| Basic Information | |
|---|---|
| Family ID | F008374 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 334 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MIPESHPLQQLFLELVGRHYAEEIGIRDPQIVNYVAQLLA |
| Number of Associated Samples | 251 |
| Number of Associated Scaffolds | 334 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 98.50 % |
| % of genes near scaffold ends (potentially truncated) | 97.31 % |
| % of genes from short scaffolds (< 2000 bps) | 88.32 % |
| Associated GOLD sequencing projects | 232 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (75.749 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (8.383 % of family members) |
| Environment Ontology (ENVO) | Unclassified (19.162 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.198 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.18% β-sheet: 0.00% Coil/Unstructured: 58.82% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 334 Family Scaffolds |
|---|---|---|
| PF01042 | Ribonuc_L-PSP | 60.18 |
| PF01979 | Amidohydro_1 | 4.19 |
| PF00583 | Acetyltransf_1 | 1.50 |
| PF00571 | CBS | 1.50 |
| PF00216 | Bac_DNA_binding | 1.20 |
| PF03602 | Cons_hypoth95 | 0.90 |
| PF00586 | AIRS | 0.60 |
| PF01197 | Ribosomal_L31 | 0.30 |
| PF02913 | FAD-oxidase_C | 0.30 |
| PF13442 | Cytochrome_CBB3 | 0.30 |
| PF00483 | NTP_transferase | 0.30 |
| PF12704 | MacB_PCD | 0.30 |
| PF02687 | FtsX | 0.30 |
| PF00069 | Pkinase | 0.30 |
| PF13673 | Acetyltransf_10 | 0.30 |
| PF01594 | AI-2E_transport | 0.30 |
| PF03331 | LpxC | 0.30 |
| PF01288 | HPPK | 0.30 |
| PF07992 | Pyr_redox_2 | 0.30 |
| PF02618 | YceG | 0.30 |
| COG ID | Name | Functional Category | % Frequency in 334 Family Scaffolds |
|---|---|---|---|
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 60.18 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 1.20 |
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 1.20 |
| COG0742 | 16S rRNA G966 N2-methylase RsmD | Translation, ribosomal structure and biogenesis [J] | 0.90 |
| COG1092 | 23S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmI | Translation, ribosomal structure and biogenesis [J] | 0.90 |
| COG2242 | Precorrin-6B methylase 2 | Coenzyme transport and metabolism [H] | 0.90 |
| COG2265 | tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family | Translation, ribosomal structure and biogenesis [J] | 0.90 |
| COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 0.90 |
| COG0254 | Ribosomal protein L31 | Translation, ribosomal structure and biogenesis [J] | 0.30 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.30 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.30 |
| COG0774 | UDP-3-O-acyl-N-acetylglucosamine deacetylase | Cell wall/membrane/envelope biogenesis [M] | 0.30 |
| COG0801 | 7,8-dihydro-6-hydroxymethylpterin pyrophosphokinase (folate biosynthesis) | Coenzyme transport and metabolism [H] | 0.30 |
| COG1559 | Endolytic transglycosylase MltG, terminates peptidoglycan polymerization | Cell wall/membrane/envelope biogenesis [M] | 0.30 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 75.75 % |
| Unclassified | root | N/A | 24.25 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000579|AP72_2010_repI_A01DRAFT_1006106 | All Organisms → cellular organisms → Bacteria | 2113 | Open in IMG/M |
| 3300000955|JGI1027J12803_108950627 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
| 3300001180|JGI12695J13573_1000303 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5737 | Open in IMG/M |
| 3300001471|JGI12712J15308_10050386 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300001471|JGI12712J15308_10091313 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300001593|JGI12635J15846_10585489 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300001661|JGI12053J15887_10535128 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300001867|JGI12627J18819_10117454 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100084392 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2954 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100917335 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101372980 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300002558|JGI25385J37094_10223095 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 502 | Open in IMG/M |
| 3300002560|JGI25383J37093_10114839 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300004080|Ga0062385_10916653 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300004091|Ga0062387_101448392 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300004091|Ga0062387_101458240 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300004091|Ga0062387_101626856 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300004092|Ga0062389_101748866 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300004152|Ga0062386_100475268 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300004635|Ga0062388_101176775 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300005167|Ga0066672_10087375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1878 | Open in IMG/M |
| 3300005171|Ga0066677_10302500 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
| 3300005177|Ga0066690_10005632 | All Organisms → cellular organisms → Bacteria | 5863 | Open in IMG/M |
| 3300005180|Ga0066685_10146437 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1604 | Open in IMG/M |
| 3300005184|Ga0066671_10305282 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
| 3300005184|Ga0066671_10821734 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300005434|Ga0070709_10120300 | All Organisms → cellular organisms → Bacteria | 1779 | Open in IMG/M |
| 3300005436|Ga0070713_100378640 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1318 | Open in IMG/M |
| 3300005541|Ga0070733_10019871 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 4185 | Open in IMG/M |
| 3300005541|Ga0070733_10284704 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1091 | Open in IMG/M |
| 3300005542|Ga0070732_10214892 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1150 | Open in IMG/M |
| 3300005542|Ga0070732_10401681 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300005560|Ga0066670_10986560 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300005569|Ga0066705_10975822 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300005587|Ga0066654_10049755 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1846 | Open in IMG/M |
| 3300005602|Ga0070762_10621416 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 719 | Open in IMG/M |
| 3300005614|Ga0068856_100143867 | Not Available | 2392 | Open in IMG/M |
| 3300005712|Ga0070764_10674142 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
| 3300005764|Ga0066903_107808446 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300005880|Ga0075298_1035477 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300005898|Ga0075276_10086204 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300005995|Ga0066790_10167890 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300006028|Ga0070717_10440090 | All Organisms → cellular organisms → Bacteria | 1174 | Open in IMG/M |
| 3300006028|Ga0070717_10562560 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1033 | Open in IMG/M |
| 3300006028|Ga0070717_12102433 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300006034|Ga0066656_10282760 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300006052|Ga0075029_100039218 | All Organisms → cellular organisms → Bacteria | 2713 | Open in IMG/M |
| 3300006059|Ga0075017_100002018 | All Organisms → cellular organisms → Bacteria | 12621 | Open in IMG/M |
| 3300006086|Ga0075019_10555925 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300006162|Ga0075030_101114450 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300006173|Ga0070716_100588787 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300006173|Ga0070716_100752131 | Not Available | 750 | Open in IMG/M |
| 3300006174|Ga0075014_100189981 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
| 3300006174|Ga0075014_100251417 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300006174|Ga0075014_100966471 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300006237|Ga0097621_100576256 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
| 3300006794|Ga0066658_10669181 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300006796|Ga0066665_10111487 | All Organisms → cellular organisms → Bacteria | 2023 | Open in IMG/M |
| 3300006800|Ga0066660_11637076 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300006871|Ga0075434_100830188 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 940 | Open in IMG/M |
| 3300006881|Ga0068865_100053241 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2808 | Open in IMG/M |
| 3300007258|Ga0099793_10146158 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1118 | Open in IMG/M |
| 3300009089|Ga0099828_10175338 | All Organisms → cellular organisms → Bacteria | 1905 | Open in IMG/M |
| 3300009089|Ga0099828_11086130 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 711 | Open in IMG/M |
| 3300009137|Ga0066709_101447781 | Not Available | 995 | Open in IMG/M |
| 3300009143|Ga0099792_11153415 | Not Available | 524 | Open in IMG/M |
| 3300009520|Ga0116214_1289260 | Not Available | 627 | Open in IMG/M |
| 3300009520|Ga0116214_1342507 | Not Available | 578 | Open in IMG/M |
| 3300009521|Ga0116222_1231552 | Not Available | 796 | Open in IMG/M |
| 3300009523|Ga0116221_1341322 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 650 | Open in IMG/M |
| 3300009524|Ga0116225_1071226 | All Organisms → cellular organisms → Bacteria | 1638 | Open in IMG/M |
| 3300009525|Ga0116220_10425931 | Not Available | 596 | Open in IMG/M |
| 3300009525|Ga0116220_10475626 | Not Available | 565 | Open in IMG/M |
| 3300009545|Ga0105237_11332115 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 724 | Open in IMG/M |
| 3300009618|Ga0116127_1059069 | Not Available | 1081 | Open in IMG/M |
| 3300009624|Ga0116105_1032555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1140 | Open in IMG/M |
| 3300009630|Ga0116114_1103341 | Not Available | 755 | Open in IMG/M |
| 3300009634|Ga0116124_1133539 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 695 | Open in IMG/M |
| 3300009639|Ga0116122_1217897 | Not Available | 595 | Open in IMG/M |
| 3300009672|Ga0116215_1530598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300009683|Ga0116224_10366169 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300009698|Ga0116216_10081448 | All Organisms → cellular organisms → Bacteria | 1992 | Open in IMG/M |
| 3300009792|Ga0126374_10697056 | Not Available | 763 | Open in IMG/M |
| 3300009792|Ga0126374_10755632 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 738 | Open in IMG/M |
| 3300010043|Ga0126380_11062110 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 687 | Open in IMG/M |
| 3300010046|Ga0126384_10437582 | Not Available | 1113 | Open in IMG/M |
| 3300010048|Ga0126373_10065571 | All Organisms → cellular organisms → Bacteria | 3265 | Open in IMG/M |
| 3300010048|Ga0126373_11146624 | Not Available | 843 | Open in IMG/M |
| 3300010339|Ga0074046_10883763 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
| 3300010343|Ga0074044_10087892 | All Organisms → cellular organisms → Bacteria | 2097 | Open in IMG/M |
| 3300010343|Ga0074044_10102021 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1930 | Open in IMG/M |
| 3300010343|Ga0074044_10344041 | Not Available | 978 | Open in IMG/M |
| 3300010359|Ga0126376_12984208 | Not Available | 523 | Open in IMG/M |
| 3300010360|Ga0126372_13030960 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300010360|Ga0126372_13230230 | Not Available | 507 | Open in IMG/M |
| 3300010371|Ga0134125_10388601 | All Organisms → cellular organisms → Bacteria | 1548 | Open in IMG/M |
| 3300010373|Ga0134128_11654944 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 704 | Open in IMG/M |
| 3300010373|Ga0134128_13061758 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300010379|Ga0136449_100158531 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4415 | Open in IMG/M |
| 3300010379|Ga0136449_102094752 | Not Available | 830 | Open in IMG/M |
| 3300010379|Ga0136449_102225488 | Not Available | 799 | Open in IMG/M |
| 3300010396|Ga0134126_12547691 | Not Available | 556 | Open in IMG/M |
| 3300010398|Ga0126383_11291008 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella arctica | 820 | Open in IMG/M |
| 3300010398|Ga0126383_12763759 | Not Available | 573 | Open in IMG/M |
| 3300011269|Ga0137392_11188586 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 621 | Open in IMG/M |
| 3300011270|Ga0137391_10553143 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 969 | Open in IMG/M |
| 3300012189|Ga0137388_10395711 | All Organisms → cellular organisms → Bacteria | 1278 | Open in IMG/M |
| 3300012189|Ga0137388_11105900 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300012199|Ga0137383_10339962 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
| 3300012202|Ga0137363_11115364 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 671 | Open in IMG/M |
| 3300012202|Ga0137363_11344126 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300012205|Ga0137362_10462601 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
| 3300012205|Ga0137362_11140562 | Not Available | 662 | Open in IMG/M |
| 3300012207|Ga0137381_10849655 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300012208|Ga0137376_10412897 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
| 3300012208|Ga0137376_10520965 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
| 3300012357|Ga0137384_11539638 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 514 | Open in IMG/M |
| 3300012363|Ga0137390_10337634 | All Organisms → cellular organisms → Bacteria | 1488 | Open in IMG/M |
| 3300012582|Ga0137358_10157666 | All Organisms → cellular organisms → Bacteria | 1547 | Open in IMG/M |
| 3300012918|Ga0137396_10051751 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2818 | Open in IMG/M |
| 3300012918|Ga0137396_10766749 | Not Available | 710 | Open in IMG/M |
| 3300012948|Ga0126375_12068662 | Not Available | 505 | Open in IMG/M |
| 3300012955|Ga0164298_10726939 | Not Available | 700 | Open in IMG/M |
| 3300012957|Ga0164303_11166995 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300012960|Ga0164301_10997928 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300013105|Ga0157369_10918836 | Not Available | 897 | Open in IMG/M |
| 3300013105|Ga0157369_11425667 | Not Available | 705 | Open in IMG/M |
| 3300013296|Ga0157374_12160789 | Not Available | 584 | Open in IMG/M |
| 3300013307|Ga0157372_10060479 | All Organisms → cellular organisms → Bacteria | 4239 | Open in IMG/M |
| 3300013307|Ga0157372_11962410 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 673 | Open in IMG/M |
| 3300013766|Ga0120181_1139242 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300014157|Ga0134078_10525500 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 554 | Open in IMG/M |
| 3300014162|Ga0181538_10020812 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4584 | Open in IMG/M |
| 3300014168|Ga0181534_10699237 | Not Available | 592 | Open in IMG/M |
| 3300014169|Ga0181531_10000920 | All Organisms → cellular organisms → Bacteria | 19110 | Open in IMG/M |
| 3300014169|Ga0181531_10158701 | All Organisms → cellular organisms → Bacteria | 1369 | Open in IMG/M |
| 3300014169|Ga0181531_10201484 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1209 | Open in IMG/M |
| 3300014487|Ga0182000_10055050 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
| 3300014492|Ga0182013_10247275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 1035 | Open in IMG/M |
| 3300014838|Ga0182030_10102569 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3935 | Open in IMG/M |
| 3300015242|Ga0137412_10644370 | Not Available | 796 | Open in IMG/M |
| 3300015356|Ga0134073_10395232 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 520 | Open in IMG/M |
| 3300016387|Ga0182040_10482245 | Not Available | 988 | Open in IMG/M |
| 3300016445|Ga0182038_11629826 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300017823|Ga0187818_10404675 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300017928|Ga0187806_1232124 | Not Available | 634 | Open in IMG/M |
| 3300017938|Ga0187854_10248185 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300017942|Ga0187808_10536728 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300017948|Ga0187847_10167746 | Not Available | 1199 | Open in IMG/M |
| 3300017975|Ga0187782_11008838 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300017975|Ga0187782_11391058 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 551 | Open in IMG/M |
| 3300017993|Ga0187823_10251237 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 598 | Open in IMG/M |
| 3300017993|Ga0187823_10310292 | Not Available | 551 | Open in IMG/M |
| 3300017995|Ga0187816_10099077 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1250 | Open in IMG/M |
| 3300017995|Ga0187816_10113646 | All Organisms → cellular organisms → Bacteria | 1165 | Open in IMG/M |
| 3300017995|Ga0187816_10203263 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300017995|Ga0187816_10580756 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 504 | Open in IMG/M |
| 3300017995|Ga0187816_10590298 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| 3300018006|Ga0187804_10190278 | Not Available | 874 | Open in IMG/M |
| 3300018007|Ga0187805_10133188 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
| 3300018007|Ga0187805_10151530 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
| 3300018012|Ga0187810_10422874 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300018016|Ga0187880_1493191 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| 3300018018|Ga0187886_1137495 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
| 3300018018|Ga0187886_1191253 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 793 | Open in IMG/M |
| 3300018021|Ga0187882_1012749 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5294 | Open in IMG/M |
| 3300018021|Ga0187882_1130600 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
| 3300018021|Ga0187882_1311441 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300018026|Ga0187857_10458974 | Not Available | 572 | Open in IMG/M |
| 3300018033|Ga0187867_10017642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4682 | Open in IMG/M |
| 3300018035|Ga0187875_10249583 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300018037|Ga0187883_10410424 | Not Available | 694 | Open in IMG/M |
| 3300018038|Ga0187855_10718951 | Not Available | 582 | Open in IMG/M |
| 3300018038|Ga0187855_10750317 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
| 3300018042|Ga0187871_10516224 | Not Available | 661 | Open in IMG/M |
| 3300018044|Ga0187890_10095203 | All Organisms → cellular organisms → Bacteria | 1733 | Open in IMG/M |
| 3300018044|Ga0187890_10355010 | Not Available | 822 | Open in IMG/M |
| 3300018044|Ga0187890_10664981 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
| 3300018047|Ga0187859_10549407 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300018062|Ga0187784_11291327 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300018062|Ga0187784_11541706 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300018085|Ga0187772_10161723 | Not Available | 1487 | Open in IMG/M |
| 3300018085|Ga0187772_10166288 | All Organisms → cellular organisms → Bacteria | 1467 | Open in IMG/M |
| 3300018085|Ga0187772_10698667 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 727 | Open in IMG/M |
| 3300018085|Ga0187772_11131399 | Not Available | 575 | Open in IMG/M |
| 3300018086|Ga0187769_11063332 | Not Available | 612 | Open in IMG/M |
| 3300018086|Ga0187769_11224429 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300018088|Ga0187771_10015675 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5578 | Open in IMG/M |
| 3300018468|Ga0066662_10167487 | All Organisms → cellular organisms → Bacteria | 1688 | Open in IMG/M |
| 3300018468|Ga0066662_11526604 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 695 | Open in IMG/M |
| 3300018482|Ga0066669_11586210 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 597 | Open in IMG/M |
| 3300019787|Ga0182031_1273593 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1733 | Open in IMG/M |
| 3300019787|Ga0182031_1413133 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1649 | Open in IMG/M |
| 3300019787|Ga0182031_1425500 | Not Available | 2903 | Open in IMG/M |
| 3300019787|Ga0182031_1543102 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2831 | Open in IMG/M |
| 3300019878|Ga0193715_1034182 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
| 3300019879|Ga0193723_1162975 | Not Available | 588 | Open in IMG/M |
| 3300019996|Ga0193693_1021168 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1207 | Open in IMG/M |
| 3300020002|Ga0193730_1135124 | Not Available | 665 | Open in IMG/M |
| 3300020006|Ga0193735_1077283 | Not Available | 955 | Open in IMG/M |
| 3300020006|Ga0193735_1108424 | Not Available | 767 | Open in IMG/M |
| 3300020021|Ga0193726_1237437 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 746 | Open in IMG/M |
| 3300020021|Ga0193726_1265129 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300020170|Ga0179594_10159815 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300020199|Ga0179592_10140909 | Not Available | 1104 | Open in IMG/M |
| 3300020580|Ga0210403_10209761 | All Organisms → cellular organisms → Bacteria | 1598 | Open in IMG/M |
| 3300020580|Ga0210403_10819145 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300020582|Ga0210395_10009682 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7187 | Open in IMG/M |
| 3300020582|Ga0210395_10560732 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300020582|Ga0210395_10624126 | Not Available | 808 | Open in IMG/M |
| 3300020583|Ga0210401_10127752 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2383 | Open in IMG/M |
| 3300021088|Ga0210404_10080951 | All Organisms → cellular organisms → Bacteria | 1600 | Open in IMG/M |
| 3300021168|Ga0210406_10449474 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300021170|Ga0210400_10370618 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
| 3300021170|Ga0210400_10712193 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 825 | Open in IMG/M |
| 3300021178|Ga0210408_10857988 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 709 | Open in IMG/M |
| 3300021362|Ga0213882_10425985 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
| 3300021404|Ga0210389_11028942 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300021407|Ga0210383_10756436 | Not Available | 833 | Open in IMG/M |
| 3300021432|Ga0210384_10581155 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
| 3300021477|Ga0210398_10515618 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 973 | Open in IMG/M |
| 3300021477|Ga0210398_10540321 | Not Available | 948 | Open in IMG/M |
| 3300021478|Ga0210402_10937700 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300021478|Ga0210402_11741320 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300022557|Ga0212123_10166626 | All Organisms → cellular organisms → Bacteria | 1678 | Open in IMG/M |
| 3300022557|Ga0212123_10675918 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 639 | Open in IMG/M |
| 3300023250|Ga0224544_1007757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1446 | Open in IMG/M |
| 3300025442|Ga0208034_1075490 | Not Available | 621 | Open in IMG/M |
| 3300025444|Ga0208189_1054717 | Not Available | 749 | Open in IMG/M |
| 3300025604|Ga0207930_1031727 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1412 | Open in IMG/M |
| 3300025898|Ga0207692_10764364 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 630 | Open in IMG/M |
| 3300025899|Ga0207642_10652964 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 659 | Open in IMG/M |
| 3300025913|Ga0207695_10042304 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4868 | Open in IMG/M |
| 3300025915|Ga0207693_10377198 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
| 3300025915|Ga0207693_10429591 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1033 | Open in IMG/M |
| 3300025922|Ga0207646_10339887 | All Organisms → cellular organisms → Bacteria | 1356 | Open in IMG/M |
| 3300025922|Ga0207646_11380651 | Not Available | 613 | Open in IMG/M |
| 3300025931|Ga0207644_10083497 | All Organisms → cellular organisms → Bacteria | 2366 | Open in IMG/M |
| 3300025992|Ga0208775_1005654 | Not Available | 895 | Open in IMG/M |
| 3300026116|Ga0207674_10856765 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 876 | Open in IMG/M |
| 3300026271|Ga0209880_1034796 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
| 3300026296|Ga0209235_1215451 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300026308|Ga0209265_1120782 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300026315|Ga0209686_1022203 | All Organisms → cellular organisms → Bacteria | 2512 | Open in IMG/M |
| 3300026318|Ga0209471_1091074 | All Organisms → cellular organisms → Bacteria | 1332 | Open in IMG/M |
| 3300026324|Ga0209470_1330603 | Not Available | 552 | Open in IMG/M |
| 3300026355|Ga0257149_1040799 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300026358|Ga0257166_1010902 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1121 | Open in IMG/M |
| 3300026524|Ga0209690_1002765 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 10001 | Open in IMG/M |
| 3300026547|Ga0209156_10240911 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 845 | Open in IMG/M |
| 3300026551|Ga0209648_10118666 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2138 | Open in IMG/M |
| 3300027109|Ga0208603_1034766 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300027266|Ga0209215_1015907 | Not Available | 950 | Open in IMG/M |
| 3300027521|Ga0209524_1102199 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300027545|Ga0209008_1006585 | All Organisms → cellular organisms → Bacteria | 2757 | Open in IMG/M |
| 3300027546|Ga0208984_1076098 | Not Available | 724 | Open in IMG/M |
| 3300027562|Ga0209735_1030178 | Not Available | 1135 | Open in IMG/M |
| 3300027570|Ga0208043_1190837 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300027625|Ga0208044_1053825 | All Organisms → cellular organisms → Bacteria | 1276 | Open in IMG/M |
| 3300027629|Ga0209422_1041422 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
| 3300027635|Ga0209625_1043160 | Not Available | 1007 | Open in IMG/M |
| 3300027643|Ga0209076_1114588 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300027667|Ga0209009_1144989 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300027674|Ga0209118_1148649 | Not Available | 647 | Open in IMG/M |
| 3300027701|Ga0209447_10057796 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
| 3300027737|Ga0209038_10238698 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300027812|Ga0209656_10229677 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300027824|Ga0209040_10018230 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4642 | Open in IMG/M |
| 3300027824|Ga0209040_10098680 | All Organisms → cellular organisms → Bacteria | 1658 | Open in IMG/M |
| 3300027824|Ga0209040_10450922 | Not Available | 585 | Open in IMG/M |
| 3300027826|Ga0209060_10499726 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300027862|Ga0209701_10453032 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300027879|Ga0209169_10133979 | All Organisms → cellular organisms → Bacteria | 1288 | Open in IMG/M |
| 3300027879|Ga0209169_10595901 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300027884|Ga0209275_10463309 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 720 | Open in IMG/M |
| 3300027889|Ga0209380_10272177 | Not Available | 995 | Open in IMG/M |
| 3300027889|Ga0209380_10686211 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300027903|Ga0209488_10669409 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300027903|Ga0209488_10841621 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 647 | Open in IMG/M |
| 3300027908|Ga0209006_10294705 | All Organisms → cellular organisms → Bacteria | 1386 | Open in IMG/M |
| 3300027911|Ga0209698_11337675 | Not Available | 523 | Open in IMG/M |
| 3300028572|Ga0302152_10257922 | Not Available | 570 | Open in IMG/M |
| 3300028748|Ga0302156_10426328 | Not Available | 574 | Open in IMG/M |
| 3300028780|Ga0302225_10292368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 773 | Open in IMG/M |
| 3300028906|Ga0308309_10697632 | Not Available | 882 | Open in IMG/M |
| 3300028906|Ga0308309_10805321 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300029916|Ga0302148_1030829 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1559 | Open in IMG/M |
| 3300029939|Ga0311328_11131698 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 504 | Open in IMG/M |
| 3300029945|Ga0311330_10661119 | Not Available | 811 | Open in IMG/M |
| 3300029993|Ga0302304_10299276 | Not Available | 588 | Open in IMG/M |
| 3300030000|Ga0311337_10213961 | All Organisms → cellular organisms → Bacteria | 1587 | Open in IMG/M |
| 3300030054|Ga0302182_10040979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2108 | Open in IMG/M |
| 3300030054|Ga0302182_10431574 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300030054|Ga0302182_10504541 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300030057|Ga0302176_10163727 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300030520|Ga0311372_10018615 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 14775 | Open in IMG/M |
| 3300030520|Ga0311372_10336344 | All Organisms → cellular organisms → Bacteria | 2347 | Open in IMG/M |
| 3300030520|Ga0311372_12137375 | Not Available | 648 | Open in IMG/M |
| 3300030629|Ga0210268_1088503 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 827 | Open in IMG/M |
| 3300030659|Ga0316363_10276090 | Not Available | 677 | Open in IMG/M |
| 3300030659|Ga0316363_10406159 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300030707|Ga0310038_10264499 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 790 | Open in IMG/M |
| 3300030974|Ga0075371_10757742 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 810 | Open in IMG/M |
| 3300031090|Ga0265760_10389650 | Not Available | 502 | Open in IMG/M |
| 3300031231|Ga0170824_117160109 | All Organisms → cellular organisms → Bacteria | 1913 | Open in IMG/M |
| 3300031235|Ga0265330_10358855 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300031236|Ga0302324_101553163 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300031474|Ga0170818_101530133 | All Organisms → cellular organisms → Bacteria | 1163 | Open in IMG/M |
| 3300031546|Ga0318538_10050051 | All Organisms → cellular organisms → Bacteria | 2038 | Open in IMG/M |
| 3300031718|Ga0307474_10490137 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 963 | Open in IMG/M |
| 3300031718|Ga0307474_10716228 | Not Available | 791 | Open in IMG/M |
| 3300031753|Ga0307477_10544595 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300031754|Ga0307475_10652183 | Not Available | 841 | Open in IMG/M |
| 3300031754|Ga0307475_10901526 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 698 | Open in IMG/M |
| 3300031754|Ga0307475_11484359 | Not Available | 520 | Open in IMG/M |
| 3300031770|Ga0318521_10284768 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
| 3300031823|Ga0307478_10208163 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1576 | Open in IMG/M |
| 3300031823|Ga0307478_10880239 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 749 | Open in IMG/M |
| 3300031823|Ga0307478_11300428 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 604 | Open in IMG/M |
| 3300032068|Ga0318553_10553691 | Not Available | 603 | Open in IMG/M |
| 3300032160|Ga0311301_10538615 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1713 | Open in IMG/M |
| 3300032174|Ga0307470_11445952 | Not Available | 569 | Open in IMG/M |
| 3300032805|Ga0335078_10105472 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4061 | Open in IMG/M |
| 3300032892|Ga0335081_12323716 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 560 | Open in IMG/M |
| 3300032893|Ga0335069_10946678 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 959 | Open in IMG/M |
| 3300032897|Ga0335071_10840658 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300033004|Ga0335084_12130549 | Not Available | 544 | Open in IMG/M |
| 3300033134|Ga0335073_10156749 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2876 | Open in IMG/M |
| 3300033158|Ga0335077_11177278 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300033290|Ga0318519_10922786 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300033405|Ga0326727_10494177 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
| 3300033412|Ga0310810_10131465 | All Organisms → cellular organisms → Bacteria | 2938 | Open in IMG/M |
| 3300033891|Ga0334811_101281 | Not Available | 735 | Open in IMG/M |
| 3300034163|Ga0370515_0085425 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1368 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.78% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.69% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.39% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.99% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.19% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.59% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.59% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.29% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.69% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.40% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.40% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.99% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.99% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.10% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.10% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.80% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.20% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.20% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.20% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.50% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.50% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.50% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.90% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.90% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.60% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.60% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.60% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.60% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.30% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.30% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.30% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.30% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.30% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.30% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.30% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.30% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.30% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.30% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.30% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.30% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.30% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000579 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001180 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005880 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_201 | Environmental | Open in IMG/M |
| 3300005898 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_405 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009618 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100 | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009630 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 | Environmental | Open in IMG/M |
| 3300009634 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 | Environmental | Open in IMG/M |
| 3300009639 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013766 | Permafrost microbial communities from Nunavut, Canada - A26_65cm_6M | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
| 3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
| 3300018021 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300019996 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a2 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300023250 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 10-14 | Environmental | Open in IMG/M |
| 3300025442 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025444 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025604 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025992 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_104 (SPAdes) | Environmental | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026271 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026355 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-A | Environmental | Open in IMG/M |
| 3300026358 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-B | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027109 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008 (SPAdes) | Environmental | Open in IMG/M |
| 3300027266 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028572 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300028748 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029916 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_1 | Environmental | Open in IMG/M |
| 3300029939 | I_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029945 | I_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029993 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300030000 | I_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030629 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO153-ARE093SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300030974 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Host-Associated | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033891 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-1-D | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AP72_2010_repI_A01DRAFT_10061061 | 3300000579 | Forest Soil | MISESHSLQQLFQDLVGRHYAEEIGIRDPQIVAYVSHLLAEF |
| JGI1027J12803_1089506272 | 3300000955 | Soil | MIPESHPLQQLFVDLVGRHYAEEIGIRDPQLIGYVAH |
| JGI12695J13573_10003031 | 3300001180 | Forest Soil | MIPESHPLRKLFQELVGRHYAEEIGIRDPEVVAYVSHLLT |
| JGI12712J15308_100503862 | 3300001471 | Forest Soil | MIPESHPLQELFQDLVGRHYAEEIGIRDPQVVAYVSHLL |
| JGI12712J15308_100913131 | 3300001471 | Forest Soil | MDIPETHPLQQLFLELVGRHYAEEIGIRDPQLVSYVAQLLSEFCDAEQLL |
| JGI12635J15846_105854892 | 3300001593 | Forest Soil | MIPESHPLRQLFQELVGRHYAQEIGIRDPEVVAYV |
| JGI12053J15887_105351281 | 3300001661 | Forest Soil | MTSEAHPLQQLFVDLVGRHYAEEIGIRDPQIISYVAHLLSEFCDAEQ |
| JGI12627J18819_101174541 | 3300001867 | Forest Soil | MIPESHPLQDLFQDLVGRHYAEEIGIRDPQVVAYVSHLLAEFCDAEQ |
| JGIcombinedJ26739_1000843925 | 3300002245 | Forest Soil | MEIPEKHPLEELFIELVGRHYAQEIGIRDPQVVNYVAHL |
| JGIcombinedJ26739_1009173352 | 3300002245 | Forest Soil | MDIPETHPLQQLFLELVGRHYAEEIGIRDPQLVSYVAQLLSEFCDAE |
| JGIcombinedJ26739_1013729802 | 3300002245 | Forest Soil | MIPESHPLQQLFVELIGRHYAEEIGIRDPQIVNYVAHLM |
| JGI25385J37094_102230951 | 3300002558 | Grasslands Soil | MIQESHPLQQLFVELVGRHYAEEIGIRDPQIVNYVAHLLGEFCEAEQL |
| JGI25383J37093_101148391 | 3300002560 | Grasslands Soil | MIPESHPLQQLFIELVGRHYAEEIGIRDPQIVNYVSHLLAEFCDAEQL |
| Ga0062385_109166531 | 3300004080 | Bog Forest Soil | MEIPETHPLQQLFVELVGRHYAEEIGIRDPQVVNYVAQLLSEFCDAEQLLKIRNASGKKLND |
| Ga0062387_1014483922 | 3300004091 | Bog Forest Soil | LEAEFGGPKTMIPESHPLQQLFIELIGRHYAEEIGIRDPQIVNYVAHLMAEFC |
| Ga0062387_1014582401 | 3300004091 | Bog Forest Soil | MGHTQGGNGAMEIPETHPLQQLFLELVGRHYAEEIGIRDPQVVNYVAQLLSEFCDAEQ |
| Ga0062387_1016268562 | 3300004091 | Bog Forest Soil | MIPESHPLRQLFQELVGRRYAEEIGIRDPEIVAYVSNLLA |
| Ga0062389_1017488662 | 3300004092 | Bog Forest Soil | MIPESHPLQQLFVELIGRHYAEEIGIRDPQIVNYVAHLMAEFC |
| Ga0062386_1004752681 | 3300004152 | Bog Forest Soil | MDREMISETHPLQKLFLELVGRHYADEIGIRDPQIVGYVAHLLSEFCDAE |
| Ga0062388_1011767752 | 3300004635 | Bog Forest Soil | MEIPETHPLQKLFLELVGRHYAEEIGIRDPQLVGYVAHLLAEFCDAEQLL |
| Ga0066672_100873751 | 3300005167 | Soil | MEMIPESHPLQQLFLELVGRHYAEEIGIRDPQLVNYVAHLLSEF |
| Ga0066677_103025001 | 3300005171 | Soil | MIPESHPLQQLFLDVVGRHYAEEIGLRNPQLVGYVAHLLAEFCDVEQL |
| Ga0066690_100056321 | 3300005177 | Soil | MIPESHPLQQLFVELVGRHYAEEIGLRDPQLIAYVAHLLS |
| Ga0066685_101464373 | 3300005180 | Soil | MIPESHPLQQLFLDVVGRHYAEEIGLRNPQLVGYVAHLLAE |
| Ga0066671_103052823 | 3300005184 | Soil | MIPESHPLQQLFQDLVGQHYADEIGIRDPQVVAYVSHLLAEFCES |
| Ga0066671_108217341 | 3300005184 | Soil | MFREALMISDDHPLQQLFMDLVARHYAHEIGIRDPELVGYVAHL |
| Ga0070709_101203001 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MIPESHPLQQLFQELVGRHYAEEIGIRDPQVVAYVSTLLAEFCDTEQL |
| Ga0070713_1003786401 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MISETHPLQDLFQDLVGRHYAEEIGIRDPQVVAYVSHLLAEFCDAEQ |
| Ga0070733_100198711 | 3300005541 | Surface Soil | MIPESHPLRQLFLELVGRHYAEEIGIRDPQIVNYVA |
| Ga0070733_102847043 | 3300005541 | Surface Soil | MIEESHPLQQLFEDLVGRHYAEEIGIRDPQIVAYVSHLLAE |
| Ga0070732_102148921 | 3300005542 | Surface Soil | MIPEAHPLQQLFQDLVGRHYAEEIGIRDPQIVAYVSHLL |
| Ga0070732_104016812 | 3300005542 | Surface Soil | MIPESHPLQQLFVELIGRHYAEEIGIRDPQIVNYV |
| Ga0066670_109865602 | 3300005560 | Soil | MLSESHPLQQLFIELVGRHYAEEIGIRDPQVVNYVAQLLTE |
| Ga0066705_109758221 | 3300005569 | Soil | MSVIPESHPLRQFFSEMVGRHYAEEIGIRDPQLIAYVAHLLT |
| Ga0066654_100497551 | 3300005587 | Soil | MVSDDHPLQQLFLEMVGRHYADEIGIRDSELVGYVAHVLAEFCDAEQLF |
| Ga0070762_106214161 | 3300005602 | Soil | MEIPETHPLQQLFLELVGRHYAEEIGIRDPQVVNYVAQLLSEFCDAEQLMKIRNTSGKPLNDVGE |
| Ga0068856_1001438671 | 3300005614 | Corn Rhizosphere | MIPDDHPLQRMFLEMVGRHYAEEIGIRDQEVVGYVAHLLAEFCDAEQLF |
| Ga0070764_106741422 | 3300005712 | Soil | MEIPETHPLQQLFLELVGRHYAEEIGIRDPQVVNYVAQLLSEFCDAEQLMKI |
| Ga0066903_1078084462 | 3300005764 | Tropical Forest Soil | MISDGHPLQKLFTELVGRHYAHEIGIRDQDVVAYVAHLLTEF |
| Ga0075298_10354771 | 3300005880 | Rice Paddy Soil | MIPESHPLQQLFQDLVGQHYAHEIGIRDPQVVAYVSHLLAEFCEAD |
| Ga0075276_100862041 | 3300005898 | Rice Paddy Soil | MIPESHPLQQLFQEMVTEKFAQDIGLRDPQVSQYVACVLT |
| Ga0066790_101678902 | 3300005995 | Soil | MDREMIPEKHPLQQLFLELVGRHYAQEIGIRDPQLVSYV |
| Ga0070717_104400901 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MIPDDHPLQRLFIEMVGRHYAHEIGIRDPELVGYVAHLLAEFCD |
| Ga0070717_105625602 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MISDDHPLQKLFLEMVGRHYAHEIGIRDSEVVGYVAHLMAEFCDAEQLFK |
| Ga0070717_121024331 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MTVIPESHPLRQFFTEMVGRHYAEEIGIRDPQLIAYV |
| Ga0066656_102827603 | 3300006034 | Soil | MVSDDHPLQQLFLEMVGRHYADEIGIRDSELVGYVAHVLAEFCDAEQ |
| Ga0075029_1000392184 | 3300006052 | Watersheds | MIPEAHPLQQLFQDLVGRHYAEEIGIRDPQVVAYVSH |
| Ga0075017_10000201814 | 3300006059 | Watersheds | MIPEAHPLQQLFQDLVGRHYAEEIGIRDPQVVAYVSHLL |
| Ga0075019_105559251 | 3300006086 | Watersheds | MISETHPLQQLFVELVGRHYAQEIGIRDPQVIGYVSHLLAEFCDAEQL |
| Ga0075030_1011144502 | 3300006162 | Watersheds | MIPEAHPLQRLFQDLVGRHYAGEIGIRDPQVVAYVSHLL |
| Ga0070716_1005887871 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MISETHPLQDLFQDLVGRHYAEEIGIRDPQVVAYVSHLLAEFCDAEQLFKI |
| Ga0070716_1007521312 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MISESHPLQELFQDLVGRHYAEEIGIRDPQIVAYVSHL |
| Ga0075014_1001899813 | 3300006174 | Watersheds | METIPETHPLQQLFVELVGRHYAQEIGIRDPQLVSYVAHLLSEFCDA |
| Ga0075014_1002514171 | 3300006174 | Watersheds | MIPEAHPLQNLFQDLVGRHYAEEIGIRDPQIVAYVSHLLAEFCEADQL |
| Ga0075014_1009664712 | 3300006174 | Watersheds | MIPETHPLQKLFVELVGRHYAQEIGIRDPQVVGYVAH |
| Ga0097621_1005762563 | 3300006237 | Miscanthus Rhizosphere | MIPETHPLQKLFVEMVGRHYAEEIGIRDPQIVAYVAHLLT |
| Ga0066658_106691811 | 3300006794 | Soil | MIQESHPLQQLFVELVGRHYAEEIGIRDPQIVNYVAHLLGEFCEA* |
| Ga0066665_101114874 | 3300006796 | Soil | MIPESHALQELFQGLVGRHYGEEIGIRDPQIVAYVSHLLAEFCDV |
| Ga0066660_116370763 | 3300006800 | Soil | MISDDHPLQELFMELVARHYAHEIGIRDPELVGYVSHLL |
| Ga0075434_1008301882 | 3300006871 | Populus Rhizosphere | MHSESSPLQQFFLELVGRHYAEEIGIRDPQVVNYVSQLLAEFCEVDQLFRIRDAA |
| Ga0068865_1000532416 | 3300006881 | Miscanthus Rhizosphere | MIPETHPLQKLFVEMVGRHYAEEIGIRDPQIVAYVAHL |
| Ga0099793_101461583 | 3300007258 | Vadose Zone Soil | MIQESHPLQQLFVELVGRHYAEEIGIRDPQIVNYVAHLLGEF |
| Ga0099828_101753383 | 3300009089 | Vadose Zone Soil | MIPESHPLQQLFIELVGRHYAEEIGLRDPQIVNYVA |
| Ga0099828_110861302 | 3300009089 | Vadose Zone Soil | MIAESHPLQQLFIELVGRHYAEEIGIRDPQIVNYVS |
| Ga0066709_1014477811 | 3300009137 | Grasslands Soil | MIPESHPLQQLFQDLVGRHYAEEIGIRDPQIVAYVSHLLAEFCETDQ |
| Ga0099792_111534151 | 3300009143 | Vadose Zone Soil | MIQESHPLQQLFVELVGRHYAEEIGIRDPQIVNYV |
| Ga0116214_12892601 | 3300009520 | Peatlands Soil | MEIPETHPLQQLFVELVGRHYAEEIGIRDPQLVGYVAHLLSEF |
| Ga0116214_13425071 | 3300009520 | Peatlands Soil | MIPESHPLQQLFQDLVGRHYAGEIGIRDPQIVAYVSHL |
| Ga0116222_12315522 | 3300009521 | Peatlands Soil | MEMIPETHPLQQLFLELVGRHYAEEIGIRDPQVVGYVAHLLSEFCDAE |
| Ga0116221_13413221 | 3300009523 | Peatlands Soil | MIPESHPLQQLFQDLVGRHYAAEIGIRDPQVVAYVSHLLAEFCE |
| Ga0116225_10712263 | 3300009524 | Peatlands Soil | MIPESHPLQQLFVELIGRHYAEEIGIRDPQIVNYVAHLMA |
| Ga0116220_104259311 | 3300009525 | Peatlands Soil | MIPESHPLRKLFQELVGRHYAQEIGIRDPEVVSYVSHLLA |
| Ga0116220_104756261 | 3300009525 | Peatlands Soil | MISESHPLQQLFVELIGRHYAEEIGILDPQIVNYVAHL |
| Ga0105237_113321151 | 3300009545 | Corn Rhizosphere | MIPESHPLQQLFEDLVGQHYADEIGIRDQQVVAYVSHLL |
| Ga0116127_10590691 | 3300009618 | Peatland | MIPESHPLRQLFQELVGRHYAEEIGIRDPQVVSYVSHL |
| Ga0116105_10325551 | 3300009624 | Peatland | MEIPETHPLQQLFVELVGRHYAQEIGIRDPQIVGYVAHLLS |
| Ga0116114_11033411 | 3300009630 | Peatland | MEMIPEMHPLQQLFCELVGRHYAEEIGIRDPQVVS |
| Ga0116124_11335391 | 3300009634 | Peatland | MEIPETHPLQLLFLELVGRHYAEEIGIRDPQVVSYVAHLLSEF |
| Ga0116122_12178972 | 3300009639 | Peatland | MATIPETHLLQQLFRELVGRHYAEEIGIRDPQVVSYVAHL |
| Ga0116215_15305981 | 3300009672 | Peatlands Soil | MEIPETHPLQQLFLELVGRHYAEEIGIRDPQVVGYVA |
| Ga0116224_103661692 | 3300009683 | Peatlands Soil | MIPESHPLQQLFQDLVGRHYAEEIGIRDPQIIAYVSHLL |
| Ga0116216_100814483 | 3300009698 | Peatlands Soil | MIPESHPLQQLFIELIGRHYAEEIGIRDPQIVNYVAHLMAEFCEVEQLFKIRNGAD |
| Ga0126374_106970561 | 3300009792 | Tropical Forest Soil | MNVIPESHPLRRFFTDLVGRHYAEEIGIRDPQLIAYVSQLLTE |
| Ga0126374_107556321 | 3300009792 | Tropical Forest Soil | MIPESHPLQQLFVELVGRHYAEEIGIRDPQLISYVAHLLT |
| Ga0126380_110621101 | 3300010043 | Tropical Forest Soil | MIPESHPLQQLFQELVGRHYAEEIGIRDPQVVAYVSTPLAEF |
| Ga0126384_104375821 | 3300010046 | Tropical Forest Soil | MIPESHPLQQLFNELVARHYAQEIGLRDPKLIAYV |
| Ga0126373_100655711 | 3300010048 | Tropical Forest Soil | MIPESHPLRQLFLELVGRHYAEQIGIRDPQVVNYVAHLL |
| Ga0126373_111466241 | 3300010048 | Tropical Forest Soil | MIPESHPLQQLFQELVGRHYAEEIGIRDPQVVAYVSS |
| Ga0074046_108837631 | 3300010339 | Bog Forest Soil | MIPESHPLTQLFQDLVGRHYAHEIGIRDPQIVAYVSHLLAEFCEADQ |
| Ga0074044_100878924 | 3300010343 | Bog Forest Soil | MEIPETHPLQQLFVELVGRHYAEEIGIRDPQVVGYVAHLLSE |
| Ga0074044_101020211 | 3300010343 | Bog Forest Soil | MIPEAHPLQQLFQDLVGRHYAEEIGIRDPQIVAYVSH |
| Ga0074044_103440413 | 3300010343 | Bog Forest Soil | MIPESHPLRQLFQELVGRHYAEEIGIRDPQVVAYVSHLLAEF |
| Ga0126376_129842081 | 3300010359 | Tropical Forest Soil | MISETNPLRQLFVELVGRHYAQEIGIRDPEVVGYVAHLL |
| Ga0126372_130309601 | 3300010360 | Tropical Forest Soil | MSVIPESHPLRQFFTEMVGRHYAEEIGIRDPQLIAYVAQL |
| Ga0126372_132302302 | 3300010360 | Tropical Forest Soil | MNVIPESHPLRQFFTDLVGRHYAEEIGIRDPQLIAYV |
| Ga0134125_103886013 | 3300010371 | Terrestrial Soil | MDPEPEPLEQFFLELVGRRYAEQIGIRDPQIVNYVASLLAEFCDAK |
| Ga0134128_116549441 | 3300010373 | Terrestrial Soil | MIPESHPLQQLFEDLVGQHYADEIGIRDPQVVAYVSHLL |
| Ga0134128_130617581 | 3300010373 | Terrestrial Soil | MIPEDHPLQKMFLELVGRHYADEIGIRDSELVGYVAHLLSEFC |
| Ga0136449_1001585316 | 3300010379 | Peatlands Soil | MEIPETHPLQQLFVELVGRHYAEEIGIRDPQIVSYVA |
| Ga0136449_1020947522 | 3300010379 | Peatlands Soil | MIPESHPLQKLFVELVGRHYAEEIGIRDPQIVNYVAQLMA |
| Ga0136449_1022254881 | 3300010379 | Peatlands Soil | MEIPETHPLQQLFVELVGRHYAEEIGIRDPQVVGYVAHLL |
| Ga0134126_125476912 | 3300010396 | Terrestrial Soil | MIPEAEPLEQFFLELVGRRYAEEIGIRDPQIVNYVASLL |
| Ga0126383_112910081 | 3300010398 | Tropical Forest Soil | MIPEDHPLQKLFLDLVARHYAEEIGIRDSELIAYVAH |
| Ga0126383_127637591 | 3300010398 | Tropical Forest Soil | MIPESHPLQQLFVELIGRHYAEEIGIRDPQLVGYVAH |
| Ga0137392_111885861 | 3300011269 | Vadose Zone Soil | MIAESHPLQQLFIELVGRHYAEQIGIRDPQIVNYVSHLLAEF |
| Ga0137391_105531431 | 3300011270 | Vadose Zone Soil | MEMIPETHPLQQLFLELVGRHYAEEIGIRDPQLVNYVAHLLS |
| Ga0137388_103957111 | 3300012189 | Vadose Zone Soil | MIPEDHPLQKLFMELVGQHYAHEIGIRDPELVAYVAHLLAE |
| Ga0137388_111059002 | 3300012189 | Vadose Zone Soil | MEMIPETHPLQQLFLELVGRHYAEEIGIRDPQLVNYVAHLLSEFC |
| Ga0137383_103399623 | 3300012199 | Vadose Zone Soil | MISDDHPLQKLFIEMVGRHYAHEIGIRDPEVVGYVAH |
| Ga0137363_111153641 | 3300012202 | Vadose Zone Soil | MIPESHPLQQLFLELVGRHYAQEIGIRDPQVVNYVAQLLSEF |
| Ga0137363_113441261 | 3300012202 | Vadose Zone Soil | MEMIPESHPLQQLFLELVGRHYAEEIGIRDPQLVNYVAHLLSE |
| Ga0137362_104626011 | 3300012205 | Vadose Zone Soil | MISESHPLQQLFQELVGRHYAQEIGLRDPQLVAYVAHLLAE |
| Ga0137362_111405621 | 3300012205 | Vadose Zone Soil | MISDDHPLQKLFMELVARHYAHEIGIRDPELVGYVSHL |
| Ga0137381_108496552 | 3300012207 | Vadose Zone Soil | MIPESHPLQQLFQDLVGRHYAEEIGIRDPQIVAYVSHLLAEFCDADQMF |
| Ga0137376_104128971 | 3300012208 | Vadose Zone Soil | MIPESHPLQQLFVDLVGRHYAEEIGIRDPQLISYVAHL |
| Ga0137376_105209651 | 3300012208 | Vadose Zone Soil | MIQESHPLQQLFVELVGRHYAEEIGIRDPQIVNYVAHLLGE |
| Ga0137384_115396381 | 3300012357 | Vadose Zone Soil | MTSESHPLQELFVDMVGRHYAQEIGIRDPQVISYVAHLLSEF |
| Ga0137390_103376341 | 3300012363 | Vadose Zone Soil | MEMIPEKHPLQQLFLELVGRHYAEEIGIRDPQLVNYV |
| Ga0137358_101576663 | 3300012582 | Vadose Zone Soil | MIPESHPLQQLFIELVGRHYAEEIGIRDPQIVNYVSHLLAEFCD |
| Ga0137396_100517511 | 3300012918 | Vadose Zone Soil | MEMIPETHPLQQLFLELVGRHYAEEIGIRDPQLVNYVAHLLSEFCDAEQ |
| Ga0137396_107667491 | 3300012918 | Vadose Zone Soil | MEMIPEKHPLQQLFLELVGRHYAEEIGIRDPQLVNYVAH |
| Ga0126375_120686621 | 3300012948 | Tropical Forest Soil | MKLVSEGAQMIPESHPLQQLFIELVGRHFAQEIGIRDPQIVNYVSHLL |
| Ga0164298_107269392 | 3300012955 | Soil | MIPETHPLSELFVELVGRHYAQEIGIRDPQLEAYV |
| Ga0164303_111669951 | 3300012957 | Soil | MISESHPLQQLFQDLVGRHYAEEIGIRDPQIIAYVSHLLAEF |
| Ga0164301_109979282 | 3300012960 | Soil | VIPESHPLRQLFLDLVSRHYAEELGFHDPEVSAYV |
| Ga0157369_109188362 | 3300013105 | Corn Rhizosphere | MVPESHPLQQLFVELVGRHYAEEIGLRDPQLVAYVS |
| Ga0157369_114256672 | 3300013105 | Corn Rhizosphere | MIPEDHPLQKMFLELVGRHYADEIGIRDSELVGYVAH |
| Ga0157374_121607892 | 3300013296 | Miscanthus Rhizosphere | MISDDHPLQKLFVELVGRHYAHEIGIRDPEVVGYVAHLLTEF |
| Ga0157372_100604796 | 3300013307 | Corn Rhizosphere | MIPESHPLQQLFEDLVGQHYADEIGIRDPQVVAYVSHLLAEFCEVDQL |
| Ga0157372_119624101 | 3300013307 | Corn Rhizosphere | MIPDDHPLQKLFMELVARHYAEEIGIRDSELVGYVAHLLTE |
| Ga0120181_11392421 | 3300013766 | Permafrost | MIPEDHPLQKLFMELVGEHYAHEIGIRDPELVGYV |
| Ga0134078_105255001 | 3300014157 | Grasslands Soil | MIPDDHPLQKLFLELVGRHYAEEIGIRDSEVVGYVAHLLADFCDAEQL |
| Ga0181538_100208125 | 3300014162 | Bog | MIPESHPLRQLFQELVGRHYAEEIGIRDPQVVSYVS |
| Ga0181534_106992372 | 3300014168 | Bog | MEISETHPLQKLFVELVGRHYAEEIGIRDPQIVGYVAHLLSEFCD |
| Ga0181531_100009201 | 3300014169 | Bog | VIPESHALQQFFTELVGKHYAEEIGLRDPEITAYVAHVLVEFCE |
| Ga0181531_101587013 | 3300014169 | Bog | MIPESHPLQQLFQDLVGRHYAQEIGIRDPQIVAYVSHLLAEFCE |
| Ga0181531_102014842 | 3300014169 | Bog | MEIPETHPLQQLFLELVGRHYAEEIGIRDPQIVSYVA |
| Ga0182000_100550501 | 3300014487 | Soil | MIPESHPLQQLFQDLVGQHYADEIGIRDPQVVAYVSHLLAEFC |
| Ga0182013_102472751 | 3300014492 | Bog | MEIPETHPLQQLFRELVGRHYAEEIGIRDPQVVSYVAHLLS |
| Ga0182030_101025696 | 3300014838 | Bog | MIPESHPLQQLFQDLVGRHYAEEIGIRDPQIVAYVSQ |
| Ga0137412_106443701 | 3300015242 | Vadose Zone Soil | MIPESHPLQQLFVDLVGRHYAEEIGIRDPQLISYVAH |
| Ga0134073_103952321 | 3300015356 | Grasslands Soil | VIGNQGDLMIPDDHPLQKMFLEMVGRHYAEEIGIRDQEVVGYVAHLLAEFCDAEQLCKI |
| Ga0182040_104822453 | 3300016387 | Soil | MIPESHPLQQLFEDLVGSQFAEQIGIRDPQIVAYVSHLLA |
| Ga0182038_116298262 | 3300016445 | Soil | MIPESHPLQQLFQDLVGRHYAEEIGIRDPEIVAYVSSLLAEFCDADQ |
| Ga0187818_104046752 | 3300017823 | Freshwater Sediment | MIPESHPLQQLFQDLVGRHYAEEIGIRDPQIVAYVSHLLAEFCE |
| Ga0187806_12321242 | 3300017928 | Freshwater Sediment | MEIPETHPLQQLFLELVGRHYAQEIGIRDPQVVSYVAH |
| Ga0187854_102481852 | 3300017938 | Peatland | MEPISEDHPLQQLFLELVGRHYAQEIGIRDPQIVSYVAHLLSEFCDAEQLL |
| Ga0187808_105367282 | 3300017942 | Freshwater Sediment | MIPESHPLQKLFVELVGRHYAEEIGIRDPQIVNYVAHLMAEFC |
| Ga0187847_101677461 | 3300017948 | Peatland | MGIPETHPLEQLFLELVGRHYAQEIGIRDPQVVNYVAHL |
| Ga0187782_110088381 | 3300017975 | Tropical Peatland | MIPEGHPLQQLFQDLVGRHYAEAIGIRDPQVVAYVSHL |
| Ga0187782_113910582 | 3300017975 | Tropical Peatland | MIPESHALQQLFRELVGRHYAEEIGIRDPQVVNYVAQLLTEFSERDQLSKIR |
| Ga0187823_102512372 | 3300017993 | Freshwater Sediment | MIPESHPPQQLFQDLVGRHYAEEIGIRDQQIVAYVSHLLAEFCDAEQLYKIHN |
| Ga0187823_103102922 | 3300017993 | Freshwater Sediment | VIPESHPLRDLFVELVNRHYTDELRMRDPEVSGYVANML |
| Ga0187816_100990773 | 3300017995 | Freshwater Sediment | MIPESHPLQQLFVEMVGRHYAQQIGVRDPQIVAYVAHLLAEF |
| Ga0187816_101136461 | 3300017995 | Freshwater Sediment | MEISETHPLQRLFGELVGRHYAQEIGIRDPQVVSY |
| Ga0187816_102032632 | 3300017995 | Freshwater Sediment | MIPESHPLQQLFQDLVGRHYAEEIGIRDPQIVAYVSHLLSEFCD |
| Ga0187816_105807561 | 3300017995 | Freshwater Sediment | MEIPETHPLQQLFLELVGRHYAEEIGIRDPQVVGYVAHLLSEFCDVEQ |
| Ga0187816_105902981 | 3300017995 | Freshwater Sediment | MIPESHPLQQLFQDLVGRHYAEEIGIRDPQIVAYVSHLLAE |
| Ga0187804_101902782 | 3300018006 | Freshwater Sediment | MEIPETHPLQQLFVELVGRHYAEEIGIRDSQVVSYVAHLLS |
| Ga0187805_101331881 | 3300018007 | Freshwater Sediment | MIPESHPLRQLFQELVGRHYAEEIGIRDPQVVAYVSHLLTE |
| Ga0187805_101515303 | 3300018007 | Freshwater Sediment | MIPESHPLQQLFQDLVGRHYAEEIGIRDPQIVAYVS |
| Ga0187810_104228741 | 3300018012 | Freshwater Sediment | MIPESHPLQQLFIELVGRHYFEEIGIRDPQIVNYVAHLLAEFCEV |
| Ga0187880_14931911 | 3300018016 | Peatland | MEIPETHPLQQLFLELVGRHYAEEIGIRDPQIVGYV |
| Ga0187886_11374951 | 3300018018 | Peatland | MIPEMHPLQQLFCELVGRHYAEEIGIRDPQVVSYVAHLLAEFCD |
| Ga0187886_11912531 | 3300018018 | Peatland | MDREMIPETHPLQQLFVELVGRHYAEEIGIRDPQIVGYVAHLLSE |
| Ga0187882_10127491 | 3300018021 | Peatland | MEIPETHPLQQLFLELVGRHYAEEIGIRDPQIVGYVAHLLSEF |
| Ga0187882_11306001 | 3300018021 | Peatland | MEIPETHPLQQLFLELVGRHYAEEIGIRDPQIVGYVAHLLSEFCDAEQ |
| Ga0187882_13114411 | 3300018021 | Peatland | MEIPETHPLQQLFLELVGRHYAEEIGIRDPQVVGYVAHLLSEFCDAEQ |
| Ga0187857_104589742 | 3300018026 | Peatland | MEIPETHPLQQLFRELVGRHYADEIGIRDTQVVSYVAHLLSEFC |
| Ga0187867_100176421 | 3300018033 | Peatland | MDREMIPETHPLQQLFVELVGRHYAEEIGIRDPQVVS |
| Ga0187875_102495831 | 3300018035 | Peatland | MEIPETHPLQQLFLELVGRHYAEEIGIRDPQIVGYVAHLLSEFCD |
| Ga0187883_104104242 | 3300018037 | Peatland | VIPESHPLRQLFQELVGRHYAEEIGIRDPQVVAYV |
| Ga0187855_107189511 | 3300018038 | Peatland | MDREMISETHPLQQLFLELVGRHYAEEIGIRDPQIVGYV |
| Ga0187855_107503171 | 3300018038 | Peatland | MIPETHPLQQLFVELVGRHYAQEIGIRDPQVVSYV |
| Ga0187871_105162242 | 3300018042 | Peatland | MIPESHPLRQLFQELVGRHYAEEIGIRDPQVVAYVS |
| Ga0187890_100952031 | 3300018044 | Peatland | MEIPETHPLQQLFLELVGRHYAEEIGIRDPQIVGYVAH |
| Ga0187890_103550101 | 3300018044 | Peatland | MEMIPEMHPLQQLFCELVGRHYAEEIGIRDPQVVSY |
| Ga0187890_106649812 | 3300018044 | Peatland | MDREIIPETHPLQQLFLELVGRHYAEEIGIRDPQIVGYVAQLLSEFCDAEQLLKIRDAAGKPL |
| Ga0187859_105494071 | 3300018047 | Peatland | MISESHPLQKLFVELVGRHYAEEIGIRDPQIVNYVAHLLA |
| Ga0187784_112913272 | 3300018062 | Tropical Peatland | MIPESHALQQLFRELVGRRYAEEIGIRDPQIVNYVAQLLTEFSEWEQLSKIRNA |
| Ga0187784_115417062 | 3300018062 | Tropical Peatland | MEIPETHPLQQLFLELVGRHYAEEIGIRDPQVVGYVAHLLAEFCDVER |
| Ga0187772_101617234 | 3300018085 | Tropical Peatland | MIPESHSLEQLFQDLVGRHYAHEIGIRDPQIVAYVSHLLAEFCET |
| Ga0187772_101662881 | 3300018085 | Tropical Peatland | VGAEFGETMIPEGHPLERFFIELVGRHYAEEIGIRDPRIVNY |
| Ga0187772_106986671 | 3300018085 | Tropical Peatland | VGAGFGETMIPEGHPLEKFFIELVGRHYAEEIGIRDPR |
| Ga0187772_111313991 | 3300018085 | Tropical Peatland | MIPESHPLQQLFQDLVTRHYAHEIGLRDPQIVAYVSHLL |
| Ga0187769_110633321 | 3300018086 | Tropical Peatland | MIPESHPLQQLFQDLVGRHYAQEIGLRDPQIVAYVSQLLAE |
| Ga0187769_112244292 | 3300018086 | Tropical Peatland | MIPESHPLQQLFLDLVGRHYAQEIGIRDPQIVAYVSHLLAEFCEADQL |
| Ga0187771_100156757 | 3300018088 | Tropical Peatland | MIPETHPLERLFAELVGRHFAEEIGIRNPEVVGYVAHLLT |
| Ga0066662_101674871 | 3300018468 | Grasslands Soil | MIPESHPLQQLFVELVGRHYAQEIGLRDPQLTAYVAHLLSE |
| Ga0066662_115266042 | 3300018468 | Grasslands Soil | MIPESHPFQQLFVEMVGRHYAEEIGLRDPQIVAYD |
| Ga0066669_115862101 | 3300018482 | Grasslands Soil | MIQESHPLQQLFVELVGRHYAEEIGIRDPQIVNYVAHLLGEFCEAE |
| Ga0182031_12735935 | 3300019787 | Bog | LQQLFLELVGRHYAQEIGIRDPQIVSYVAHLLSEFAMPSSC |
| Ga0182031_14131332 | 3300019787 | Bog | MDMEPISEDHPLQQLFLELVGRHYAQEIGIRDPQM |
| Ga0182031_14255004 | 3300019787 | Bog | MDMKPISEDHPLQQLFLNWWGVIRQEIGIRDPQIVSYVAHLALGVCDAEQLVKIRNTAGK |
| Ga0182031_15431025 | 3300019787 | Bog | MDMEPISEDHPLQQLFLELVGRHYAQEIGIRDPQIVSYVAHLLSSFAMPSSC |
| Ga0193715_10341821 | 3300019878 | Soil | MIQESHPLQQLFVELVGRHYAEEIGIRDPQIVNYVAHLLG |
| Ga0193723_11629752 | 3300019879 | Soil | MIPESHPLQQLFIELVGRHYAEEIGLRDPQIVNYV |
| Ga0193693_10211682 | 3300019996 | Soil | MIPDDHPLQKLFLEMVGRHYAHEIGIRDPEVVGYVAHMLAEFCDAEQLFK |
| Ga0193730_11351242 | 3300020002 | Soil | MIPESHPLERFFLELVERHYSHDIGLRNPQISNYVANLLT |
| Ga0193735_10772833 | 3300020006 | Soil | MIQESHPLQQLFVELVGRHYAEEIGIRDPQIVNYVA |
| Ga0193735_11084242 | 3300020006 | Soil | VIPESHPLRQLFLDLVSRHYAEELGFHDPEVSAYVANM |
| Ga0193726_12374372 | 3300020021 | Soil | MIPESHPLQQLFKELVARHYAEQIGIRDPQIVGYVAHL |
| Ga0193726_12651292 | 3300020021 | Soil | MIPESHPLQQLFKELVARHYAEEIGIRDPQIVGYVAQLLADFIEVDQMHKIRNAT |
| Ga0179594_101598151 | 3300020170 | Vadose Zone Soil | MIPESHPLQQLFIELVGRHYAEEIGIRDPQIVNYVSHLLAEFCDAEQLF |
| Ga0179592_101409093 | 3300020199 | Vadose Zone Soil | MEMIPEKHPLQQLFLELVGRHYAEEIGIRDPQLVNYVAHL |
| Ga0210403_102097614 | 3300020580 | Soil | MEMIPEKHPLQQLFLELVGRHYAEEIGIRDPQLVNYVAHLLSEFCDAEQLL |
| Ga0210403_108191451 | 3300020580 | Soil | MIPESHPLQQLFIELIGRHYAEEIGIRDPQIVNYVAHLMAEFCEVEQLFKIHNSADKPLTDVG |
| Ga0210395_100096821 | 3300020582 | Soil | MIPESHPLRQLFQELVGRHYAQEIGIRDPQVVAYVSHL |
| Ga0210395_105607321 | 3300020582 | Soil | MISESHPLQQLFVELIGRHYAEEIGIRDPQIVNYVAHLMAEFCEVEQL |
| Ga0210395_106241261 | 3300020582 | Soil | MIPESHPLQQLFIELIGRHYAEEIGIRDPQIVNYVAHL |
| Ga0210401_101277521 | 3300020583 | Soil | MISESHPLQQLFVELIGRHYAEEIGIRDPQIVNYVAHLMAEFCEVE |
| Ga0210404_100809511 | 3300021088 | Soil | MTVIPESHPLRQFFNEMVGRHYAEEIGIRDPQLIAYVAHLL |
| Ga0210406_104494741 | 3300021168 | Soil | MDMEMIPETHPLQQLFLELVGRHYAEEIGIRDPQLVNYVAHLLSEFCDAAQ |
| Ga0210400_103706181 | 3300021170 | Soil | MIPESHPLQELFQDLVGRHYAEEIGIRDPQIVAYVSHLL |
| Ga0210400_107121931 | 3300021170 | Soil | MISDDHPLQKLFLEMVGRHYAHEIGIRDSELVGYVAHLLAEFCDAEQL |
| Ga0210408_108579882 | 3300021178 | Soil | MIPESHLLQQLFQDLVGRHYADEIGIRDPQIVAYV |
| Ga0213882_104259852 | 3300021362 | Exposed Rock | MIPDDHPLQKFFLELVGRHYAEEIGIRDHELVGYVAHLLT |
| Ga0210389_110289421 | 3300021404 | Soil | MEMIPETHPLQQLFLELVGRHYAEEIGIRDPQVVSYVAQLLSEFCDAEQLLKIRNMSGTPLNDV |
| Ga0210383_107564362 | 3300021407 | Soil | MIEESHPLQELFQALVGRHYAEEIGIRDPQVVAYVSH |
| Ga0210384_105811553 | 3300021432 | Soil | MIPESHPLQQLFTELIGRHYAEEIGIRDPQIVAYVSHLMAEF |
| Ga0210398_105156183 | 3300021477 | Soil | MIPESHPLQKLFVELVGRHYAEEIGIRDPQIVNYVAHLLA |
| Ga0210398_105403211 | 3300021477 | Soil | MIPESHPLQQLFVELVGRHYAEEIGIRDPQLISYVAHL |
| Ga0210402_109377001 | 3300021478 | Soil | MIQESHPLQQLFEELVGRHYAEEIGIRDPQIVAYVSHLLAEFCEAEQVY |
| Ga0210402_117413202 | 3300021478 | Soil | MIPETHSLQELFQDLVGRHYAEEIGIRDPQVIAYVSHLLAEF |
| Ga0212123_101666263 | 3300022557 | Iron-Sulfur Acid Spring | MIPEDHPLQKLFMDLVGQHYAHEIGIRDPELVGYVAHLYG |
| Ga0212123_106759181 | 3300022557 | Iron-Sulfur Acid Spring | MIPESHPLQELFQDLVGRHYAEEIGIRDPQIVAYVS |
| Ga0224544_10077573 | 3300023250 | Soil | MEIPETHPLQQLFLELVGRHYAEEIGIRDPQVVNYVAHLLAEFCD |
| Ga0208034_10754901 | 3300025442 | Peatland | MEMIPEMHPLQQLFCELVGRHYAEEIGIRDPQVVSYVAHLLAEFC |
| Ga0208189_10547171 | 3300025444 | Peatland | MEMIPEMHPLQQLFCELVGRHYAEEIGIRDPQVVSYV |
| Ga0207930_10317271 | 3300025604 | Arctic Peat Soil | MIPESHPLQELFQDLVGRHYATEIGIRDPQIVAYVSHLLA |
| Ga0207692_107643641 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MIPESHPLQKLFVEMVGRHYAEEIGLRDPQLVAYVAHLLS |
| Ga0207642_106529642 | 3300025899 | Miscanthus Rhizosphere | MIPEDHPLQKLFLELVARHYAEEIGIRDSELIGYVAH |
| Ga0207695_100423047 | 3300025913 | Corn Rhizosphere | MISDDHPLQKLFLEMVGRHYAHEIGIRDSEVVGYVAHLMA |
| Ga0207693_103771981 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MVPESHPLQQLFEDLVGQHYADEIGIRDPQVVAYVSHLLA |
| Ga0207693_104295911 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MISDDHPLQQLFMDLVARHYAHEIGIRDPELVGYVAHLLTEF |
| Ga0207646_103398873 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MEIPETHPLQQLFLELVSRHYAEEIGIRDPQVVSYV |
| Ga0207646_113806512 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MIQESHPLQQLFVELVGRHYAEEIGIRDPQIVNYVAHL |
| Ga0207644_100834973 | 3300025931 | Switchgrass Rhizosphere | MVPESHPLQQLFVELVGRHYAEEIGLRDPQLVAYVSHLLA |
| Ga0208775_10056542 | 3300025992 | Rice Paddy Soil | MIPESHPLQQLFQDLVGQHYAHEIGIRDPQVVAYVSHLLAEFCEA |
| Ga0207674_108567652 | 3300026116 | Corn Rhizosphere | MIPDDHPLQKLFMELVARHYAEEIGIRDPELIGYVAHLLTEF |
| Ga0209880_10347961 | 3300026271 | Soil | MEMIPETHPLQQLFLELVGRHYAEEIGIRDPQVVSYVAHL |
| Ga0209235_12154511 | 3300026296 | Grasslands Soil | MIPESHPLQKLFVELVGRHYAEEIGIRDPQIVGYVAHLLSEF |
| Ga0209265_11207822 | 3300026308 | Soil | MVSDDHPLQQLFLEMVGRHYADEIGIRDSELVGYVAHVLAEFCDA |
| Ga0209686_10222033 | 3300026315 | Soil | MIPESHPLQQLFVELVGRHYAQEIGLRDPQLTAYVAH |
| Ga0209471_10910741 | 3300026318 | Soil | MIPESHPLQQLFLELVGRHYAQEIGIRDPQVVNYVAQLLSEFCDVEQLMK |
| Ga0209470_13306032 | 3300026324 | Soil | MIQESHPLQQLFVELVGRHYAEEIGIRDPQIVNYVAHLL |
| Ga0257149_10407992 | 3300026355 | Soil | MDMEMIPETHPLQQLFLELVGRHYAEEIGIRDPQLVNYVAHLLSEFCDA |
| Ga0257166_10109021 | 3300026358 | Soil | MEIPETHPLQQLFVELVGRHYAEEIGIRDPQVVGYVAHLLSEF |
| Ga0209690_100276514 | 3300026524 | Soil | MIPESHPLQQLFIELVGRHYAEEIGIRDPQIVNYVSHL |
| Ga0209156_102409111 | 3300026547 | Soil | MISDDHPLQQLFMDLVARHYAHEIGIRDPELVGYVAHLLTE |
| Ga0209648_101186664 | 3300026551 | Grasslands Soil | MDMEMIPETHPLQQLFLELVGRHYAEEIGIRDPQLVNYVAHLLSEFCD |
| Ga0208603_10347661 | 3300027109 | Forest Soil | MIPETHPLQQLFVELVGRHYAEEIGIRDPQIVSYVASLMAEFCDVEQLFKIRNA |
| Ga0209215_10159073 | 3300027266 | Forest Soil | MIPESHPLQDLFQDLVGRHYAEEIGIRDPQVVAYVSHLLAE |
| Ga0209524_11021991 | 3300027521 | Forest Soil | MIPESHPLQQLFIELVGRHYAEEIGIRDPQIVNYVAQLMAEFCEVEQLFKIRN |
| Ga0209008_10065851 | 3300027545 | Forest Soil | MIPESHPLRQLFQELVGRHYAEEIGIRDPQVVAYVSHLL |
| Ga0208984_10760982 | 3300027546 | Forest Soil | MDMEMIPETHPLQQLFLELVGRHYAEEIGIRDPQLVNYVAHL |
| Ga0209735_10301783 | 3300027562 | Forest Soil | MDREMIPETHPLQQLFLELVGRHYAEEIGIRDPQLVNYVAHLLS |
| Ga0208043_11908372 | 3300027570 | Peatlands Soil | MISESHPLQQLFVELIGRHYAEEIGIRDPQIVNYVAHLMAE |
| Ga0208044_10538253 | 3300027625 | Peatlands Soil | MIPESHPLQQLFVELIGRHYAEEIGIRDPQIVNYVAHL |
| Ga0209422_10414223 | 3300027629 | Forest Soil | MDMEMIPETHPLQQLFLELVGRHYAEEIGIRDPQLVNYVAHLLSE |
| Ga0209625_10431601 | 3300027635 | Forest Soil | MIPESHPLQDLFQDLVGRHYAVEIGIRDPQVVAYVS |
| Ga0209076_11145882 | 3300027643 | Vadose Zone Soil | MIPESHPLQQLFVDLVGRHYAEEIGIRDPQLIHYVAHLLTEF |
| Ga0209009_11449892 | 3300027667 | Forest Soil | MTSESHPLQELFVDMVGRHYAQEIGIRDPQVISYVAHLLSE |
| Ga0209118_11486492 | 3300027674 | Forest Soil | MIPEKHPLQQLFLELVGRHYAEEIGIRDPQLVNYV |
| Ga0209447_100577961 | 3300027701 | Bog Forest Soil | MIPESHPLRQLFEELVGRHYAEEIGIRDPQIVNYVAH |
| Ga0209038_102386982 | 3300027737 | Bog Forest Soil | LEAEFGGPKTMIPESHPLQQLFIELIGRHYAEEIGIRDPQIVNYVAHLMAEFCEVEQLFKIRNAADQPITDV |
| Ga0209656_102296771 | 3300027812 | Bog Forest Soil | MAIPETHPLQQLFLELVGRHYAEEIGIRDPQVVNYVAQLLAEFCDAEQLLKIRNASGR |
| Ga0209040_100182306 | 3300027824 | Bog Forest Soil | MAIPETHPLQQLFLELVGRHYAEEIGIRDPQVVNYVAQLLAEFCDAEQ |
| Ga0209040_100986803 | 3300027824 | Bog Forest Soil | MIPESNPLQQLFVDLVGRHYAEEIGLRDPQIVSYVSHLL |
| Ga0209040_104509222 | 3300027824 | Bog Forest Soil | MIPESHPLQHLFQDLVGQHYAREIGIRDPQIIAYVSHLLAEFCE |
| Ga0209060_104997261 | 3300027826 | Surface Soil | MIPESHPLQQLFQDLVGRHYAEEIGIRDPQIVAYVSHLLAEFCETDQL |
| Ga0209701_104530322 | 3300027862 | Vadose Zone Soil | MIPESHPLQQLFIELVGRHYAEEIGIRDPQIVNYVSHLLAEFCDVEQL |
| Ga0209169_101339791 | 3300027879 | Soil | MTAESHPLQELFQDLVGRHYAEEIGIRDPQIIAYVS |
| Ga0209169_105959013 | 3300027879 | Soil | MEMIPETHPLQQLFLELVGRHYAEEIGIRDPQVVNYVAQLLSEFCDAEQLLKIRDTAGRP |
| Ga0209275_104633092 | 3300027884 | Soil | MEIPETHPLQQLFLELVGRHYAEEIGIRDPQVVNYVAQLLSEFCDAEQLMKIRNTSGKPLNDVGEM |
| Ga0209380_102721771 | 3300027889 | Soil | MIPESHPLQQLFLDLVGRHYAEEIGIRDPQIVAYVSH |
| Ga0209380_106862111 | 3300027889 | Soil | MIPESHPLQKLFIELVGRRYAEEIGIRDPQIVNYVAHLMAEFCEVEQLF |
| Ga0209488_106694092 | 3300027903 | Vadose Zone Soil | MEIPETHPLQQLFVELVGRHYAEEIGIRDPQVVGYVAHLLSEFCDAE |
| Ga0209488_108416211 | 3300027903 | Vadose Zone Soil | MIADDHPLQKLFLEMVGRHYAHEIGLRDPEVVGYVA |
| Ga0209006_102947053 | 3300027908 | Forest Soil | MIPESHSLQELFQDLVGRHYAEEIGIRDPQVVAYV |
| Ga0209698_113376751 | 3300027911 | Watersheds | MEIPETHPLQQLFRELVGRHYAEEIGIRDPQVVSYVAHL |
| Ga0302152_102579222 | 3300028572 | Bog | MEISETHPLQKLFVELVGRHYAEEIGIRDPQIVGYVAHLLSEFC |
| Ga0302156_104263281 | 3300028748 | Bog | MEIPEIHPLQKLFVELVGRHYAEEIGIRDPQIVGYVAHLLSEFC |
| Ga0302225_102923682 | 3300028780 | Palsa | MIPESHPLRQLFQELVGRHYAEEIGIRDPQVVAYVSQLLA |
| Ga0308309_106976321 | 3300028906 | Soil | MIPESHPLRKLFQELVGRHYAQEIGIRDPEVVAYVSQ |
| Ga0308309_108053211 | 3300028906 | Soil | MIEESHPLQELFQALVGRHYAEEIGIRDPQVVAYVSHLLAEF |
| Ga0302148_10308291 | 3300029916 | Bog | MEIPETHPLQELFVELVGRHYAEEIGIRDPQIVGYVAHLLSE |
| Ga0311328_111316981 | 3300029939 | Bog | MEIPEIHPLQKLFVELVGRHYAEEIGIRDPQIVGYVAYLLSEFCDAEQL |
| Ga0311330_106611191 | 3300029945 | Bog | MIRESHPLRQLFQELVGRRYAEEVGIRDPELVAYVS |
| Ga0302304_102992761 | 3300029993 | Palsa | MIPESHPLRQLFQELVGRHYAEEIGIRDPQVVAYV |
| Ga0311337_102139613 | 3300030000 | Fen | MIPESHPLQQLFVEMVGRHYAEEIGLRDPQIVNYVAHLMAD |
| Ga0302182_100409793 | 3300030054 | Palsa | MIPESHPLRQLFQDLVGRHYAEAIGIRNPEVVAYVSHLLAEFCDAP |
| Ga0302182_104315741 | 3300030054 | Palsa | MIEESHPLQQLFQALVGRHYAEEIGIRDPQVVAYVSHLLAEF |
| Ga0302182_105045412 | 3300030054 | Palsa | MGTPEKHPLEQLFLELVGRHYAQEIGIRDPQVVNYVAHL |
| Ga0302176_101637273 | 3300030057 | Palsa | MIEESHPLQQLFQALVGRHYAEEIGIRDPQVVAYVSHLLAEFCEADQLF |
| Ga0311372_1001861516 | 3300030520 | Palsa | MIPESHPLRQLFQELVGRHYAEEIGIRDPQVVAYVSHLLA |
| Ga0311372_103363444 | 3300030520 | Palsa | MIPESHPLRQLFQDLVGRHYAEAIGIRNPEVVAYVSHL |
| Ga0311372_121373752 | 3300030520 | Palsa | MIPESHPLQELFQDLVGRHYAEEIGIRDPQVVAYVSHLLSE |
| Ga0210268_10885031 | 3300030629 | Soil | MIPESHPLRQLFQELVGRRYAEEIGIRDPELVAYVSQLLAEFCEAD |
| Ga0316363_102760902 | 3300030659 | Peatlands Soil | MEIPETHPLQQLFLELVGRHYAEEIGIRDPQVVGY |
| Ga0316363_104061592 | 3300030659 | Peatlands Soil | MIPESHPLQQLFLELVGRRYAEEIGIRDPQVVNYVAHLLAEFCD |
| Ga0310038_102644991 | 3300030707 | Peatlands Soil | MIPESHPLQQLFVELIGRHYAEEIGIRDPQIVNYVAH |
| Ga0075371_107577422 | 3300030974 | Soil | MIPESHPLQQLFLELVGRHYAQEIGIRDPQVVNYVA |
| Ga0265760_103896502 | 3300031090 | Soil | MIEESHPLQQLFQALVGRHYAEEIGIRDPQVVAYVSHL |
| Ga0170824_1171601091 | 3300031231 | Forest Soil | MIPESHPLQQLFQDLVGRHYAEEIGIRDPQIVAYVSHL |
| Ga0265330_103588552 | 3300031235 | Rhizosphere | MATISETHPLQQLFRELVGRHYAEEIGIRDPQVVSYVAHLLSE |
| Ga0302324_1015531631 | 3300031236 | Palsa | MEIPETHPLQQLFLELVGRHYAEEIGIRDPQVVNYVAHLLAEFC |
| Ga0170818_1015301333 | 3300031474 | Forest Soil | MIPEDHPLQKLFMDLVGRHYAHEIGIRDPELVGYVAHLLTE |
| Ga0318538_100500512 | 3300031546 | Soil | MTTIPESHPLREFFTELVGRHYAEEIGIRDPELIAY |
| Ga0307474_104901371 | 3300031718 | Hardwood Forest Soil | MISDDHPLQKLFLEMVGRHYAHEIGIRDSEVVGYVAH |
| Ga0307474_107162281 | 3300031718 | Hardwood Forest Soil | MIPESHPLRKLFQELVGRHYAEEIGIRDPQVVAYVSHLLTE |
| Ga0307477_105445951 | 3300031753 | Hardwood Forest Soil | MIPESHPLQQLFTELIGRHYAEEIGIRDPQIVNYVAHLMAEFCEVEQLFKIRNSADQPI |
| Ga0307475_106521831 | 3300031754 | Hardwood Forest Soil | MEMIPEKHPLQQLFLELVGRHYAEEIGIRDPQLVN |
| Ga0307475_109015261 | 3300031754 | Hardwood Forest Soil | MIPESHPLRKLFQELVGRHYAQEIGIRDPQVVAYVSHLLA |
| Ga0307475_114843592 | 3300031754 | Hardwood Forest Soil | MIPESHPLRQFFTEMVGRHYAEEIGIRDPQLIAYVAH |
| Ga0318521_102847683 | 3300031770 | Soil | MTTIPESHPLREFFTELVGRHYAEEIGIRDPELIAYVSQ |
| Ga0307478_102081631 | 3300031823 | Hardwood Forest Soil | MISDDHPLQKLFLEMVGRHYAHEIGIRDAELVGYVAHLLAEFCDA |
| Ga0307478_108802392 | 3300031823 | Hardwood Forest Soil | MIPESHPLQQLFTELIGRHYAEEIGIRDPQIVAYVS |
| Ga0307478_113004281 | 3300031823 | Hardwood Forest Soil | MIPESHPLRQLFQELVGRHYAEEIGIRDPEVVAYVSHLLAEFC |
| Ga0318553_105536912 | 3300032068 | Soil | MTTIPESHPLREFFTELVGRHYAEEIGIRDPELIAYVSQLLTKFC |
| Ga0311301_105386154 | 3300032160 | Peatlands Soil | VECVIRGKLTMVSESHPLQQFFLELVGRRYAEEIGIRDPQIVGYV |
| Ga0307470_114459522 | 3300032174 | Hardwood Forest Soil | MIPESHPLQELFQDLVGRHYAEEIGIRDPQIVAYV |
| Ga0335078_101054721 | 3300032805 | Soil | MIPESHPLQKLFIELVGRHYAEEIGIRDPQIVNYV |
| Ga0335081_123237162 | 3300032892 | Soil | MIPESHALQQLFSELVGRRYAEEIGIRDPQLVNYVAHLL |
| Ga0335069_109466781 | 3300032893 | Soil | MIPESHPLRELFETLVGRHYAHEIGIRDPQIVAYVSQ |
| Ga0335071_108406581 | 3300032897 | Soil | MIPESHPLQQLFLELVGRHYAEEIGIRDPQIVNYVAQLLA |
| Ga0335084_121305491 | 3300033004 | Soil | MIPESHPLQQLFVELVGRHYAEEIGIRDPQLISYVAHLLTE |
| Ga0335073_101567491 | 3300033134 | Soil | VIPESHPLRQLFEELVERHYAHEIGIRDPQIVAYVSHLLAEF |
| Ga0335077_111772782 | 3300033158 | Soil | MIPESHPLQQLFQDLVGRHYAEEIGIRDPQVVAYVSHLLSEFCDADQLYK |
| Ga0318519_109227861 | 3300033290 | Soil | MIPESHSLQQLFEDLVGRHYAEEIGIRDPQIVAYVSH |
| Ga0326727_104941771 | 3300033405 | Peat Soil | MEIPETHPLQQLFRELVGRHYAEEIGIRDPQVVSY |
| Ga0310810_101314655 | 3300033412 | Soil | MIPESHPLQQLFEDLVGQHYADEIGIRDPQVVAYVS |
| Ga0334811_101281_624_734 | 3300033891 | Soil | MEIPETHPLQQLFRELVGHHYAEEIGIRDPQVVSYVA |
| Ga0370515_0085425_1256_1366 | 3300034163 | Untreated Peat Soil | MIPESHPLRQLFQELVGRHYAEEIGIRDPQVVAYVSH |
| ⦗Top⦘ |