Metagenome / Metatranscriptome Family F008338

Basic Information
Family ID	F008338
Family Type	Metagenome / Metatranscriptome
Number of Sequences	335
Average Sequence Length	52 residues
Representative Sequence	MLENLEKELRKWRQSRASKPQREAPSDRRTVKVNGQEVLVVRKKQKPRPE
Number of Associated Samples	238
Number of Associated Scaffolds	335

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	88.36 %
% of genes near scaffold ends (potentially truncated)	32.84 %
% of genes from short scaffolds (< 2000 bps)	89.55 %
Associated GOLD sequencing projects	220
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.33

Most Common Taxonomy
Group	Bacteria (90.149 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil (14.328 % of family members)
Environment Ontology (ENVO)	Unclassified (33.731 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (48.060 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Mixed	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 21.79% β-sheet: 15.38% Coil/Unstructured: 62.82%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 335 Family Scaffolds
PF04545	Sigma70_r4	74.33
PF00293	NUDIX	5.37
PF16576	HlyD_D23	2.39
PF00005	ABC_tran	1.79
PF13437	HlyD_3	1.49
PF06762	LMF1	1.19
PF00076	RRM_1	0.60
PF12704	MacB_PCD	0.60
PF03807	F420_oxidored	0.60
PF00300	His_Phos_1	0.30
PF14134	DUF4301	0.30
PF02518	HATPase_c	0.30
PF04546	Sigma70_ner	0.30
PF02776	TPP_enzyme_N	0.30
PF08448	PAS_4	0.30
PF12700	HlyD_2	0.30
PF14582	Metallophos_3	0.30
PF00012	HSP70	0.30
PF04542	Sigma70_r2	0.30
PF01112	Asparaginase_2	0.30
PF00196	GerE	0.30

COG ID	Name	Functional Category	% Frequency in 335 Family Scaffolds
COG0568	DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)	Transcription [K]	0.60
COG0443	Molecular chaperone DnaK (HSP70)	Posttranslational modification, protein turnover, chaperones [O]	0.30
COG1191	DNA-directed RNA polymerase specialized sigma subunit	Transcription [K]	0.30
COG1446	Isoaspartyl peptidase or L-asparaginase, Ntn-hydrolase superfamily	Amino acid transport and metabolism [E]	0.30
COG1595	DNA-directed RNA polymerase specialized sigma subunit, sigma24 family	Transcription [K]	0.30
COG4941	Predicted RNA polymerase sigma factor, contains C-terminal TPR domain	Transcription [K]	0.30

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	90.45 %
Unclassified	root	N/A	9.55 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	90.45 %
Unclassified	root	N/A	9.55 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	90.15 %
Unclassified	root	N/A	9.55 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	0.30 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	60.90 %
Unclassified	root	N/A	9.55 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1.49 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	0.30 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.30 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	0.60 %

Name	Rank	Taxonomy	Distribution
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	49.55 %
Unclassified	root	N/A	9.55 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1.49 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	0.30 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.30 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.30 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	0.30 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	0.60 %

Name	Rank	Taxonomy	Distribution
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	49.55 %
Unclassified	root	N/A	9.55 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.30 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.30 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.30 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	0.30 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.30 %
Acidimicrobiia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia	0.90 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	0.60 %

Name	Rank	Taxonomy	Distribution
Myxococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	35.82 %
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	10.75 %
Unclassified	root	N/A	9.55 %
Corynebacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales	0.30 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	0.30 %
Desulfuromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales	0.30 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.30 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.30 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.30 %
Acidimicrobiales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales	0.90 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	0.60 %

Name	Rank	Taxonomy	Distribution
unclassified Myxococcales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales	35.82 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	10.75 %
Unclassified	root	N/A	9.55 %
Rhizobium/Agrobacterium group	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group	0.30 %
Mycobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae	0.30 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	0.30 %
Desulfuromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales	0.30 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.30 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.30 %
environmental samples	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → environmental samples	0.90 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	0.60 %

Name	Rank	Taxonomy	Distribution
Myxococcales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	35.82 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	10.75 %
Unclassified	root	N/A	9.55 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	0.30 %
Rhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium	0.30 %
Mycobacterium	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium	0.30 %
Desulfuromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales	0.30 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.30 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.30 %
uncultured Acidimicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → environmental samples → uncultured Acidimicrobiales bacterium	0.90 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	0.60 %

Name	Rank	Taxonomy	Distribution
Myxococcales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	35.82 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	10.75 %
Unclassified	root	N/A	9.55 %
Rhizobium freirei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium freirei	0.30 %
Nematoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda	0.30 %
Mycobacterium tuberculosis complex	species group	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex	0.30 %
Desulfuromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales	0.30 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.30 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.30 %
uncultured Acidimicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → environmental samples → uncultured Acidimicrobiales bacterium	0.90 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	0.60 %

Name	Rank	Taxonomy	Distribution
Myxococcales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	35.82 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	10.75 %
Unclassified	root	N/A	9.55 %
Rhizobium freirei PRF 81	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium freirei → Rhizobium freirei PRF 81	0.30 %
Chromadorea	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea	0.30 %
Mycobacterium tuberculosis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis	0.30 %
Desulfuromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales	0.30 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.30 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.30 %
uncultured Acidimicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → environmental samples → uncultured Acidimicrobiales bacterium	0.90 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	0.60 %

Name	Rank	Taxonomy	Distribution
Myxococcales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	35.82 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	10.75 %
Unclassified	root	N/A	9.55 %
Rhabditida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida	0.30 %
Rhizobium freirei PRF 81	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium freirei → Rhizobium freirei PRF 81	0.30 %
Mycobacterium tuberculosis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis	0.30 %
Desulfuromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales	0.30 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.30 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.30 %
uncultured Acidimicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → environmental samples → uncultured Acidimicrobiales bacterium	0.90 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	0.60 %

Name	Rank	Taxonomy	Distribution
Myxococcales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	35.82 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	10.75 %
Unclassified	root	N/A	9.55 %
Tylenchina	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina	0.30 %
Rhizobium freirei PRF 81	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium freirei → Rhizobium freirei PRF 81	0.30 %
Mycobacterium tuberculosis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis	0.30 %
Desulfuromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales	0.30 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.30 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.30 %
uncultured Acidimicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → environmental samples → uncultured Acidimicrobiales bacterium	0.90 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	0.60 %

Name	Rank	Taxonomy	Distribution
Myxococcales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	35.82 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	10.75 %
Unclassified	root	N/A	9.55 %
Panagrolaimomorpha	infraorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha	0.30 %
Rhizobium freirei PRF 81	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium freirei → Rhizobium freirei PRF 81	0.30 %
Mycobacterium tuberculosis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis	0.30 %
Desulfuromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales	0.30 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.30 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.30 %
uncultured Acidimicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → environmental samples → uncultured Acidimicrobiales bacterium	0.90 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	0.60 %

Name	Rank	Taxonomy	Distribution
Myxococcales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	35.82 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	10.75 %
Unclassified	root	N/A	9.55 %
Strongyloidoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea	0.30 %
Rhizobium freirei PRF 81	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium freirei → Rhizobium freirei PRF 81	0.30 %
Mycobacterium tuberculosis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis	0.30 %
Desulfuromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales	0.30 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.30 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.30 %
uncultured Acidimicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → environmental samples → uncultured Acidimicrobiales bacterium	0.90 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	0.60 %

Name	Rank	Taxonomy	Distribution
Myxococcales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	35.82 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	10.75 %
Unclassified	root	N/A	9.55 %
Strongyloididae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae	0.30 %
Rhizobium freirei PRF 81	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium freirei → Rhizobium freirei PRF 81	0.30 %
Mycobacterium tuberculosis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis	0.30 %
Desulfuromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales	0.30 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.30 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.30 %
uncultured Acidimicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → environmental samples → uncultured Acidimicrobiales bacterium	0.90 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	0.60 %

Name	Rank	Taxonomy	Distribution
Myxococcales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	35.82 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	10.75 %
Unclassified	root	N/A	9.55 %
Parastrongyloides	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides	0.30 %
Rhizobium freirei PRF 81	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium freirei → Rhizobium freirei PRF 81	0.30 %
Mycobacterium tuberculosis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis	0.30 %
Desulfuromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales	0.30 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.30 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.30 %
uncultured Acidimicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → environmental samples → uncultured Acidimicrobiales bacterium	0.90 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	0.60 %

Name	Rank	Taxonomy	Distribution
Myxococcales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	35.82 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	10.75 %
Unclassified	root	N/A	9.55 %
Parastrongyloides trichosuri	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri	0.30 %
Rhizobium freirei PRF 81	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium freirei → Rhizobium freirei PRF 81	0.30 %
Mycobacterium tuberculosis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis	0.30 %
Desulfuromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales	0.30 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.30 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.30 %
uncultured Acidimicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → environmental samples → uncultured Acidimicrobiales bacterium	0.90 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	0.60 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300002560\|JGI25383J37093_10047732	All Organisms → cellular organisms → Bacteria	1391	Open in IMG/M
3300002561\|JGI25384J37096_10029653	All Organisms → cellular organisms → Bacteria	2133	Open in IMG/M
3300002562\|JGI25382J37095_10033613	All Organisms → cellular organisms → Bacteria	2010	Open in IMG/M
3300002908\|JGI25382J43887_10041743	Not Available	2494	Open in IMG/M
3300002908\|JGI25382J43887_10087882	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → environmental samples → uncultured Acidimicrobiales bacterium	1660	Open in IMG/M
3300003203\|JGI25406J46586_10101764	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	856	Open in IMG/M
3300004052\|Ga0055490_10003486	All Organisms → cellular organisms → Bacteria → Proteobacteria	2896	Open in IMG/M
3300004058\|Ga0055498_10080305	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	630	Open in IMG/M
3300004267\|Ga0066396_10051090	All Organisms → cellular organisms → Bacteria	664	Open in IMG/M
3300004463\|Ga0063356_102202016	All Organisms → cellular organisms → Bacteria	839	Open in IMG/M
3300004480\|Ga0062592_100384967	All Organisms → cellular organisms → Bacteria → Proteobacteria	1108	Open in IMG/M
3300004480\|Ga0062592_101440212	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	658	Open in IMG/M
3300004633\|Ga0066395_10258716	All Organisms → cellular organisms → Bacteria	936	Open in IMG/M
3300004643\|Ga0062591_100164452	All Organisms → cellular organisms → Bacteria → Proteobacteria	1572	Open in IMG/M
3300005093\|Ga0062594_102750989	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	546	Open in IMG/M
3300005166\|Ga0066674_10105312	All Organisms → cellular organisms → Bacteria	1312	Open in IMG/M
3300005166\|Ga0066674_10442927	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	594	Open in IMG/M
3300005167\|Ga0066672_10323458	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1005	Open in IMG/M
3300005171\|Ga0066677_10009461	All Organisms → cellular organisms → Bacteria	4163	Open in IMG/M
3300005171\|Ga0066677_10207456	All Organisms → cellular organisms → Bacteria	1099	Open in IMG/M
3300005172\|Ga0066683_10273800	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1048	Open in IMG/M
3300005172\|Ga0066683_10308394	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	983	Open in IMG/M
3300005174\|Ga0066680_10676666	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	637	Open in IMG/M
3300005175\|Ga0066673_10241985	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	1042	Open in IMG/M
3300005175\|Ga0066673_10709048	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	579	Open in IMG/M
3300005181\|Ga0066678_10261030	All Organisms → cellular organisms → Bacteria	1123	Open in IMG/M
3300005183\|Ga0068993_10071373	All Organisms → cellular organisms → Bacteria	1059	Open in IMG/M
3300005294\|Ga0065705_10159880	Not Available	1811	Open in IMG/M
3300005295\|Ga0065707_10565345	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	712	Open in IMG/M
3300005331\|Ga0070670_101047964	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	743	Open in IMG/M
3300005332\|Ga0066388_100300287	All Organisms → cellular organisms → Bacteria	2251	Open in IMG/M
3300005332\|Ga0066388_101397413	All Organisms → cellular organisms → Bacteria → Proteobacteria	1216	Open in IMG/M
3300005332\|Ga0066388_101803689	All Organisms → cellular organisms → Bacteria	1088	Open in IMG/M
3300005332\|Ga0066388_107016077	All Organisms → cellular organisms → Bacteria → Proteobacteria	567	Open in IMG/M
3300005335\|Ga0070666_11374936	All Organisms → cellular organisms → Bacteria	527	Open in IMG/M
3300005340\|Ga0070689_100102146	All Organisms → cellular organisms → Bacteria → Proteobacteria	2271	Open in IMG/M
3300005347\|Ga0070668_101041933	All Organisms → cellular organisms → Bacteria → Proteobacteria	736	Open in IMG/M
3300005440\|Ga0070705_100822136	All Organisms → cellular organisms → Bacteria → Proteobacteria	741	Open in IMG/M
3300005440\|Ga0070705_101648960	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	541	Open in IMG/M
3300005440\|Ga0070705_101669098	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	538	Open in IMG/M
3300005444\|Ga0070694_100577928	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	903	Open in IMG/M
3300005444\|Ga0070694_101808196	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	521	Open in IMG/M
3300005445\|Ga0070708_100541916	All Organisms → cellular organisms → Bacteria → Proteobacteria	1098	Open in IMG/M
3300005445\|Ga0070708_100955681	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	804	Open in IMG/M
3300005445\|Ga0070708_101027736	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	772	Open in IMG/M
3300005445\|Ga0070708_102205127	Not Available	509	Open in IMG/M
3300005446\|Ga0066686_10192606	All Organisms → cellular organisms → Bacteria	1363	Open in IMG/M
3300005447\|Ga0066689_10040966	All Organisms → cellular organisms → Bacteria	2431	Open in IMG/M
3300005447\|Ga0066689_10252806	All Organisms → cellular organisms → Bacteria	1084	Open in IMG/M
3300005455\|Ga0070663_101110223	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	692	Open in IMG/M
3300005467\|Ga0070706_100212762	All Organisms → cellular organisms → Bacteria	1805	Open in IMG/M
3300005467\|Ga0070706_100697435	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	942	Open in IMG/M
3300005467\|Ga0070706_101693796	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	576	Open in IMG/M
3300005468\|Ga0070707_100351796	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1431	Open in IMG/M
3300005468\|Ga0070707_100519737	All Organisms → cellular organisms → Bacteria → Proteobacteria	1152	Open in IMG/M
3300005468\|Ga0070707_100671471	All Organisms → cellular organisms → Bacteria → Proteobacteria	999	Open in IMG/M
3300005468\|Ga0070707_100773202	All Organisms → cellular organisms → Bacteria	924	Open in IMG/M
3300005518\|Ga0070699_100440399	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1181	Open in IMG/M
3300005518\|Ga0070699_101615142	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	594	Open in IMG/M
3300005524\|Ga0070737_10000653	All Organisms → cellular organisms → Bacteria	66167	Open in IMG/M
3300005529\|Ga0070741_10001932	All Organisms → cellular organisms → Bacteria → Proteobacteria	58549	Open in IMG/M
3300005529\|Ga0070741_10001941	All Organisms → cellular organisms → Bacteria	58347	Open in IMG/M
3300005533\|Ga0070734_10000139	All Organisms → cellular organisms → Bacteria	199809	Open in IMG/M
3300005536\|Ga0070697_100091419	All Organisms → cellular organisms → Bacteria	2516	Open in IMG/M
3300005536\|Ga0070697_100103294	All Organisms → cellular organisms → Bacteria	2369	Open in IMG/M
3300005545\|Ga0070695_100196806	All Organisms → cellular organisms → Bacteria → Proteobacteria	1438	Open in IMG/M
3300005545\|Ga0070695_101357066	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	589	Open in IMG/M
3300005546\|Ga0070696_100337025	Not Available	1165	Open in IMG/M
3300005546\|Ga0070696_100590988	All Organisms → cellular organisms → Bacteria → Proteobacteria	894	Open in IMG/M
3300005546\|Ga0070696_100715271	All Organisms → cellular organisms → Bacteria	817	Open in IMG/M
3300005549\|Ga0070704_100893387	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	799	Open in IMG/M
3300005552\|Ga0066701_10041556	All Organisms → cellular organisms → Bacteria	2471	Open in IMG/M
3300005552\|Ga0066701_10085311	All Organisms → cellular organisms → Bacteria	1818	Open in IMG/M
3300005556\|Ga0066707_10123463	All Organisms → cellular organisms → Bacteria → Proteobacteria	1616	Open in IMG/M
3300005556\|Ga0066707_10372883	All Organisms → cellular organisms → Bacteria	931	Open in IMG/M
3300005556\|Ga0066707_10670425	All Organisms → cellular organisms → Bacteria	653	Open in IMG/M
3300005559\|Ga0066700_10247124	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1246	Open in IMG/M
3300005566\|Ga0066693_10492689	Not Available	506	Open in IMG/M
3300005568\|Ga0066703_10414628	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	808	Open in IMG/M
3300005569\|Ga0066705_10279133	All Organisms → cellular organisms → Bacteria	1060	Open in IMG/M
3300005569\|Ga0066705_10397095	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	864	Open in IMG/M
3300005574\|Ga0066694_10178549	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1008	Open in IMG/M
3300005598\|Ga0066706_10013207	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	4693	Open in IMG/M
3300005615\|Ga0070702_101517005	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	552	Open in IMG/M
3300005764\|Ga0066903_104158437	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	775	Open in IMG/M
3300005764\|Ga0066903_104739646	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	724	Open in IMG/M
3300006034\|Ga0066656_10104273	All Organisms → cellular organisms → Bacteria	1726	Open in IMG/M
3300006046\|Ga0066652_101868006	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	540	Open in IMG/M
3300006169\|Ga0082029_1591785	Not Available	1010	Open in IMG/M
3300006173\|Ga0070716_101727588	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	517	Open in IMG/M
3300006175\|Ga0070712_100208459	Not Available	1540	Open in IMG/M
3300006237\|Ga0097621_102086093	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	542	Open in IMG/M
3300006755\|Ga0079222_12178726	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	550	Open in IMG/M
3300006797\|Ga0066659_11158302	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	646	Open in IMG/M
3300006844\|Ga0075428_102142845	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	578	Open in IMG/M
3300006844\|Ga0075428_102536128	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	525	Open in IMG/M
3300006845\|Ga0075421_100522690	All Organisms → cellular organisms → Bacteria	1406	Open in IMG/M
3300006847\|Ga0075431_100576752	All Organisms → cellular organisms → Bacteria → Proteobacteria	1111	Open in IMG/M
3300006852\|Ga0075433_10229550	All Organisms → cellular organisms → Bacteria → Proteobacteria	1648	Open in IMG/M
3300006854\|Ga0075425_100205481	All Organisms → cellular organisms → Bacteria → Proteobacteria	2264	Open in IMG/M
3300006854\|Ga0075425_100556932	Not Available	1319	Open in IMG/M
3300006865\|Ga0073934_10007564	All Organisms → cellular organisms → Bacteria → Proteobacteria	15009	Open in IMG/M
3300006865\|Ga0073934_10374739	All Organisms → cellular organisms → Bacteria → Proteobacteria	883	Open in IMG/M
3300006865\|Ga0073934_10478160	All Organisms → cellular organisms → Bacteria → Proteobacteria	749	Open in IMG/M
3300006904\|Ga0075424_101266325	All Organisms → cellular organisms → Bacteria	784	Open in IMG/M
3300006904\|Ga0075424_101609610	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	689	Open in IMG/M
3300006904\|Ga0075424_102184364	Not Available	583	Open in IMG/M
3300007076\|Ga0075435_101349862	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	625	Open in IMG/M
3300007255\|Ga0099791_10023086	All Organisms → cellular organisms → Bacteria	2688	Open in IMG/M
3300007258\|Ga0099793_10064384	All Organisms → cellular organisms → Bacteria	1645	Open in IMG/M
3300009012\|Ga0066710_100912535	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1352	Open in IMG/M
3300009012\|Ga0066710_102851263	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	681	Open in IMG/M
3300009012\|Ga0066710_103156564	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	635	Open in IMG/M
3300009012\|Ga0066710_103736957	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	572	Open in IMG/M
3300009038\|Ga0099829_10074029	All Organisms → cellular organisms → Bacteria → Proteobacteria	2590	Open in IMG/M
3300009078\|Ga0105106_11212018	Not Available	535	Open in IMG/M
3300009088\|Ga0099830_10550374	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	944	Open in IMG/M
3300009094\|Ga0111539_11599000	All Organisms → cellular organisms → Bacteria	756	Open in IMG/M
3300009100\|Ga0075418_10369069	All Organisms → cellular organisms → Bacteria	1533	Open in IMG/M
3300009100\|Ga0075418_11603600	All Organisms → cellular organisms → Bacteria → Proteobacteria	707	Open in IMG/M
3300009137\|Ga0066709_103244305	All Organisms → cellular organisms → Bacteria	593	Open in IMG/M
3300009137\|Ga0066709_103735916	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	552	Open in IMG/M
3300009147\|Ga0114129_11137089	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	976	Open in IMG/M
3300009147\|Ga0114129_11175672	All Organisms → cellular organisms → Bacteria → Proteobacteria	957	Open in IMG/M
3300009148\|Ga0105243_11695974	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	661	Open in IMG/M
3300009148\|Ga0105243_11978569	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	617	Open in IMG/M
3300009148\|Ga0105243_12725553	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	535	Open in IMG/M
3300009156\|Ga0111538_11667946	All Organisms → cellular organisms → Bacteria	803	Open in IMG/M
3300009162\|Ga0075423_10311077	Not Available	1651	Open in IMG/M
3300009162\|Ga0075423_10578980	Not Available	1182	Open in IMG/M
3300009162\|Ga0075423_11916617	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	640	Open in IMG/M
3300009174\|Ga0105241_10917503	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	814	Open in IMG/M
3300009455\|Ga0114939_10070568	All Organisms → cellular organisms → Bacteria → Proteobacteria	1492	Open in IMG/M
3300009792\|Ga0126374_10390470	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	969	Open in IMG/M
3300009792\|Ga0126374_11516226	Not Available	551	Open in IMG/M
3300009870\|Ga0131092_11087009	All Organisms → cellular organisms → Bacteria → Proteobacteria	639	Open in IMG/M
3300010091\|Ga0127485_1016053	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	842	Open in IMG/M
3300010095\|Ga0127475_1088280	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	813	Open in IMG/M
3300010102\|Ga0127453_1106694	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	540	Open in IMG/M
3300010103\|Ga0127500_1047844	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	795	Open in IMG/M
3300010117\|Ga0127449_1091724	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	770	Open in IMG/M
3300010122\|Ga0127488_1006531	Not Available	956	Open in IMG/M
3300010130\|Ga0127493_1115760	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	635	Open in IMG/M
3300010132\|Ga0127455_1146249	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	610	Open in IMG/M
3300010134\|Ga0127484_1124194	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	563	Open in IMG/M
3300010140\|Ga0127456_1230965	All Organisms → cellular organisms → Bacteria	892	Open in IMG/M
3300010304\|Ga0134088_10609961	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	543	Open in IMG/M
3300010321\|Ga0134067_10233452	All Organisms → cellular organisms → Bacteria → Proteobacteria	687	Open in IMG/M
3300010326\|Ga0134065_10020102	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1875	Open in IMG/M
3300010333\|Ga0134080_10180892	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	906	Open in IMG/M
3300010333\|Ga0134080_10374284	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	654	Open in IMG/M
3300010335\|Ga0134063_10152702	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1071	Open in IMG/M
3300010336\|Ga0134071_10122761	All Organisms → cellular organisms → Bacteria → Proteobacteria	1249	Open in IMG/M
3300010358\|Ga0126370_12048845	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	560	Open in IMG/M
3300010358\|Ga0126370_12638864	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	503	Open in IMG/M
3300010391\|Ga0136847_10010821	All Organisms → cellular organisms → Bacteria → Proteobacteria	7420	Open in IMG/M
3300010391\|Ga0136847_12018326	All Organisms → cellular organisms → Bacteria	1406	Open in IMG/M
3300010399\|Ga0134127_10594027	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1134	Open in IMG/M
3300010400\|Ga0134122_10299569	All Organisms → cellular organisms → Bacteria	1379	Open in IMG/M
3300010400\|Ga0134122_12286505	Not Available	586	Open in IMG/M
3300010401\|Ga0134121_11698048	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	654	Open in IMG/M
3300010403\|Ga0134123_11304608	Not Available	762	Open in IMG/M
3300010403\|Ga0134123_12425357	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	590	Open in IMG/M
3300010938\|Ga0137716_10173217	Not Available	1376	Open in IMG/M
3300011119\|Ga0105246_10457214	All Organisms → cellular organisms → Bacteria	1074	Open in IMG/M
3300012189\|Ga0137388_11569256	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	594	Open in IMG/M
3300012189\|Ga0137388_11790615	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	546	Open in IMG/M
3300012201\|Ga0137365_10551918	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	846	Open in IMG/M
3300012206\|Ga0137380_10131231	All Organisms → cellular organisms → Bacteria	2287	Open in IMG/M
3300012206\|Ga0137380_11420109	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	579	Open in IMG/M
3300012224\|Ga0134028_1251170	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	890	Open in IMG/M
3300012349\|Ga0137387_10979417	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	608	Open in IMG/M
3300012362\|Ga0137361_10145564	All Organisms → cellular organisms → Bacteria	2113	Open in IMG/M
3300012362\|Ga0137361_10159998	All Organisms → cellular organisms → Bacteria	2019	Open in IMG/M
3300012363\|Ga0137390_10899623	All Organisms → cellular organisms → Bacteria	840	Open in IMG/M
3300012371\|Ga0134022_1100655	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	563	Open in IMG/M
3300012372\|Ga0134037_1089331	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	627	Open in IMG/M
3300012376\|Ga0134032_1001926	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	626	Open in IMG/M
3300012383\|Ga0134033_1289743	All Organisms → cellular organisms → Bacteria	1271	Open in IMG/M
3300012388\|Ga0134031_1074658	All Organisms → cellular organisms → Bacteria	1056	Open in IMG/M
3300012390\|Ga0134054_1255362	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → environmental samples → uncultured Acidimicrobiales bacterium	1097	Open in IMG/M
3300012395\|Ga0134044_1086783	All Organisms → cellular organisms → Bacteria	932	Open in IMG/M
3300012396\|Ga0134057_1217251	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis	1098	Open in IMG/M
3300012397\|Ga0134056_1050411	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	622	Open in IMG/M
3300012399\|Ga0134061_1302596	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	541	Open in IMG/M
3300012401\|Ga0134055_1042635	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	768	Open in IMG/M
3300012401\|Ga0134055_1350149	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	591	Open in IMG/M
3300012402\|Ga0134059_1084891	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	646	Open in IMG/M
3300012402\|Ga0134059_1316311	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	551	Open in IMG/M
3300012403\|Ga0134049_1113966	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	531	Open in IMG/M
3300012404\|Ga0134024_1329117	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	547	Open in IMG/M
3300012407\|Ga0134050_1408653	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	510	Open in IMG/M
3300012409\|Ga0134045_1119255	All Organisms → cellular organisms → Bacteria	1031	Open in IMG/M
3300012410\|Ga0134060_1511568	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	554	Open in IMG/M
3300012582\|Ga0137358_10736455	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	659	Open in IMG/M
3300012685\|Ga0137397_10568481	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	844	Open in IMG/M
3300012908\|Ga0157286_10287114	All Organisms → cellular organisms → Bacteria	596	Open in IMG/M
3300012912\|Ga0157306_10121065	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri	788	Open in IMG/M
3300012918\|Ga0137396_10289589	All Organisms → cellular organisms → Bacteria	1210	Open in IMG/M
3300012922\|Ga0137394_10271265	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1451	Open in IMG/M
3300012925\|Ga0137419_10580476	All Organisms → cellular organisms → Bacteria	898	Open in IMG/M
3300012927\|Ga0137416_10247779	All Organisms → cellular organisms → Bacteria	1454	Open in IMG/M
3300012951\|Ga0164300_10877471	Not Available	565	Open in IMG/M
3300012971\|Ga0126369_12259752	Not Available	631	Open in IMG/M
3300012976\|Ga0134076_10030695	All Organisms → cellular organisms → Bacteria	1955	Open in IMG/M
3300012976\|Ga0134076_10135611	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	999	Open in IMG/M
3300012977\|Ga0134087_10052902	All Organisms → cellular organisms → Bacteria	1605	Open in IMG/M
3300014154\|Ga0134075_10341164	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	656	Open in IMG/M
3300014320\|Ga0075342_1224541	Not Available	538	Open in IMG/M
3300014745\|Ga0157377_11315540	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	566	Open in IMG/M
3300015358\|Ga0134089_10476884	Not Available	543	Open in IMG/M
3300015371\|Ga0132258_13014043	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	1167	Open in IMG/M
3300015373\|Ga0132257_101561510	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	843	Open in IMG/M
3300017654\|Ga0134069_1109243	All Organisms → cellular organisms → Bacteria	905	Open in IMG/M
3300017656\|Ga0134112_10211750	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	760	Open in IMG/M
3300017656\|Ga0134112_10239287	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	718	Open in IMG/M
3300017656\|Ga0134112_10382900	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	578	Open in IMG/M
3300017659\|Ga0134083_10020233	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	2342	Open in IMG/M
3300017659\|Ga0134083_10190373	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	844	Open in IMG/M
3300017792\|Ga0163161_10786796	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	798	Open in IMG/M
3300017936\|Ga0187821_10161947	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	849	Open in IMG/M
3300017959\|Ga0187779_10691437	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	689	Open in IMG/M
3300018058\|Ga0187766_10722034	Not Available	690	Open in IMG/M
3300018058\|Ga0187766_11358286	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	520	Open in IMG/M
3300018060\|Ga0187765_10353287	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	895	Open in IMG/M
3300018060\|Ga0187765_11338007	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	509	Open in IMG/M
3300018431\|Ga0066655_10004435	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	5623	Open in IMG/M
3300018431\|Ga0066655_10040295	All Organisms → cellular organisms → Bacteria	2346	Open in IMG/M
3300018431\|Ga0066655_10070755	All Organisms → cellular organisms → Bacteria	1869	Open in IMG/M
3300018431\|Ga0066655_10072242	All Organisms → cellular organisms → Bacteria → Proteobacteria	1853	Open in IMG/M
3300018431\|Ga0066655_10185347	All Organisms → cellular organisms → Bacteria	1272	Open in IMG/M
3300018431\|Ga0066655_10393958	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	913	Open in IMG/M
3300018433\|Ga0066667_10100678	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1922	Open in IMG/M
3300018433\|Ga0066667_10152116	All Organisms → cellular organisms → Bacteria	1634	Open in IMG/M
3300018433\|Ga0066667_10633856	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	893	Open in IMG/M
3300018433\|Ga0066667_10899850	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	761	Open in IMG/M
3300018433\|Ga0066667_12143928	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	518	Open in IMG/M
3300018468\|Ga0066662_10144327	All Organisms → cellular organisms → Bacteria	1787	Open in IMG/M
3300018468\|Ga0066662_10864939	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	884	Open in IMG/M
3300019360\|Ga0187894_10084421	All Organisms → cellular organisms → Bacteria	1737	Open in IMG/M
3300019362\|Ga0173479_10783277	Not Available	525	Open in IMG/M
3300019458\|Ga0187892_10369738	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	692	Open in IMG/M
3300019487\|Ga0187893_10457581	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	845	Open in IMG/M
3300019487\|Ga0187893_10928146	Not Available	518	Open in IMG/M
3300020170\|Ga0179594_10285740	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	624	Open in IMG/M
3300021151\|Ga0179584_1481753	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	610	Open in IMG/M
3300023444\|Ga0256747_1327587	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	695	Open in IMG/M
3300024330\|Ga0137417_1150400	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	877	Open in IMG/M
3300024330\|Ga0137417_1204725	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1454	Open in IMG/M
3300025310\|Ga0209172_10053666	All Organisms → cellular organisms → Bacteria	2487	Open in IMG/M
3300025324\|Ga0209640_11290879	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	542	Open in IMG/M
3300025901\|Ga0207688_10439476	All Organisms → cellular organisms → Bacteria	812	Open in IMG/M
3300025907\|Ga0207645_10178899	All Organisms → cellular organisms → Bacteria	1391	Open in IMG/M
3300025908\|Ga0207643_10090811	All Organisms → cellular organisms → Bacteria → Proteobacteria	1781	Open in IMG/M
3300025910\|Ga0207684_10675022	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	879	Open in IMG/M
3300025922\|Ga0207646_10258168	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1575	Open in IMG/M
3300025922\|Ga0207646_11065082	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	713	Open in IMG/M
3300025922\|Ga0207646_11271305	Not Available	643	Open in IMG/M
3300025923\|Ga0207681_10188523	Not Available	1576	Open in IMG/M
3300025923\|Ga0207681_11129090	All Organisms → cellular organisms → Bacteria	658	Open in IMG/M
3300025923\|Ga0207681_11217103	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	633	Open in IMG/M
3300025931\|Ga0207644_11237176	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	628	Open in IMG/M
3300025933\|Ga0207706_11717980	Not Available	505	Open in IMG/M
3300025936\|Ga0207670_11795765	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	521	Open in IMG/M
3300025938\|Ga0207704_11754822	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	534	Open in IMG/M
3300025942\|Ga0207689_10543782	All Organisms → cellular organisms → Bacteria	975	Open in IMG/M
3300025959\|Ga0210116_1010721	All Organisms → cellular organisms → Bacteria → Proteobacteria	1654	Open in IMG/M
3300026089\|Ga0207648_10174858	All Organisms → cellular organisms → Bacteria	1899	Open in IMG/M
3300026118\|Ga0207675_100674412	All Organisms → cellular organisms → Bacteria → Proteobacteria	1041	Open in IMG/M
3300026118\|Ga0207675_102120625	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	578	Open in IMG/M
3300026277\|Ga0209350_1044870	All Organisms → cellular organisms → Bacteria	1290	Open in IMG/M
3300026301\|Ga0209238_1129920	All Organisms → cellular organisms → Bacteria	815	Open in IMG/M
3300026307\|Ga0209469_1043788	All Organisms → cellular organisms → Bacteria	1439	Open in IMG/M
3300026313\|Ga0209761_1088231	All Organisms → cellular organisms → Bacteria	1584	Open in IMG/M
3300026316\|Ga0209155_1203194	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	623	Open in IMG/M
3300026329\|Ga0209375_1255324	Not Available	585	Open in IMG/M
3300026330\|Ga0209473_1244599	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	624	Open in IMG/M
3300026331\|Ga0209267_1092779	All Organisms → cellular organisms → Bacteria	1291	Open in IMG/M
3300026343\|Ga0209159_1005721	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	7855	Open in IMG/M
3300026524\|Ga0209690_1027965	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales	2747	Open in IMG/M
3300026524\|Ga0209690_1139433	All Organisms → cellular organisms → Bacteria	914	Open in IMG/M
3300026537\|Ga0209157_1348880	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	533	Open in IMG/M
3300026548\|Ga0209161_10245498	All Organisms → cellular organisms → Bacteria	938	Open in IMG/M
3300026550\|Ga0209474_10348787	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	830	Open in IMG/M
3300026551\|Ga0209648_10538765	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	657	Open in IMG/M
3300027643\|Ga0209076_1180881	All Organisms → cellular organisms → Bacteria	583	Open in IMG/M
3300027706\|Ga0209581_1006050	All Organisms → cellular organisms → Bacteria → Proteobacteria	9010	Open in IMG/M
3300027748\|Ga0209689_1289753	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	639	Open in IMG/M
3300027748\|Ga0209689_1439615	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	500	Open in IMG/M
3300027815\|Ga0209726_10310489	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	766	Open in IMG/M
3300027826\|Ga0209060_10000091	All Organisms → cellular organisms → Bacteria	242926	Open in IMG/M
3300027862\|Ga0209701_10635240	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	560	Open in IMG/M
(restricted) 3300027872\|Ga0255058_10377432	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	687	Open in IMG/M
3300027909\|Ga0209382_10200921	All Organisms → cellular organisms → Bacteria	2285	Open in IMG/M
3300028536\|Ga0137415_10504415	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1018	Open in IMG/M
3300028587\|Ga0247828_10314246	All Organisms → cellular organisms → Bacteria	870	Open in IMG/M
3300028673\|Ga0257175_1016072	Not Available	1198	Open in IMG/M
3300028812\|Ga0247825_10791758	Not Available	684	Open in IMG/M
3300030730\|Ga0307482_1031085	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium freirei → Rhizobium freirei PRF 81	1191	Open in IMG/M
3300031572\|Ga0318515_10503603	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	646	Open in IMG/M
3300031590\|Ga0307483_1002836	All Organisms → cellular organisms → Bacteria	1230	Open in IMG/M
3300031590\|Ga0307483_1029380	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	572	Open in IMG/M
3300031720\|Ga0307469_10416604	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	1152	Open in IMG/M
3300031720\|Ga0307469_11004868	All Organisms → cellular organisms → Bacteria	779	Open in IMG/M
3300031720\|Ga0307469_11143143	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	733	Open in IMG/M
3300031720\|Ga0307469_11526769	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	640	Open in IMG/M
3300031720\|Ga0307469_11712039	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	606	Open in IMG/M
3300031723\|Ga0318493_10330064	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	827	Open in IMG/M
3300031740\|Ga0307468_101959369	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	560	Open in IMG/M
3300031754\|Ga0307475_10569909	Not Available	907	Open in IMG/M
3300031805\|Ga0318497_10274782	All Organisms → cellular organisms → Bacteria	936	Open in IMG/M
3300031820\|Ga0307473_10956323	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	622	Open in IMG/M
3300031820\|Ga0307473_11069762	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	593	Open in IMG/M
3300031896\|Ga0318551_10917566	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	511	Open in IMG/M
3300031943\|Ga0310885_10234759	All Organisms → cellular organisms → Bacteria → Proteobacteria	922	Open in IMG/M
3300032012\|Ga0310902_10748421	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	662	Open in IMG/M
3300032065\|Ga0318513_10615040	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	532	Open in IMG/M
3300032122\|Ga0310895_10369795	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	695	Open in IMG/M
3300032144\|Ga0315910_10601985	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	852	Open in IMG/M
3300032180\|Ga0307471_100363952	All Organisms → cellular organisms → Bacteria → Proteobacteria	1561	Open in IMG/M
3300032180\|Ga0307471_100503951	Not Available	1359	Open in IMG/M
3300032180\|Ga0307471_101428702	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → environmental samples → uncultured Acidimicrobiales bacterium	851	Open in IMG/M
3300032180\|Ga0307471_101972960	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	731	Open in IMG/M
3300032180\|Ga0307471_102376804	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	669	Open in IMG/M
3300032180\|Ga0307471_103294069	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	572	Open in IMG/M
3300032205\|Ga0307472_100434424	All Organisms → cellular organisms → Bacteria	1110	Open in IMG/M
3300032397\|Ga0315287_12239592	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	595	Open in IMG/M
3300032782\|Ga0335082_10425679	All Organisms → cellular organisms → Bacteria	1191	Open in IMG/M
3300032829\|Ga0335070_10098384	All Organisms → cellular organisms → Bacteria	3068	Open in IMG/M
3300032893\|Ga0335069_10484014	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1438	Open in IMG/M
3300033004\|Ga0335084_10141531	All Organisms → cellular organisms → Bacteria	2503	Open in IMG/M
3300033004\|Ga0335084_10601831	All Organisms → cellular organisms → Bacteria	1125	Open in IMG/M
3300033233\|Ga0334722_10501270	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	871	Open in IMG/M
3300033233\|Ga0334722_10803319	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	666	Open in IMG/M
3300033289\|Ga0310914_10715545	All Organisms → cellular organisms → Bacteria	897	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	84.78%
Host-Associated	Host-Associated	14.93%
Engineered	Engineered	0.30%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	78.81%
Plants	Host-Associated → Plants	14.93%
Aquatic	Environmental → Aquatic	5.97%
Wastewater	Engineered → Wastewater	0.30%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	77.61%
Rhizosphere	Host-Associated → Plants → Rhizosphere	11.04%
Rhizoplane	Host-Associated → Plants → Rhizoplane	3.58%
Freshwater	Environmental → Aquatic → Freshwater	2.69%
Thermal Springs	Environmental → Aquatic → Thermal Springs	1.49%
Marine	Environmental → Aquatic → Marine	1.79%
Cave	Environmental → Terrestrial → Cave	1.19%
Roots	Host-Associated → Plants → Roots	0.30%
Activated Sludge	Engineered → Wastewater → Activated Sludge	0.30%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	59.70%
Loam	Environmental → Terrestrial → Soil → Loam	14.63%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	8.06%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	3.28%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	2.99%
Soil	Host-Associated → Plants → Rhizosphere → Soil	2.99%
Lake	Environmental → Aquatic → Freshwater → Lake	1.49%
Wetlands	Environmental → Aquatic → Marine → Wetlands	1.19%
Sediment	Environmental → Aquatic → Thermal Springs → Sediment	1.19%
Unclassified	Environmental → Terrestrial → Cave → Unclassified	1.19%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.30%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.30%
Hydrothermal Vents	Environmental → Aquatic → Marine → Hydrothermal Vents	0.30%
Gulf	Environmental → Aquatic → Marine → Gulf	0.30%
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	0.30%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.30%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified	0.30%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.60%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.60%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	29.55%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	19.40%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	10.45%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	8.06%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	7.76%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	3.28%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	2.99%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	2.99%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	2.39%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	1.49%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	1.49%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	1.49%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	1.49%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	1.19%
Unclassified	Environmental → Aquatic → Thermal Springs → Sediment → Unclassified	1.19%
Unclassified	Environmental → Terrestrial → Cave → Unclassified → Unclassified	1.19%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.30%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	0.30%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	0.30%
Contaminated	Environmental → Aquatic → Freshwater → Groundwater → Contaminated	0.30%
Microbial Mats	Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats	0.30%
Unclassified	Environmental → Aquatic → Marine → Gulf → Unclassified	0.30%
Neutral	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral	0.30%
Unclassified	Environmental → Terrestrial → Soil → Loam → Unclassified	0.30%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.30%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified	0.30%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.60%

Habitat	Taxonomy	Distribution
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	14.33%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	11.04%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	9.85%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	8.36%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	7.76%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	6.27%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	5.67%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	2.39%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	2.09%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	2.09%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.49%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	1.49%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	1.49%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	1.49%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	1.49%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	1.49%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.79%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	1.79%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	1.19%
Hot Spring Sediment	Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment	1.19%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	1.19%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.19%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.19%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	0.90%
Microbial Mat On Rocks	Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks	0.90%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.30%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	0.30%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater	0.30%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater	0.30%
Hydrothermal Fe-Rich Mat	Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Fe-Rich Mat	0.30%
Seawater	Environmental → Aquatic → Marine → Gulf → Unclassified → Seawater	0.30%
Hot Spring Fe-Si Sediment	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral → Hot Spring Fe-Si Sediment	0.30%
Termite Nest	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest	0.30%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.30%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	0.30%
Soil	Environmental → Terrestrial → Soil → Loam → Unclassified → Soil	0.30%
Bio-Ooze	Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze	0.30%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.30%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.30%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.30%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.30%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.30%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.30%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.30%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.30%
Activated Sludge	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge	0.30%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment	0.60%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere	0.60%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.60%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.60%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.60%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.60%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300002560	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm	Environmental	Open in IMG/M
3300002561	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm	Environmental	Open in IMG/M
3300002562	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm	Environmental	Open in IMG/M
3300002908	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm	Environmental	Open in IMG/M
3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Host-Associated	Open in IMG/M
3300004052	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2	Environmental	Open in IMG/M
3300004058	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1	Environmental	Open in IMG/M
3300004267	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio	Environmental	Open in IMG/M
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated	Open in IMG/M
3300004480	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4	Environmental	Open in IMG/M
3300004633	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio	Environmental	Open in IMG/M
3300004643	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3	Environmental	Open in IMG/M
3300005093	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks	Environmental	Open in IMG/M
3300005166	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123	Environmental	Open in IMG/M
3300005167	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121	Environmental	Open in IMG/M
3300005171	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126	Environmental	Open in IMG/M
3300005172	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132	Environmental	Open in IMG/M
3300005174	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129	Environmental	Open in IMG/M
3300005175	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122	Environmental	Open in IMG/M
3300005181	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127	Environmental	Open in IMG/M
3300005183	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1	Environmental	Open in IMG/M
3300005294	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil	Environmental	Open in IMG/M
3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3	Environmental	Open in IMG/M
3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Host-Associated	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Host-Associated	Open in IMG/M
3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Environmental	Open in IMG/M
3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Host-Associated	Open in IMG/M
3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Environmental	Open in IMG/M
3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Environmental	Open in IMG/M
3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Environmental	Open in IMG/M
3300005446	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135	Environmental	Open in IMG/M
3300005447	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138	Environmental	Open in IMG/M
3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Host-Associated	Open in IMG/M
3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Environmental	Open in IMG/M
3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Environmental	Open in IMG/M
3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Environmental	Open in IMG/M
3300005524	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1	Environmental	Open in IMG/M
3300005529	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1	Environmental	Open in IMG/M
3300005533	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1	Environmental	Open in IMG/M
3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Environmental	Open in IMG/M
3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Environmental	Open in IMG/M
3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Environmental	Open in IMG/M
3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Environmental	Open in IMG/M
3300005552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150	Environmental	Open in IMG/M
3300005556	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156	Environmental	Open in IMG/M
3300005559	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149	Environmental	Open in IMG/M
3300005566	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142	Environmental	Open in IMG/M
3300005568	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152	Environmental	Open in IMG/M
3300005569	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154	Environmental	Open in IMG/M
3300005574	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143	Environmental	Open in IMG/M
3300005598	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155	Environmental	Open in IMG/M
3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300006034	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105	Environmental	Open in IMG/M
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental	Open in IMG/M
3300006169	Termite nest microbial communities from Madurai, India	Environmental	Open in IMG/M
3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Environmental	Open in IMG/M
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental	Open in IMG/M
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated	Open in IMG/M
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental	Open in IMG/M
3300006797	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108	Environmental	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006847	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Host-Associated	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006865	Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG	Environmental	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated	Open in IMG/M
3300007255	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1	Environmental	Open in IMG/M
3300007258	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3	Environmental	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental	Open in IMG/M
3300009078	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015	Environmental	Open in IMG/M
3300009088	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG	Environmental	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated	Open in IMG/M
3300009455	Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Crystal Spring	Environmental	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300009870	Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant	Engineered	Open in IMG/M
3300010091	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_16_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010095	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_16_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010102	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_4_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010103	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_16_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010117	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_4_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010122	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010130	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_4_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010132	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_16_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010134	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_8_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010140	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_24_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010304	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015	Environmental	Open in IMG/M
3300010321	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015	Environmental	Open in IMG/M
3300010326	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG	Environmental	Open in IMG/M
3300010333	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG	Environmental	Open in IMG/M
3300010335	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015	Environmental	Open in IMG/M
3300010336	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010391	Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300010938	Sediment microbial community from Chocolate Pots hot springs, Yellowstone National Park, Wyoming, USA. Combined Assembly of Gp0156111, Gp0156114, Gp0156117	Environmental	Open in IMG/M
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated	Open in IMG/M
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental	Open in IMG/M
3300012201	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG	Environmental	Open in IMG/M
3300012206	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG	Environmental	Open in IMG/M
3300012224	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012349	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG	Environmental	Open in IMG/M
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental	Open in IMG/M
3300012363	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG	Environmental	Open in IMG/M
3300012371	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_0_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012372	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_0_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012376	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_0_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012383	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_4_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012388	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_24_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012390	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012395	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012396	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012397	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012399	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012401	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012402	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012403	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012404	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_8_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012407	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012409	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012410	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012582	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG	Environmental	Open in IMG/M
3300012685	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG	Environmental	Open in IMG/M
3300012908	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1	Environmental	Open in IMG/M
3300012912	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2	Environmental	Open in IMG/M
3300012918	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG	Environmental	Open in IMG/M
3300012922	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG	Environmental	Open in IMG/M
3300012925	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012927	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012951	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300012976	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG	Environmental	Open in IMG/M
3300012977	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG	Environmental	Open in IMG/M
3300014154	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015	Environmental	Open in IMG/M
3300014320	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1	Environmental	Open in IMG/M
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated	Open in IMG/M
3300015358	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300017654	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG	Environmental	Open in IMG/M
3300017656	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015	Environmental	Open in IMG/M
3300017659	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG	Environmental	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300017936	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1	Environmental	Open in IMG/M
3300017959	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG	Environmental	Open in IMG/M
3300018058	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG	Environmental	Open in IMG/M
3300018060	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG	Environmental	Open in IMG/M
3300018431	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104	Environmental	Open in IMG/M
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300019360	White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG	Environmental	Open in IMG/M
3300019362	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)	Environmental	Open in IMG/M
3300019458	Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG	Environmental	Open in IMG/M
3300019487	White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG	Environmental	Open in IMG/M
3300020170	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300021151	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_06_16RNAfungal (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300023444	Hydrothermal Fe-rich mat microbial community from Loihi Seamount, Hawaii, USA - 675-SC9	Environmental	Open in IMG/M
3300024330	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300025310	Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes)	Environmental	Open in IMG/M
3300025324	Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)	Environmental	Open in IMG/M
3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)	Host-Associated	Open in IMG/M
3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)	Environmental	Open in IMG/M
3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025959	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2 (SPAdes)	Environmental	Open in IMG/M
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026277	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes)	Environmental	Open in IMG/M
3300026301	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes)	Environmental	Open in IMG/M
3300026307	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes)	Environmental	Open in IMG/M
3300026313	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes)	Environmental	Open in IMG/M
3300026316	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes)	Environmental	Open in IMG/M
3300026329	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes)	Environmental	Open in IMG/M
3300026330	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes)	Environmental	Open in IMG/M
3300026331	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes)	Environmental	Open in IMG/M
3300026343	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes)	Environmental	Open in IMG/M
3300026524	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes)	Environmental	Open in IMG/M
3300026537	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes)	Environmental	Open in IMG/M
3300026548	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)	Environmental	Open in IMG/M
3300026550	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)	Environmental	Open in IMG/M
3300026551	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)	Environmental	Open in IMG/M
3300027643	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes)	Environmental	Open in IMG/M
3300027706	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes)	Environmental	Open in IMG/M
3300027748	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)	Environmental	Open in IMG/M
3300027815	Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes)	Environmental	Open in IMG/M
3300027826	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027862	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027872 (restricted)	Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_9	Environmental	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300028536	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300028587	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3	Environmental	Open in IMG/M
3300028673	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B	Environmental	Open in IMG/M
3300028812	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48	Environmental	Open in IMG/M
3300030730	Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031572	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19	Environmental	Open in IMG/M
3300031590	Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031723	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23	Environmental	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300031754	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515	Environmental	Open in IMG/M
3300031805	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23	Environmental	Open in IMG/M
3300031820	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515	Environmental	Open in IMG/M
3300031896	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19	Environmental	Open in IMG/M
3300031943	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2	Environmental	Open in IMG/M
3300032012	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3	Environmental	Open in IMG/M
3300032065	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20	Environmental	Open in IMG/M
3300032122	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4	Environmental	Open in IMG/M
3300032144	Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M
3300032397	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0	Environmental	Open in IMG/M
3300032782	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1	Environmental	Open in IMG/M
3300032829	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3	Environmental	Open in IMG/M
3300032893	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1	Environmental	Open in IMG/M
3300033004	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4	Environmental	Open in IMG/M
3300033233	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom	Environmental	Open in IMG/M
3300033289	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.33
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.33
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F008338

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign