
| Ga0187806_10905523 | 3300017928 | Freshwater Sediment | GQPEPYGSVGVDINCAVIGYTAGAPTANLASPAPNSQFPPR |
| Ga0187821_103445442 | 3300017936 | Freshwater Sediment | YGSVGVDINCAVIGWSGSKPPTANLAPPAPGSQFPPR |
| Ga0187809_103309721 | 3300017937 | Freshwater Sediment | TGQPQLYGSVGVDINCAVIGFTAQAPTANLAPNLPGSQFPPR |
| Ga0187853_103397823 | 3300017940 | Peatland | PALYGSVGVDINCAVIGYTATAPTAALQPSAPLSQFPPR |
| Ga0187808_102998461 | 3300017942 | Freshwater Sediment | QPQLYGSVGVDINCAVIGYTATAPLTPGPPNLPGSQFPPR |
| Ga0187780_110362162 | 3300017973 | Tropical Peatland | GSVGVDINCAVIGYTATAPTAALEPSAPGSQFPPR |
| Ga0187777_106481481 | 3300017974 | Tropical Peatland | PYGSVGVDINCAVIGYTATAPTAALEPSAPGSQFPPR |
| Ga0187886_12934142 | 3300018018 | Peatland | ALYGSVGVDINCAVIGYTAKAPTAALQPSLPLSQFPPK |
| Ga0187857_102287553 | 3300018026 | Peatland | GQPQLYGSVGVDINCAVIGYTATAPTAALQPPAPLSQFPPR |
| Ga0187788_105366692 | 3300018032 | Tropical Peatland | GVDPATGQPAPYGSVGVDINCAVIGFINQAPAANLAAPAPNSPFPPR |
| Ga0187855_107463022 | 3300018038 | Peatland | ATGQPQLYGSVGVDINCAVIGYSAHTPTANLAPNLPGSQFPPR |
| Ga0066667_101086644 | 3300018433 | Grasslands Soil | DPATGNPAPYGATGVDINCAVIGFTDKAPTANLADPVPNSQFPPR |
| Ga0066667_110093353 | 3300018433 | Grasslands Soil | GVDPATGQPARYGAGVDINCAVIGFIDKPPTKNLADPVPDSQFPPR |
| Ga0193707_12035951 | 3300019881 | Soil | PATGQPAPYGSVGVDINCAVIGFTKKAPTANLADPAPNSQFPPR |
| Ga0193729_10392481 | 3300019887 | Soil | TPYGSVGVDINCAVIGFTAHAPTANLAPPAPHSQFPPR |
| Ga0193728_10004951 | 3300019890 | Soil | PAPYGSIGVDINCAVIGFTASAPTANLAPPAANSQFPPR |
| Ga0210407_104592611 | 3300020579 | Soil | ATGQPAPYGAQGVDINCAVIGYTAQAPTANLAPPAPLSQFPPR |
| Ga0210403_111386242 | 3300020580 | Soil | DPATGKPAPYGAAGVDINCAVLGFTAHAPTANLAPPAPHSQFPPR |
| Ga0210404_100078814 | 3300021088 | Soil | NPATGQPAPYGSVGVDINCAVIGYTAQAPTANLAPPAPTSQFPPR |
| Ga0210400_103466973 | 3300021170 | Soil | GQPAPYGSVGVDINCAVIGYTAAAPTANLAPPAPNSQFPPR |
| Ga0210400_116197801 | 3300021170 | Soil | PYGSVGVDINCAVIGYTAAAPTANLAPPAPNSQFPPR |
| Ga0210405_111109681 | 3300021171 | Soil | TGKPAPYGAAGVDINCAVIGFTAAAPTANLAPPAPNSQFPPR |
| Ga0213882_100590413 | 3300021362 | Exposed Rock | PAPYGAVGVDINCAVIGYTADAPTANLAAPAPHSQFPPR |
| Ga0193699_102139322 | 3300021363 | Soil | VDPATGQPAPYGATGVDINCAVIGFTDKAPTANLANPLSNSQFPPR |
| Ga0213874_102793241 | 3300021377 | Plant Roots | TGQPAPYGAVGVDINCAVIGYTDQAPTANLATPAPNSQFPPR |
| Ga0213875_101091523 | 3300021388 | Plant Roots | GSVGVDINCAVIGYTAAAPTANLAPPAPGSQFPPR |
| Ga0210393_112577121 | 3300021401 | Soil | ATGQPEPYGSVGVDINCAVIGYTASAPTANLAPNIPGSQFPPR |
| Ga0210383_101961964 | 3300021407 | Soil | GSVGVDINCAVIGYTASAPTANLAPNIPGSQFPPR |
| Ga0210383_109293191 | 3300021407 | Soil | GVNPATGKPAPYGAAGVDINCAVLGFTAHAPTANLAPPAPHSQFPPR |
| Ga0210384_101927602 | 3300021432 | Soil | PYGSAGVDINCAVIGFTAAAPTANLAPPAPNSQFPPR |
| Ga0210402_105502391 | 3300021478 | Soil | PTPYGSVGVDINCAVIGFTAHAPTANLAPPAPHSQFPPR |
| Ga0210410_101886101 | 3300021479 | Soil | PYGAQGVDINCAVIGYTAQAPTANLAPPAPLSQFPPR |
| Ga0222621_11196122 | 3300021510 | Groundwater Sediment | PAPYGASGVDINCAVIGFTDKAPTANLADPVPNSQFPPR |
| Ga0210409_100874911 | 3300021559 | Soil | APYGSAGVDINCAVIGFTAAAPTANLAPPAPDSQFPPR |
| Ga0210409_101403144 | 3300021559 | Soil | TGQPEPYGSVGVDINCAVIGYTATAPTANLASPAPNSQFPPR |
| Ga0212090_102853481 | 3300022561 | Glacier Valley | YGSVGVDINCAVIGYTNTAPTAALATNLPRSQFPPR |
| Ga0137417_13827511 | 3300024330 | Vadose Zone Soil | SVGVDINCAVIGWTGDQPPTANLEAPAPNSQFPPR |
| Ga0207656_103544651 | 3300025321 | Corn Rhizosphere | YGSAGVDINCAVIGFTAAAPTANLAPPAPNSQFPPR |
| Ga0210138_11413392 | 3300025580 | Natural And Restored Wetlands | PAPYGSVGVDINCAVIGWTDKPPTANLADPVPNSQFPPR |
| Ga0207692_105850172 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | GQPAPYGASGVDINCAVIGFTLKAPTANLAPPAPHSQFEPR |
| Ga0207692_108473992 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | YGSVGVDINCAVIGFTAHAPTANLAPPAPHSQFPPR |
| Ga0207699_107468443 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | GQPAPYGSVGVDINCAVIGYTAHAPTANLAAPVPGSQFPPR |
| Ga0207699_113324572 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | GKPAPYGSVGVDINCAVIGFTAAAPTANLAPPAPNSQFPPR |
| Ga0207699_114580542 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | YGSVGVDINCAVIGYTAAAPTANLAPPAPNSQFPPR |
| Ga0207654_106977851 | 3300025911 | Corn Rhizosphere | DPSTGKPAPYGSVGVDINCAVIGFTAKPPTANLAQPVPGSQFPPR |
| Ga0207693_101753103 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | QPAPYGADGVNINCAVIGYTAQAPTANLAPPAPNSQFPPR |
| Ga0207693_102709781 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | NPATGQPAPYGSVGVDINCAVIGFTAQAPTANLAPPAPHSQFPPR |
| Ga0207693_106516462 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | QPAPYGADGVNINCAVIGYTAQAPTANLAPPAPLSQFPPR |
| Ga0207693_110317472 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | ATGQPAPYGAAGVDINCAVIGFTADAPTANLAEPVANSQFPPL |
| Ga0207646_101692741 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | PYGASGVDINCAVIGFTDKAPTANLADPVPNSQFPPR |
| Ga0207700_104969951 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | APYGSVGVDINCAVIGFTAAAPTANLAPPAPNSQFPPR |
| Ga0207700_115885281 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | GQPAPYGSVGVDINCAVIGFTDKAPTANLADPAPNSQFPPR |
| Ga0207700_116500642 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | PGGAPYGTVGIDINCAVIGFTADAPTANLVTPAPNSQFPPR |
| Ga0207664_102259401 | 3300025929 | Agricultural Soil | QPAAYGASGVDINCAVIGFTAKAPTANLAAPVPNSQFPPR |
| Ga0207664_102899624 | 3300025929 | Agricultural Soil | GPGGAPYGTVGIDINCAVLGFTNLPPTTNLVAPVPNSQFPPR |
| Ga0207665_100226281 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | QPAPYGASGVDINCAVIGFTLKAPTANLAPPAPHSQFEPR |
| Ga0207665_102985402 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | NPATGQPAPYGASGVDINCAVIGFTAKAPTANLAAPVPNSQFPPR |
| Ga0207667_118805172 | 3300025949 | Corn Rhizosphere | NPATGQPAPYGSVGVDINCAVIGYIAQAPTANLAPPAPNSQFPPR |
| Ga0207712_102170174 | 3300025961 | Switchgrass Rhizosphere | ATGKPAPYGSAGVDINCAVIGFTAAAPTANLAPPAPNSQFPPR |
| Ga0207640_101262321 | 3300025981 | Corn Rhizosphere | PAPYGSAGVDINCAVIGFTAAAPTANLAPPAPNSQFPPR |
| Ga0207703_104792882 | 3300026035 | Switchgrass Rhizosphere | ITGPGGAPYGAAGVDINCAVIGFTDKAPTANLAQPVPGSQFPPR |
| Ga0207639_104311291 | 3300026041 | Corn Rhizosphere | PATGKPAPYGSAGVDINCAVIGFTAAAPTANLAPPAPNSQFPPR |
| Ga0207678_110465421 | 3300026067 | Corn Rhizosphere | YGAAGVDINCAVIGFSDKAPTANLAQPVPGSQFPPR |
| Ga0207683_106715112 | 3300026121 | Miscanthus Rhizosphere | TGKPAPYGSAGVDINCAVIGFTAAAPTANLAPPAPNSQFPPR |
| Ga0209153_12989931 | 3300026312 | Soil | GGAPYGASTVDINCAVIGFTDQAPTANLATPVPNSQFPPR |
| Ga0257161_10685351 | 3300026508 | Soil | ITGPGGAPYGSVGIDINCAVIGFTNEAPTANLVAPVPNSQFPPR |
| Ga0209690_12108142 | 3300026524 | Soil | GQPAPYGAAGVDINCAVIGFTAKAPTANLADPVPNSQFPPR |
| Ga0209059_12434411 | 3300026527 | Soil | GPGGAPYGTVGIDINCAVIGFTADAPTANLVAPVPNSQFPPR |
| Ga0209648_101756302 | 3300026551 | Grasslands Soil | GPYGSVGIDINCAVIGFTNLAPTANLVAPVPNSQFPPR |
| Ga0209620_10288231 | 3300026911 | Forest Soil | PEPYGAAGVDINCAVIGYTAQAPTANLAPNVPGSQFPPR |
| Ga0209730_10018623 | 3300027034 | Forest Soil | TGEPAPYGADGVDINCAVLGFTNHAPTENLEPPVPNSQFPPR |
| Ga0208241_10006506 | 3300027297 | Forest Soil | VDPATGQPEPYGSVGVDINCAVIGYTASAPTANLAPNIPGSQFPPR |
| Ga0208696_12864132 | 3300027696 | Peatlands Soil | QPEPYGSVGVDINCAVIGYTASAPTANLASPAPNSQFPPR |
| Ga0209178_10233714 | 3300027725 | Agricultural Soil | GAPYGSVGIDINCAVIGFTAKAPTANLVAPAPNSQFPPR |
| Ga0209073_101525573 | 3300027765 | Agricultural Soil | ATGKPAPYGSVGVDINCAVIGFTAQAPTANLAPPAPNSQFPPR |
| Ga0209177_102739472 | 3300027775 | Agricultural Soil | PATGKPAPYGSVGVDINCAVIGFTAQAPTANLAQPVPGSQFPPR |
| Ga0209811_101520243 | 3300027821 | Surface Soil | ATGQPAPYGASGVDINCAVIGFTDKAPTANLADPVPNSQFPPR |
| Ga0209283_103589732 | 3300027875 | Vadose Zone Soil | TGQPAPYGSVGVDINCAVIGFTAQAPTANLAPPAPHSQFPPR |
| Ga0209488_102079491 | 3300027903 | Vadose Zone Soil | QPAPYGAAGVDINCAVIGYTANAPTANLAPPAPGSQFPPR |
| Ga0209526_104767081 | 3300028047 | Forest Soil | YGAQGVDINCAVIGFTAMAPTANLATPVPNSQFPPR |
| Ga0302181_104638772 | 3300030056 | Palsa | TGQPQLYGSVGVDINCAVIGYTAKAPTNALQPSAPGSQFEPR |
| Ga0272436_10502533 | 3300030523 | Rock | PKPYGSAGVDINCAVIGFTAQPPTANLAPPAPHSQFPPR |
| Ga0302307_104582222 | 3300031233 | Palsa | TGQPQLYGSVGVDINCAVIGYTATAPLTPGSPNLPGSQFPPR |
| Ga0302325_101519867 | 3300031234 | Palsa | GSVGVDINCAVIGYTATAPLTPGPPNLPGSQFPPR |
| Ga0272422_10654702 | 3300031452 | Rock | YGSAGVDINCAVIGFTAQPPTANLAPPAPHSQFPPR |
| Ga0272422_10924711 | 3300031452 | Rock | PKPYGSAGVDINCAIIGFTAKPPTANLAPPAPHSQFPPR |
| Ga0272437_11678241 | 3300031472 | Rock | YGSVGIDINCAVIGYTAQAPTANLAASAPGSQFPPR |
| Ga0318571_101052182 | 3300031549 | Soil | PYGSVGVDINCAVIGFTDKAPTANLAAPVPNSQFPPR |
| Ga0318573_103757902 | 3300031564 | Soil | TLQPVPYGSVGVDINCAVLGWSGKKPPTANLAPPAPGSQFPPR |
| Ga0310915_103993023 | 3300031573 | Soil | PGTGQPQPYGSAGVDINCAVIGYTAKAPTANLVPPAPNSQFPPR |
| Ga0318572_100067257 | 3300031681 | Soil | VDPGTGQPQPYGSAGVDINCAVIGYTAKAPTANLVPPAPNSQFPPR |
| Ga0318572_100331405 | 3300031681 | Soil | ATGQPEPYGSVGVDINCAVIGYTATAPTANLASPAPDSQFPPR |
| Ga0318572_107476131 | 3300031681 | Soil | YGSVGVDINCAVIGWSGKKPPTANLAPPAPGSQFPPR |
| Ga0310686_1008086731 | 3300031708 | Soil | TGQPQLYGSVGVDINCAVIGYTATAPQTPGPPNLPGSQFPPR |
| Ga0310686_1134210421 | 3300031708 | Soil | PATGQPEPYGSVGVDINCAVIGYTAQAPTANLAPPAPGSQFPPR |
| Ga0307476_107095051 | 3300031715 | Hardwood Forest Soil | PATGQPAPYGSAGVDINCAVIGFTAQAPTANLAPPAPLSQFPPR |
| Ga0307474_100421075 | 3300031718 | Hardwood Forest Soil | ATGQPKPYGSAGVDINCAVIGFTAQAPTANLAPPVPGSQFPPR |
| Ga0307469_101036981 | 3300031720 | Hardwood Forest Soil | APYGSVGVDSNCAVIGYIAQAPTANLAPPAPNSQFPPR |
| Ga0307469_124370191 | 3300031720 | Hardwood Forest Soil | PATGQPAPYGASGVDINCAVIGFTAKAPTANLATPLPNSQFPPR |
| Ga0318493_106404182 | 3300031723 | Soil | SVGVDINCAVIGWSGNKPPTANLAPPAPGSQFPPR |
| Ga0318500_103354282 | 3300031724 | Soil | PATVQPQPYGSVGVDINCAVIGYTAKAPTANLVPPAPNSQFPPR |
| Ga0318501_102740083 | 3300031736 | Soil | EPYGSVGVDINCAVIGFTNKAPTANLAPPAPNSQFPPR |
| Ga0318521_102537052 | 3300031770 | Soil | PQPYGSVGVDINCAVIGYTAKAPTANLAPPAPNSQFPPR |
| Ga0318521_110005992 | 3300031770 | Soil | APYGSVGVDINCAVIGFTNKPPTANLADPVANSQFPPR |
| Ga0318566_106537651 | 3300031779 | Soil | PATGQPAPYGSVGVDINCAVIGYTAQAPTANLAAPVPGSQFPPR |
| Ga0318547_104912301 | 3300031781 | Soil | NPATGQPQLYGSVGVDINCAVIGYTAKAPTVNLAPNLPGSQFPPR |
| Ga0318503_102271032 | 3300031794 | Soil | TGQPTPYGSVGVDINCAVIGYTNQAPTANLAAPVPGSQFPPR |
| Ga0318557_105884962 | 3300031795 | Soil | TLQPVSYGSVGVDINCAVLGWSGKKPPTANLAPPAPGSQFPPR |
| Ga0318565_100713021 | 3300031799 | Soil | GQPVPYGSVGVDINCAVIGYTATAPTANLASPAPDSQFPPR |
| Ga0318565_106024521 | 3300031799 | Soil | YNVATGQPEPYGSDGVDINCAVIGYTAQAPTANLASPVPNSQFPPR |
| Ga0318497_104211632 | 3300031805 | Soil | GTGQPQPYGSVGVDINCAVIGYTAKAPTANLVPPAPNSQFPPR |
| Ga0318568_101024054 | 3300031819 | Soil | PYGSVGVDINCAVIGFTEEPPTANLEPPAPNSQFPPR |
| Ga0318568_108044972 | 3300031819 | Soil | PYGSVGVDINCAVIGWTGDEPPLANLADPVPNSQFPPR |
| Ga0318567_101249604 | 3300031821 | Soil | PATGQPEPYGSVGVDINCAVIGYTATAPTANLASPAPDSQFPPR |
| Ga0307478_109207432 | 3300031823 | Hardwood Forest Soil | DPATGQSEPYGSVGVDINCAVIGYTASAPTANLAPNIPGSQFPPR |
| Ga0310917_100348411 | 3300031833 | Soil | AGNPATGQPEPYGSVGVDINCAVIGYTATAPTANLASPAPDSQFPPR |
| Ga0310917_102124353 | 3300031833 | Soil | GSDGTDINCAVIGYTNKAPTANLAPPAPGSQFPPR |
| Ga0318511_102165572 | 3300031845 | Soil | QLYGSVGVDINCAVIGYTAKAPTTPGPANLPGSQFPPR |
| Ga0318522_100741071 | 3300031894 | Soil | YGSVGVDINCAVIGFTANAPTANLASPAPDSQFPPR |
| Ga0307406_118602832 | 3300031901 | Rhizosphere | GSVGVDINCAVLGFTAKAPTANLANPLPNSQFPPR |
| Ga0306921_113101901 | 3300031912 | Soil | EPYGSVGVDINCAVIGYTATAPTANLAPPAPGSQFPPR |
| Ga0306921_115783352 | 3300031912 | Soil | QPQPYGSVGVDINCAVIGYTATAPTANLAQPAPGSQFPPR |
| Ga0306926_116793711 | 3300031954 | Soil | GQPTPYGSVGVDINCAVIGFTDKAPTANLAAPVPNSQFPPR |
| Ga0306926_126186492 | 3300031954 | Soil | ATGKPAPYGSVGVDINCAVIGFTEKAPTANLAEPVPGSQFPPR |
| Ga0307479_118022751 | 3300031962 | Hardwood Forest Soil | LITGPGGAPYGSVGIDINCAVIGFTNEPPTANLVAPAPNSQFPPR |
| Ga0318531_103185561 | 3300031981 | Soil | GTGQPQPYGSAGVDINCAVIGYTAKAPTANLVPPAPNSQFPPR |
| Ga0306922_103969912 | 3300032001 | Soil | QAEPYGSVGVDINCAVIGYTATAPTANLAPPAPGSQFPPR |
| Ga0306922_105052873 | 3300032001 | Soil | TGQPEPYGSDGVDINCAVIGYTATAPTANLASPVPNSQFPPR |
| Ga0318569_101828761 | 3300032010 | Soil | VDPATGQPAPYGAVGVDINCAVIGFTNQAPTANLATPAPNSQFPPR |
| Ga0318507_104511351 | 3300032025 | Soil | PYGSAGVDINCAVIGYTATAPTANLAPPAPGSQFPPR |
| Ga0318506_100797571 | 3300032052 | Soil | ATGQPVPYGSVGVDINCAVIGYTATAPTANLASPAPDSQFPPR |
| Ga0318570_105668651 | 3300032054 | Soil | GGAPYGSAGVDINCAVIGFTDDAPTANLEPPAPNSQFPPR |
| Ga0318505_106030332 | 3300032060 | Soil | PATVQPQPYGSAGVDINCAPTANLAPPAPNSQFPPR |
| Ga0318504_100338671 | 3300032063 | Soil | VNPATGQPTPYGSVGVDINCAVIGYTNQAPTANLAAPVPGSQFPPR |
| Ga0318514_103946691 | 3300032066 | Soil | PAPYGSVGVDINCAVIGFTEKAPTANLADPVPGSQFPPR |
| Ga0318553_100555951 | 3300032068 | Soil | YGSDGVDINCAVIGYTAQAPTANLASPVPNSQFPPR |
| Ga0318553_101895733 | 3300032068 | Soil | PYGSVGVDINCAVIGYTATAPTANLASPAPDSQFPPR |
| Ga0308173_113475663 | 3300032074 | Soil | GSVGVDINCAVIGFTAKAPTANLADPVPGSQFPPR |
| Ga0306924_123035161 | 3300032076 | Soil | GAVGVDINCAVIGFTSKAPTANLATPAPNSQFPPR |
| Ga0307471_1011165363 | 3300032180 | Hardwood Forest Soil | YGATGVDINCAVIGFTHKAPTANLATPLPNSQFPPR |
| Ga0307471_1032569712 | 3300032180 | Hardwood Forest Soil | TGPGGAPYGSVGIDINCAVIGFIDEAPTANLVAPAPNSQFPPR |
| Ga0307472_1020912281 | 3300032205 | Hardwood Forest Soil | GGAPYGAAGVDINCAVIGFTDKAPTANLAQPVPGSQFPPR |
| Ga0306920_1010077801 | 3300032261 | Soil | PYGSAGVDINCAVIGYTAQAPTANLAPPAPGSQFPPR |
| Ga0306920_1014245513 | 3300032261 | Soil | PATGQPQPYGSVGVDINCAVIGYTNKAPTANLVPPAPNSQFPPR |
| Ga0306920_1033083182 | 3300032261 | Soil | ATGHPAPYGSAGVDIDCAVIGFINRPPTANLAPPVPHSQFPPR |
| Ga0335072_102097604 | 3300032898 | Soil | GQPQLYGSVGVDINCAVIGYTAKAPTTPGPPNLPGSQFPPR |
| Ga0335072_103290612 | 3300032898 | Soil | ATGQPQLYGSVGVDINCAVIGYTATAPTSPGPPSLPGSQFPPR |
| Ga0335077_105840382 | 3300033158 | Soil | ATGQPEPYGSVGVDINCAVIGYTATAPTANLAPPAPGSQFPPR |
| ⦗Top⦘ |