| Basic Information | |
|---|---|
| Family ID | F008337 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 335 |
| Average Sequence Length | 46 residues |
| Representative Sequence | YMMQRWRKVPNPLLETVCAENNGDHFGKNLFPIPQADKPDF |
| Number of Associated Samples | 250 |
| Number of Associated Scaffolds | 335 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.33 % |
| % of genes near scaffold ends (potentially truncated) | 92.24 % |
| % of genes from short scaffolds (< 2000 bps) | 94.93 % |
| Associated GOLD sequencing projects | 233 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.17 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (84.776 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (18.508 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.373 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.149 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.17 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 335 Family Scaffolds |
|---|---|---|
| PF01977 | UbiD | 4.78 |
| PF03401 | TctC | 2.99 |
| PF01557 | FAA_hydrolase | 2.09 |
| PF00497 | SBP_bac_3 | 1.79 |
| PF01436 | NHL | 1.79 |
| PF01470 | Peptidase_C15 | 1.79 |
| PF03928 | HbpS-like | 1.19 |
| PF04909 | Amidohydro_2 | 1.19 |
| PF14384 | BrnA_antitoxin | 1.19 |
| PF03150 | CCP_MauG | 1.19 |
| PF04392 | ABC_sub_bind | 1.19 |
| PF01979 | Amidohydro_1 | 0.90 |
| PF17170 | DUF5128 | 0.90 |
| PF13531 | SBP_bac_11 | 0.90 |
| PF13442 | Cytochrome_CBB3 | 0.90 |
| PF12697 | Abhydrolase_6 | 0.60 |
| PF04325 | DUF465 | 0.60 |
| PF00990 | GGDEF | 0.60 |
| PF00593 | TonB_dep_Rec | 0.60 |
| PF00890 | FAD_binding_2 | 0.60 |
| PF13354 | Beta-lactamase2 | 0.60 |
| PF12796 | Ank_2 | 0.60 |
| PF00816 | Histone_HNS | 0.60 |
| PF14295 | PAN_4 | 0.60 |
| PF13360 | PQQ_2 | 0.60 |
| PF00873 | ACR_tran | 0.60 |
| PF00881 | Nitroreductase | 0.30 |
| PF07589 | PEP-CTERM | 0.30 |
| PF07883 | Cupin_2 | 0.30 |
| PF12850 | Metallophos_2 | 0.30 |
| PF00753 | Lactamase_B | 0.30 |
| PF01553 | Acyltransferase | 0.30 |
| PF00413 | Peptidase_M10 | 0.30 |
| PF10282 | Lactonase | 0.30 |
| PF00692 | dUTPase | 0.30 |
| PF13358 | DDE_3 | 0.30 |
| PF08592 | Anthrone_oxy | 0.30 |
| PF01022 | HTH_5 | 0.30 |
| PF01878 | EVE | 0.30 |
| PF10397 | ADSL_C | 0.30 |
| PF07690 | MFS_1 | 0.30 |
| PF03699 | UPF0182 | 0.30 |
| PF00171 | Aldedh | 0.30 |
| PF01370 | Epimerase | 0.30 |
| PF00015 | MCPsignal | 0.30 |
| PF01425 | Amidase | 0.30 |
| PF10518 | TAT_signal | 0.30 |
| PF03450 | CO_deh_flav_C | 0.30 |
| PF13710 | ACT_5 | 0.30 |
| PF02219 | MTHFR | 0.30 |
| PF13570 | PQQ_3 | 0.30 |
| PF13408 | Zn_ribbon_recom | 0.30 |
| PF00456 | Transketolase_N | 0.30 |
| PF01145 | Band_7 | 0.30 |
| PF14110 | DUF4282 | 0.30 |
| PF13489 | Methyltransf_23 | 0.30 |
| PF13847 | Methyltransf_31 | 0.30 |
| PF02423 | OCD_Mu_crystall | 0.30 |
| PF00903 | Glyoxalase | 0.30 |
| PF00892 | EamA | 0.30 |
| PF15919 | HicB_lk_antitox | 0.30 |
| PF09084 | NMT1 | 0.30 |
| PF02915 | Rubrerythrin | 0.30 |
| PF13620 | CarboxypepD_reg | 0.30 |
| PF02698 | DUF218 | 0.30 |
| PF02954 | HTH_8 | 0.30 |
| PF03435 | Sacchrp_dh_NADP | 0.30 |
| PF06150 | ChaB | 0.30 |
| PF00144 | Beta-lactamase | 0.30 |
| PF01161 | PBP | 0.30 |
| PF13671 | AAA_33 | 0.30 |
| PF13606 | Ank_3 | 0.30 |
| PF02776 | TPP_enzyme_N | 0.30 |
| PF06577 | EipA | 0.30 |
| COG ID | Name | Functional Category | % Frequency in 335 Family Scaffolds |
|---|---|---|---|
| COG0043 | 3-polyprenyl-4-hydroxybenzoate decarboxylase | Coenzyme transport and metabolism [H] | 4.78 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 2.99 |
| COG2039 | Pyrrolidone-carboxylate peptidase (N-terminal pyroglutamyl peptidase) | Posttranslational modification, protein turnover, chaperones [O] | 1.79 |
| COG1858 | Cytochrome c peroxidase | Posttranslational modification, protein turnover, chaperones [O] | 1.19 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.19 |
| COG0840 | Methyl-accepting chemotaxis protein (MCP) | Signal transduction mechanisms [T] | 0.60 |
| COG2916 | DNA-binding protein H-NS | Transcription [K] | 0.60 |
| COG3959 | Transketolase, N-terminal subunit | Carbohydrate transport and metabolism [G] | 0.30 |
| COG5549 | Predicted Zn-dependent protease | Posttranslational modification, protein turnover, chaperones [O] | 0.30 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.30 |
| COG2949 | Uncharacterized periplasmic protein SanA, affects membrane permeability for vancomycin | Cell wall/membrane/envelope biogenesis [M] | 0.30 |
| COG2947 | Predicted RNA-binding protein, contains EVE domain | General function prediction only [R] | 0.30 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.30 |
| COG2423 | Ornithine cyclodeaminase/archaeal alanine dehydrogenase, mu-crystallin family | Amino acid transport and metabolism [E] | 0.30 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.30 |
| COG4572 | Cation transport regulator ChaB | Inorganic ion transport and metabolism [P] | 0.30 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.30 |
| COG1881 | Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) family | General function prediction only [R] | 0.30 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.30 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.30 |
| COG1673 | Predicted RNA-binding protein, contains PUA-like EVE domain | General function prediction only [R] | 0.30 |
| COG1615 | Uncharacterized membrane protein, UPF0182 family | Function unknown [S] | 0.30 |
| COG1434 | Lipid carrier protein ElyC involved in cell wall biogenesis, DUF218 family | Cell wall/membrane/envelope biogenesis [M] | 0.30 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.30 |
| COG0756 | dUTP pyrophosphatase (dUTPase) | Defense mechanisms [V] | 0.30 |
| COG0717 | dCTP deaminase | Nucleotide transport and metabolism [F] | 0.30 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.30 |
| COG0685 | 5,10-methylenetetrahydrofolate reductase | Amino acid transport and metabolism [E] | 0.30 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.30 |
| COG0021 | Transketolase | Carbohydrate transport and metabolism [G] | 0.30 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 85.07 % |
| Unclassified | root | N/A | 14.93 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2070309009|GPKNP_GG3DY5402H20U9 | Not Available | 523 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_104095969 | Not Available | 558 | Open in IMG/M |
| 3300000955|JGI1027J12803_107603590 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300001686|C688J18823_10658177 | Not Available | 667 | Open in IMG/M |
| 3300002562|JGI25382J37095_10225974 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300003267|soilL1_10226381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1194 | Open in IMG/M |
| 3300004080|Ga0062385_11034726 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
| 3300004080|Ga0062385_11301447 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300004091|Ga0062387_100414284 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 913 | Open in IMG/M |
| 3300004092|Ga0062389_102121360 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 737 | Open in IMG/M |
| 3300004153|Ga0063455_100222282 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300004268|Ga0066398_10066644 | Not Available | 768 | Open in IMG/M |
| 3300004463|Ga0063356_103806293 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 650 | Open in IMG/M |
| 3300004479|Ga0062595_101439092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 631 | Open in IMG/M |
| 3300004781|Ga0062379_10081084 | Not Available | 719 | Open in IMG/M |
| 3300005163|Ga0066823_10145823 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
| 3300005184|Ga0066671_10200462 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
| 3300005330|Ga0070690_101045210 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300005332|Ga0066388_103105793 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300005332|Ga0066388_103490346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 803 | Open in IMG/M |
| 3300005332|Ga0066388_104761341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 690 | Open in IMG/M |
| 3300005343|Ga0070687_100410346 | Not Available | 890 | Open in IMG/M |
| 3300005365|Ga0070688_100268537 | All Organisms → cellular organisms → Bacteria | 1221 | Open in IMG/M |
| 3300005439|Ga0070711_101066577 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 695 | Open in IMG/M |
| 3300005441|Ga0070700_100592444 | Not Available | 867 | Open in IMG/M |
| 3300005446|Ga0066686_10118718 | Not Available | 1722 | Open in IMG/M |
| 3300005446|Ga0066686_10833486 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 611 | Open in IMG/M |
| 3300005450|Ga0066682_10199223 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1283 | Open in IMG/M |
| 3300005459|Ga0068867_101188795 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 700 | Open in IMG/M |
| 3300005518|Ga0070699_101094750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 731 | Open in IMG/M |
| 3300005537|Ga0070730_10617225 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 691 | Open in IMG/M |
| 3300005544|Ga0070686_101409083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 585 | Open in IMG/M |
| 3300005586|Ga0066691_10608204 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300005598|Ga0066706_10814165 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300005598|Ga0066706_10968755 | Not Available | 658 | Open in IMG/M |
| 3300005598|Ga0066706_11242274 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300005602|Ga0070762_11320766 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300005614|Ga0068856_102262160 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300005713|Ga0066905_101156837 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300005713|Ga0066905_101577294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 600 | Open in IMG/M |
| 3300005764|Ga0066903_100987875 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1537 | Open in IMG/M |
| 3300005764|Ga0066903_101084238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. | 1474 | Open in IMG/M |
| 3300005764|Ga0066903_102062543 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
| 3300005764|Ga0066903_102910315 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 928 | Open in IMG/M |
| 3300005764|Ga0066903_106629577 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300005764|Ga0066903_108777663 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 513 | Open in IMG/M |
| 3300005764|Ga0066903_108880892 | Not Available | 510 | Open in IMG/M |
| 3300006041|Ga0075023_100189947 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300006046|Ga0066652_100857120 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 868 | Open in IMG/M |
| 3300006047|Ga0075024_100424384 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 681 | Open in IMG/M |
| 3300006050|Ga0075028_101024626 | Not Available | 514 | Open in IMG/M |
| 3300006057|Ga0075026_100129271 | All Organisms → cellular organisms → Bacteria | 1280 | Open in IMG/M |
| 3300006172|Ga0075018_10087768 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1360 | Open in IMG/M |
| 3300006172|Ga0075018_10721707 | Not Available | 540 | Open in IMG/M |
| 3300006847|Ga0075431_101336045 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 677 | Open in IMG/M |
| 3300006847|Ga0075431_101699861 | Not Available | 588 | Open in IMG/M |
| 3300006852|Ga0075433_11612604 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300006881|Ga0068865_100947899 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 751 | Open in IMG/M |
| 3300006881|Ga0068865_101863087 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 12AC_lac13 | 544 | Open in IMG/M |
| 3300006953|Ga0074063_10777948 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300007076|Ga0075435_100984115 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 736 | Open in IMG/M |
| 3300007255|Ga0099791_10580972 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
| 3300007258|Ga0099793_10610715 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
| 3300007788|Ga0099795_10023408 | All Organisms → cellular organisms → Bacteria | 2050 | Open in IMG/M |
| 3300009012|Ga0066710_102914679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Variibacter → Variibacter gotjawalensis | 670 | Open in IMG/M |
| 3300009038|Ga0099829_10667611 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 864 | Open in IMG/M |
| 3300009088|Ga0099830_11260098 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
| 3300009089|Ga0099828_11224865 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 12AC_lac13 | 665 | Open in IMG/M |
| 3300009090|Ga0099827_10252504 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1482 | Open in IMG/M |
| 3300009090|Ga0099827_11012289 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
| 3300009090|Ga0099827_11134698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → unclassified Vibrio → Vibrio sp. B183 | 679 | Open in IMG/M |
| 3300009090|Ga0099827_11213068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 656 | Open in IMG/M |
| 3300009090|Ga0099827_11584021 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
| 3300009090|Ga0099827_11848064 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300009094|Ga0111539_10446518 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1506 | Open in IMG/M |
| 3300009094|Ga0111539_12610731 | Not Available | 586 | Open in IMG/M |
| 3300009094|Ga0111539_13055096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300009137|Ga0066709_102415142 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 714 | Open in IMG/M |
| 3300009137|Ga0066709_103997631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
| 3300009143|Ga0099792_10258005 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
| 3300009143|Ga0099792_10378676 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 861 | Open in IMG/M |
| 3300009147|Ga0114129_12685667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 593 | Open in IMG/M |
| 3300009162|Ga0075423_12778534 | Not Available | 536 | Open in IMG/M |
| 3300009177|Ga0105248_11523517 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300009525|Ga0116220_10595846 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300009609|Ga0105347_1186656 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 12AC_lac13 | 827 | Open in IMG/M |
| 3300009609|Ga0105347_1358082 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
| 3300009683|Ga0116224_10295220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 771 | Open in IMG/M |
| 3300009792|Ga0126374_11300521 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300009839|Ga0116223_10215096 | All Organisms → cellular organisms → Bacteria | 1169 | Open in IMG/M |
| 3300010043|Ga0126380_11683691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 569 | Open in IMG/M |
| 3300010043|Ga0126380_12271528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300010047|Ga0126382_10136315 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1657 | Open in IMG/M |
| 3300010047|Ga0126382_11525529 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
| 3300010047|Ga0126382_12338633 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300010048|Ga0126373_11038100 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 885 | Open in IMG/M |
| 3300010048|Ga0126373_11615165 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300010049|Ga0123356_12035909 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300010159|Ga0099796_10476167 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300010320|Ga0134109_10229463 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300010322|Ga0134084_10293047 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 602 | Open in IMG/M |
| 3300010333|Ga0134080_10107595 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1152 | Open in IMG/M |
| 3300010335|Ga0134063_10579382 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300010358|Ga0126370_10212588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 1471 | Open in IMG/M |
| 3300010358|Ga0126370_11113836 | Not Available | 729 | Open in IMG/M |
| 3300010358|Ga0126370_12646544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300010359|Ga0126376_10163949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → unclassified Novosphingobium → Novosphingobium sp. | 1798 | Open in IMG/M |
| 3300010359|Ga0126376_10220376 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1589 | Open in IMG/M |
| 3300010359|Ga0126376_10886428 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300010359|Ga0126376_10922658 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 866 | Open in IMG/M |
| 3300010359|Ga0126376_11677616 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 670 | Open in IMG/M |
| 3300010359|Ga0126376_11949499 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
| 3300010359|Ga0126376_12577452 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 557 | Open in IMG/M |
| 3300010359|Ga0126376_13066062 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300010360|Ga0126372_10190756 | All Organisms → cellular organisms → Bacteria | 1694 | Open in IMG/M |
| 3300010360|Ga0126372_11683090 | Not Available | 675 | Open in IMG/M |
| 3300010360|Ga0126372_12378720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 580 | Open in IMG/M |
| 3300010360|Ga0126372_13077783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300010361|Ga0126378_10138161 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2465 | Open in IMG/M |
| 3300010362|Ga0126377_11284999 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300010362|Ga0126377_11976899 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 659 | Open in IMG/M |
| 3300010362|Ga0126377_12026850 | Not Available | 652 | Open in IMG/M |
| 3300010362|Ga0126377_12929546 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
| 3300010366|Ga0126379_10480362 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1310 | Open in IMG/M |
| 3300010366|Ga0126379_10573958 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
| 3300010379|Ga0136449_101229050 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
| 3300010379|Ga0136449_104647321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 502 | Open in IMG/M |
| 3300010398|Ga0126383_10132088 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2297 | Open in IMG/M |
| 3300010398|Ga0126383_11652664 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 730 | Open in IMG/M |
| 3300010398|Ga0126383_12931047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium | 557 | Open in IMG/M |
| 3300010399|Ga0134127_13129411 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300010400|Ga0134122_13388288 | Not Available | 502 | Open in IMG/M |
| 3300010401|Ga0134121_11753210 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300011120|Ga0150983_15337060 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300011271|Ga0137393_10275857 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1430 | Open in IMG/M |
| 3300011420|Ga0137314_1063546 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 895 | Open in IMG/M |
| 3300011423|Ga0137436_1099399 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300012096|Ga0137389_10823262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 797 | Open in IMG/M |
| 3300012199|Ga0137383_11178676 | Not Available | 552 | Open in IMG/M |
| 3300012202|Ga0137363_10147793 | All Organisms → cellular organisms → Bacteria | 1843 | Open in IMG/M |
| 3300012202|Ga0137363_10623905 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 911 | Open in IMG/M |
| 3300012202|Ga0137363_10637909 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 900 | Open in IMG/M |
| 3300012202|Ga0137363_10639564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 899 | Open in IMG/M |
| 3300012202|Ga0137363_10752749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 825 | Open in IMG/M |
| 3300012202|Ga0137363_11050947 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300012205|Ga0137362_11039924 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 697 | Open in IMG/M |
| 3300012205|Ga0137362_11303728 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 611 | Open in IMG/M |
| 3300012206|Ga0137380_11703942 | Not Available | 514 | Open in IMG/M |
| 3300012208|Ga0137376_10876792 | Not Available | 771 | Open in IMG/M |
| 3300012209|Ga0137379_11457194 | Not Available | 587 | Open in IMG/M |
| 3300012211|Ga0137377_11521914 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300012211|Ga0137377_11833886 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300012212|Ga0150985_101860108 | Not Available | 1548 | Open in IMG/M |
| 3300012212|Ga0150985_114161071 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300012357|Ga0137384_10510604 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300012357|Ga0137384_10665295 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 847 | Open in IMG/M |
| 3300012357|Ga0137384_10891050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 717 | Open in IMG/M |
| 3300012359|Ga0137385_10790747 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300012361|Ga0137360_10927081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 751 | Open in IMG/M |
| 3300012362|Ga0137361_10184980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1879 | Open in IMG/M |
| 3300012469|Ga0150984_106022590 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300012469|Ga0150984_115268866 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300012532|Ga0137373_10485828 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300012582|Ga0137358_10393652 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 937 | Open in IMG/M |
| 3300012683|Ga0137398_11265544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 501 | Open in IMG/M |
| 3300012685|Ga0137397_10902749 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 655 | Open in IMG/M |
| 3300012917|Ga0137395_10067432 | All Organisms → cellular organisms → Bacteria | 2301 | Open in IMG/M |
| 3300012918|Ga0137396_10784216 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 701 | Open in IMG/M |
| 3300012925|Ga0137419_11410266 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
| 3300012927|Ga0137416_10610774 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300012930|Ga0137407_10442504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1208 | Open in IMG/M |
| 3300012930|Ga0137407_11561850 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300012930|Ga0137407_11774334 | Not Available | 588 | Open in IMG/M |
| 3300012948|Ga0126375_10502403 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300012948|Ga0126375_10684554 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300012971|Ga0126369_10090206 | All Organisms → cellular organisms → Bacteria | 2746 | Open in IMG/M |
| 3300012971|Ga0126369_11537972 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 755 | Open in IMG/M |
| 3300012971|Ga0126369_12309495 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 624 | Open in IMG/M |
| 3300013306|Ga0163162_10931477 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 981 | Open in IMG/M |
| 3300013307|Ga0157372_12554629 | Not Available | 586 | Open in IMG/M |
| 3300014154|Ga0134075_10520674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 534 | Open in IMG/M |
| 3300014164|Ga0181532_10483553 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300014501|Ga0182024_10692495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium | 1259 | Open in IMG/M |
| 3300014877|Ga0180074_1021117 | Not Available | 1270 | Open in IMG/M |
| 3300014879|Ga0180062_1042315 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 12AC_lac13 | 967 | Open in IMG/M |
| 3300015206|Ga0167644_1163744 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
| 3300015241|Ga0137418_10110221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2466 | Open in IMG/M |
| 3300015241|Ga0137418_10362988 | All Organisms → cellular organisms → Bacteria | 1192 | Open in IMG/M |
| 3300015245|Ga0137409_10037445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4672 | Open in IMG/M |
| 3300015245|Ga0137409_10577967 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300015358|Ga0134089_10397475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
| 3300015373|Ga0132257_101561146 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300015374|Ga0132255_104880104 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300016270|Ga0182036_10134842 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1736 | Open in IMG/M |
| 3300016294|Ga0182041_11260782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 675 | Open in IMG/M |
| 3300016319|Ga0182033_10925251 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300016341|Ga0182035_11242436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium viridifuturi | 666 | Open in IMG/M |
| 3300016357|Ga0182032_10038607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2998 | Open in IMG/M |
| 3300016387|Ga0182040_10771921 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 790 | Open in IMG/M |
| 3300016404|Ga0182037_11542799 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 590 | Open in IMG/M |
| 3300016422|Ga0182039_11451529 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 624 | Open in IMG/M |
| 3300017657|Ga0134074_1290108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
| 3300017930|Ga0187825_10197556 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 723 | Open in IMG/M |
| 3300017932|Ga0187814_10300364 | Not Available | 615 | Open in IMG/M |
| 3300017943|Ga0187819_10722313 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
| 3300017965|Ga0190266_10214523 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 12AC_lac13 | 933 | Open in IMG/M |
| 3300017966|Ga0187776_11013626 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 611 | Open in IMG/M |
| 3300017975|Ga0187782_10176094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 1597 | Open in IMG/M |
| 3300017994|Ga0187822_10380078 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300018027|Ga0184605_10140839 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300018028|Ga0184608_10037548 | All Organisms → cellular organisms → Bacteria | 1854 | Open in IMG/M |
| 3300018037|Ga0187883_10719866 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300018062|Ga0187784_10573672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 907 | Open in IMG/M |
| 3300018072|Ga0184635_10337494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 582 | Open in IMG/M |
| 3300018083|Ga0184628_10023862 | All Organisms → cellular organisms → Bacteria | 3026 | Open in IMG/M |
| 3300018085|Ga0187772_10937806 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 630 | Open in IMG/M |
| 3300018431|Ga0066655_10342998 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 979 | Open in IMG/M |
| 3300018433|Ga0066667_10411245 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1096 | Open in IMG/M |
| 3300018468|Ga0066662_10152134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1752 | Open in IMG/M |
| 3300018468|Ga0066662_12643015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 531 | Open in IMG/M |
| 3300018482|Ga0066669_11650135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
| 3300020022|Ga0193733_1169844 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300020034|Ga0193753_10335902 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 634 | Open in IMG/M |
| 3300020170|Ga0179594_10138548 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300020199|Ga0179592_10163707 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1015 | Open in IMG/M |
| 3300020579|Ga0210407_10085578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2380 | Open in IMG/M |
| 3300020581|Ga0210399_11074346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 645 | Open in IMG/M |
| 3300021080|Ga0210382_10517394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300021086|Ga0179596_10011698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 2906 | Open in IMG/M |
| 3300021168|Ga0210406_10531714 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 926 | Open in IMG/M |
| 3300021168|Ga0210406_10642257 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 824 | Open in IMG/M |
| 3300021168|Ga0210406_10998404 | Not Available | 623 | Open in IMG/M |
| 3300021170|Ga0210400_10096410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2339 | Open in IMG/M |
| 3300021170|Ga0210400_10413547 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1113 | Open in IMG/M |
| 3300021170|Ga0210400_11260888 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
| 3300021171|Ga0210405_11040762 | Not Available | 615 | Open in IMG/M |
| 3300021178|Ga0210408_10655483 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 829 | Open in IMG/M |
| 3300021407|Ga0210383_10292212 | All Organisms → cellular organisms → Bacteria | 1401 | Open in IMG/M |
| 3300021407|Ga0210383_10610922 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 940 | Open in IMG/M |
| 3300021432|Ga0210384_11062375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 712 | Open in IMG/M |
| 3300021478|Ga0210402_10301597 | All Organisms → cellular organisms → Bacteria | 1483 | Open in IMG/M |
| 3300021478|Ga0210402_10436511 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1216 | Open in IMG/M |
| 3300021478|Ga0210402_10696309 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 939 | Open in IMG/M |
| 3300021478|Ga0210402_10779692 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 881 | Open in IMG/M |
| 3300021479|Ga0210410_11141943 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 670 | Open in IMG/M |
| 3300021858|Ga0213852_1486783 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium BLR9 | 653 | Open in IMG/M |
| 3300021860|Ga0213851_1174159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 508 | Open in IMG/M |
| 3300022506|Ga0242648_1029832 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300022533|Ga0242662_10170554 | Not Available | 670 | Open in IMG/M |
| 3300022557|Ga0212123_10917558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 514 | Open in IMG/M |
| 3300022694|Ga0222623_10350835 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300022756|Ga0222622_10158391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1467 | Open in IMG/M |
| 3300024251|Ga0247679_1034981 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 845 | Open in IMG/M |
| 3300024288|Ga0179589_10441030 | Not Available | 600 | Open in IMG/M |
| 3300024331|Ga0247668_1012316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → unclassified Novosphingobium → Novosphingobium sp. | 1776 | Open in IMG/M |
| 3300025916|Ga0207663_10967821 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 682 | Open in IMG/M |
| 3300025925|Ga0207650_11608925 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
| 3300025928|Ga0207700_10866139 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 808 | Open in IMG/M |
| 3300025930|Ga0207701_11142494 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
| 3300025933|Ga0207706_10406684 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
| 3300026023|Ga0207677_11878152 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 12AC_lac13 | 556 | Open in IMG/M |
| 3300026075|Ga0207708_11351530 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 12AC_lac13 | 625 | Open in IMG/M |
| 3300026121|Ga0207683_10948316 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300026304|Ga0209240_1204252 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
| 3300026304|Ga0209240_1286080 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300026326|Ga0209801_1124082 | All Organisms → cellular organisms → Bacteria | 1106 | Open in IMG/M |
| 3300026328|Ga0209802_1185068 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 826 | Open in IMG/M |
| 3300026340|Ga0257162_1037191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 606 | Open in IMG/M |
| 3300026376|Ga0257167_1041318 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 700 | Open in IMG/M |
| 3300026469|Ga0257169_1058850 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 612 | Open in IMG/M |
| 3300026514|Ga0257168_1036839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1056 | Open in IMG/M |
| 3300026551|Ga0209648_10712501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 548 | Open in IMG/M |
| 3300026552|Ga0209577_10591071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 674 | Open in IMG/M |
| 3300026555|Ga0179593_1129921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1595 | Open in IMG/M |
| 3300026557|Ga0179587_10707804 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300026557|Ga0179587_11138371 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300027635|Ga0209625_1094902 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 669 | Open in IMG/M |
| 3300027641|Ga0208827_1141887 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 674 | Open in IMG/M |
| 3300027669|Ga0208981_1165113 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300027681|Ga0208991_1200277 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
| 3300027684|Ga0209626_1162777 | Not Available | 590 | Open in IMG/M |
| 3300027737|Ga0209038_10173036 | Not Available | 654 | Open in IMG/M |
| 3300027787|Ga0209074_10390380 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 581 | Open in IMG/M |
| 3300027875|Ga0209283_10616453 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 686 | Open in IMG/M |
| 3300027882|Ga0209590_10706057 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 645 | Open in IMG/M |
| 3300027907|Ga0207428_10684105 | Not Available | 734 | Open in IMG/M |
| 3300027910|Ga0209583_10426855 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300027911|Ga0209698_10563521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes | 878 | Open in IMG/M |
| 3300028379|Ga0268266_12278375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300028666|Ga0265336_10252735 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300029636|Ga0222749_10323756 | Not Available | 802 | Open in IMG/M |
| 3300029636|Ga0222749_10819480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Alsobacteraceae → Alsobacter → unclassified Alsobacter → Alsobacter sp. SYSU M60028 | 509 | Open in IMG/M |
| 3300030524|Ga0311357_10366594 | All Organisms → cellular organisms → Bacteria | 1366 | Open in IMG/M |
| 3300030580|Ga0311355_10295554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1631 | Open in IMG/M |
| 3300030659|Ga0316363_10440743 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300031232|Ga0302323_101095253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 888 | Open in IMG/M |
| 3300031474|Ga0170818_115057660 | Not Available | 510 | Open in IMG/M |
| 3300031549|Ga0318571_10277653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium viridifuturi | 624 | Open in IMG/M |
| 3300031561|Ga0318528_10438930 | Not Available | 701 | Open in IMG/M |
| 3300031572|Ga0318515_10566220 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
| 3300031708|Ga0310686_119528932 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 828 | Open in IMG/M |
| 3300031713|Ga0318496_10719006 | Not Available | 551 | Open in IMG/M |
| 3300031715|Ga0307476_10203093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1439 | Open in IMG/M |
| 3300031720|Ga0307469_11684553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 611 | Open in IMG/M |
| 3300031720|Ga0307469_11943319 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300031744|Ga0306918_11491358 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300031753|Ga0307477_10969785 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300031798|Ga0318523_10663808 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300031945|Ga0310913_10441541 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 924 | Open in IMG/M |
| 3300031946|Ga0310910_10496529 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 969 | Open in IMG/M |
| 3300031946|Ga0310910_10719224 | Not Available | 789 | Open in IMG/M |
| 3300031947|Ga0310909_11284039 | Not Available | 589 | Open in IMG/M |
| 3300031954|Ga0306926_10969460 | Not Available | 1014 | Open in IMG/M |
| 3300032001|Ga0306922_11530092 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300032042|Ga0318545_10299057 | Not Available | 579 | Open in IMG/M |
| 3300032055|Ga0318575_10693289 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300032160|Ga0311301_10547330 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1693 | Open in IMG/M |
| 3300032160|Ga0311301_12878356 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300032174|Ga0307470_10314572 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300032180|Ga0307471_103218601 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
| 3300032205|Ga0307472_102016047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 578 | Open in IMG/M |
| 3300032205|Ga0307472_102211300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 555 | Open in IMG/M |
| 3300032261|Ga0306920_102555595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 701 | Open in IMG/M |
| 3300032515|Ga0348332_11619856 | Not Available | 1077 | Open in IMG/M |
| 3300032892|Ga0335081_11667902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 696 | Open in IMG/M |
| 3300033433|Ga0326726_12213012 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
| 3300033806|Ga0314865_144901 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 631 | Open in IMG/M |
| 3300033808|Ga0314867_153801 | Not Available | 540 | Open in IMG/M |
| 3300034115|Ga0364945_0276953 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 12AC_lac13 | 520 | Open in IMG/M |
| 3300034149|Ga0364929_0366051 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium GW2011_GWA2_47_8 | 502 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.64% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.18% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.88% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.58% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.99% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.69% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.39% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.39% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.09% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.49% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.49% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.79% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.79% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.19% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.19% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.19% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.19% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.19% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.19% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.30% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.30% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.30% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.30% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.30% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.30% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.30% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.30% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.30% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.30% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.30% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.30% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.30% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.30% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.30% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.30% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.30% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.30% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.30% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.30% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.30% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.30% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.30% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.30% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.30% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.60% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.60% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.60% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.60% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.60% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.60% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.60% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.60% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.60% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2070309009 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004781 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare2Fresh | Environmental | Open in IMG/M |
| 3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Host-Associated | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011420 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT199_2 | Environmental | Open in IMG/M |
| 3300011423 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300014877 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10D | Environmental | Open in IMG/M |
| 3300014879 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_10D | Environmental | Open in IMG/M |
| 3300015206 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8B, Adjacent to main proglacial river, end of transect (Watson river)) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300020034 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021858 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022506 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300024251 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026340 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-A | Environmental | Open in IMG/M |
| 3300026376 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-B | Environmental | Open in IMG/M |
| 3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027669 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Host-Associated | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033806 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_20 | Environmental | Open in IMG/M |
| 3300033808 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20 | Environmental | Open in IMG/M |
| 3300034115 | Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17 | Environmental | Open in IMG/M |
| 3300034149 | Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPKNP_07307230 | 2070309009 | Soil | WRKVPNQLLEMVCAENNGDHFGKNLFPIPRADKPDF |
| INPhiseqgaiiFebDRAFT_1040959691 | 3300000364 | Soil | FNEPLYLGRRWNKVPNPLLEMVCAENNSDQFREKLFPIPQANTPDF* |
| JGI1027J12803_1076035902 | 3300000955 | Soil | EPLHMMQKWRKVVNPLLETVCAENNNDAIFFKQKLPPIPEATRADF* |
| C688J18823_106581771 | 3300001686 | Soil | WNKVPNQLLEMVCAENNGDHFGKNLFPVPRAHKPDF* |
| JGI25382J37095_102259742 | 3300002562 | Grasslands Soil | LHMVQRWRKVNNPLMETVCAEDNFDYFHQNLFPVPEADKPDF* |
| soilL1_102263811 | 3300003267 | Sugarcane Root And Bulk Soil | DTFNEPLHMVRRWNKVPNQLLEMVCAENNGDHFGKNLFPVPRAHKPDF* |
| Ga0062385_110347262 | 3300004080 | Bog Forest Soil | EPLHLVQRWRKVPNPMRETVCAENNIDYFHQNLFPLPEADKPDF* |
| Ga0062385_113014471 | 3300004080 | Bog Forest Soil | APLHMVQRWRKVKNQLLETVCAENNGDHFSKNLFPIPQAEAPDF* |
| Ga0062387_1004142842 | 3300004091 | Bog Forest Soil | TFNEPLHMIKRWRKVNNQMLETVCAENNGDHFSKNLFPIPQADTPDF* |
| Ga0062389_1021213602 | 3300004092 | Bog Forest Soil | PLHMIKRWRKVNNQMLETVCSENNGDHFSKNLFPIPQADTRDF* |
| Ga0063455_1002222822 | 3300004153 | Soil | IQRWRKVPNPLVETVCAENNEDHFNQGLFPIPRAKKPDF* |
| Ga0066398_100666442 | 3300004268 | Tropical Forest Soil | EDSDTFNEPLHMVQRWRKVKNQLLETVCAENNEDVFHQNLFPLPEATTPDF* |
| Ga0063356_1038062931 | 3300004463 | Arabidopsis Thaliana Rhizosphere | EDPDTFNEPLTMMQRWRGVPNPLLETVCAENNIDPFNQNLHPIPESKTPDF* |
| Ga0062595_1014390921 | 3300004479 | Soil | YLIQRWRKVPNPLVETVCAENNEDHFNQGLFPIPRATKPDF* |
| Ga0062379_100810841 | 3300004781 | Wetland Sediment | DTFNEPLYLVQRWRKVPNPLVETVCAENNEDHFNQGLFPIPRAEKPDF* |
| Ga0066823_101458231 | 3300005163 | Soil | LYMVRRWNKVPNQLLEMVCAENNGDHFGKNLFPVPRAHKPDF* |
| Ga0066671_102004621 | 3300005184 | Soil | DPDTFNEPLYMVQRWRKVDNPLQETVCAENNGDHFNQNLFPIPEAKKFDF* |
| Ga0070690_1010452101 | 3300005330 | Switchgrass Rhizosphere | TDPDAYNEPLNLVLRWRKVNNPLLETVCAENNEDHYNQNLFPIPQASKPDF* |
| Ga0066388_1031057932 | 3300005332 | Tropical Forest Soil | FNEPLYMVQRWRKVANPLLETDCAENNGDHFNQNLFPVPEATKPDF* |
| Ga0066388_1034903462 | 3300005332 | Tropical Forest Soil | VLVKVEDPDTFNEPLYLMRRWRKVPNQLLEMVCAENNGDHFSKNLFAVPRASTPDF* |
| Ga0066388_1047613413 | 3300005332 | Tropical Forest Soil | LNEPLYMARRWRKVPNPLLEMVCAENNGDHFGKNLFPIPQAEKPDF* |
| Ga0070687_1004103462 | 3300005343 | Switchgrass Rhizosphere | LGRRWNKVPNPLLEMVCAENNGDRFGENLFPVPQANTPDF* |
| Ga0070688_1002685372 | 3300005365 | Switchgrass Rhizosphere | IVDDPDTFNEPIQMMQKWRKVANPLLETVCAENNNDAEFFHQKLPPMPIAAKADF* |
| Ga0070711_1010665772 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | ALVTVEDPDTFNEPIHMKQTWHKVVNPLLETVCAENNNDSIFFHQKLFPMPEAAKPDF* |
| Ga0070700_1005924442 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | VVMVEDVDTFNEPIHMMQKWRKVENHQIETVCAENNNDAVFFHQKLPPMPEATKPDF* |
| Ga0066686_101187184 | 3300005446 | Soil | FVKVDDPDTFNEPLYLIQRWRKVPNLLVETVCAENNEDHFNQGLFPIPRAHKPDF* |
| Ga0066686_108334862 | 3300005446 | Soil | DTFNEPLHMVQRWRKADNPLLETVCAEDNFDYFHQNLFPLPEAKKPDF* |
| Ga0066682_101992231 | 3300005450 | Soil | VTVEYPDTFNQPLHMVQRWRKVNNPLMETVCAEDNFDYFHQNLFPIPEANKPDF* |
| Ga0068867_1011887952 | 3300005459 | Miscanthus Rhizosphere | PLHMMQKWRKVVNPLLETVCAENNNDAIFFKQKLPPIPEAKTADF* |
| Ga0070699_1010947501 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | DTFNEPLHMVQRWRKVDNPLIETVCAENNFDYFNQNLFPIPEAAKPDF* |
| Ga0070730_106172252 | 3300005537 | Surface Soil | PLHMMQQWRKVKNQMLETVCAENNIDPFNQNLFPMPEADKPDF* |
| Ga0070686_1014090831 | 3300005544 | Switchgrass Rhizosphere | ESIKLVDNGNRIEAFVKVDDPDTFYEPLYLIQRWRKVPNPLVETVCAENNEDHFNQGLFPIPRATKPDF* |
| Ga0066691_106082042 | 3300005586 | Soil | QRWRQVANPLLETVCAEDNFDYFHQNLFPIPEADKLDF* |
| Ga0066706_108141653 | 3300005598 | Soil | DPDTFNEPLYMVRRWNKVPYQPLEMICAENNGDHFGKNLFPIPRADAPDF* |
| Ga0066706_109687551 | 3300005598 | Soil | KVEDPDTFHEPMYMMRRWNKVPNQLLEMVCAENERDQFGKNLFPIPQAARPDF* |
| Ga0066706_112422741 | 3300005598 | Soil | VQRWRKVPNPLLETVCAENNGDHFSQGLFPIPEATKPDF* |
| Ga0070762_113207661 | 3300005602 | Soil | AVVTVEDSDTFNEPLHMVQRWRTVKNQRLEMVCAENNGDHFGKNLFPVPHADTADF* |
| Ga0068856_1022621601 | 3300005614 | Corn Rhizosphere | TFNEPIQMMQKWRKVANPLLETVCAENNNDAEFFHQKLPPMPIAAKADF* |
| Ga0066905_1011568372 | 3300005713 | Tropical Forest Soil | VKVTDPDTFYEPLHLVLRWRKVPNPLVETVCAENNSDRFGQNLFQVPRAKKPDF* |
| Ga0066905_1015772943 | 3300005713 | Tropical Forest Soil | RWRKVPNPLLEMVCAENNKDYFGKNLFPIPQADRPDF* |
| Ga0066903_1009878751 | 3300005764 | Tropical Forest Soil | TRRWNKVPNRLLEVVCAENNWDRFGHNLFPIPQADKPDF* |
| Ga0066903_1010842383 | 3300005764 | Tropical Forest Soil | VEDPDTFNAPLHMLKRWRRTDNPTLETVCAENNGDHFSKNLFPIPEAKTPDF* |
| Ga0066903_1020625433 | 3300005764 | Tropical Forest Soil | TFNEPLYMVQRWRKVKNPLLETVCAENNGDHFEQNLFPIPQASRPDF* |
| Ga0066903_1029103152 | 3300005764 | Tropical Forest Soil | TLYMVQRWRKVPNPLLETVCAENNLDFFSQNLYPIPEASKSDF* |
| Ga0066903_1066295771 | 3300005764 | Tropical Forest Soil | VQRWRKVPNPLQESVCAETTEDFFYKNLVPIPQAEGRDF* |
| Ga0066903_1087776631 | 3300005764 | Tropical Forest Soil | EPLYMMRRWRKVANPLLEMVCAENNGDHFGKNLFPIPQAERPDF* |
| Ga0066903_1088808921 | 3300005764 | Tropical Forest Soil | LHMIKRWRKAENPLIETVCAENNVDQFYQNLVPIPQASKPDF* |
| Ga0075023_1001899471 | 3300006041 | Watersheds | VQRWRKVKNPLVETVCAENNADHFKQNLFPLPEAEKADF* |
| Ga0066652_1008571202 | 3300006046 | Soil | MVQRWRKVPNPLRESICAENNGDHFGANLFPIPEAKKFDF* |
| Ga0075024_1004243843 | 3300006047 | Watersheds | FNEPLHLVQRWRKVKNPLVETVCAENNADHFKQNLFPLPEAEKADF* |
| Ga0075028_1010246262 | 3300006050 | Watersheds | QGWRKVDNPMLETACAENNEDFFHQNLFPIPQADKPDF* |
| Ga0075026_1001292712 | 3300006057 | Watersheds | MMRRWRKVPNPLQEMDCAENNGDHFGKSLFPIPHADTPDF* |
| Ga0075018_100877683 | 3300006172 | Watersheds | NEPLYMARSWRKVPNPLFEMVCAENNGDHFGKNLFPIPHADTPDF* |
| Ga0075018_107217071 | 3300006172 | Watersheds | KVDNPMLETACAENNEDFFHQNLFPIPQADKPDF* |
| Ga0075431_1013360452 | 3300006847 | Populus Rhizosphere | KMLEALVKVEDPATFNEPLYMVRRWNKVPNQLLEMVCAENNGDHFGKNLFPVPRAHKPDF |
| Ga0075431_1016998611 | 3300006847 | Populus Rhizosphere | DNGNRMEAFVKVDDPDTFHEPLYLIQRWRKVPNPLVETVCAENNEDHFNQGLFPIPRAKKPDF* |
| Ga0075433_116126041 | 3300006852 | Populus Rhizosphere | PDTFNEPLHMTQRWRKVDNPLLETVCAEDNVDYFNQNLFPMPEAKTPDF* |
| Ga0068865_1009478991 | 3300006881 | Miscanthus Rhizosphere | MMQRWRKVPNELLETVCSENNSDFFNQNLFPIPEDSTPDF* |
| Ga0068865_1018630871 | 3300006881 | Miscanthus Rhizosphere | DVVVKVEDPDTFNEPLYMARRWNKVPNQRLEMVCAENNGDHFGGNLFPIPRADRPDF* |
| Ga0074063_107779481 | 3300006953 | Soil | PDTFNEPLNLMQRWRRVENELIETVCAENNQDHFNHNLFPIPEAKKADF* |
| Ga0075435_1009841151 | 3300007076 | Populus Rhizosphere | YMVRRWNKVPNQLLEMVCAENNGDHFGKNLFPVPRAHKPDF* |
| Ga0099791_105809722 | 3300007255 | Vadose Zone Soil | TLDVLVKVEDPDTLNEPLYMTRRWNKVPNQFLEVVCAENNGDHFGKNLFPIPQADKPDF* |
| Ga0099793_106107152 | 3300007258 | Vadose Zone Soil | MGPKSRYRRRRADDPDTLNEPLHMMRRWRKVPNALLEMVCAENNGDHFGKNLFPIPQADKPDF* |
| Ga0099795_100234082 | 3300007788 | Vadose Zone Soil | MGPKSRYRRRRADDPDTLNEPLHMMRRWRKVPNALLEMVCAENNGDHFGKNLFPIPQAERPDF* |
| Ga0066710_1029146792 | 3300009012 | Grasslands Soil | WRKVPNPLLETACAENNGDHFGKNLFPIPQADKPDF |
| Ga0099829_106676111 | 3300009038 | Vadose Zone Soil | NEPLHMIQRWRKVPNPMRETVCAENNGDHFGKNLFPIPQADKPDF* |
| Ga0099830_112600981 | 3300009088 | Vadose Zone Soil | PDTFNEPLYMTMRWRKVANPLLETVCAEDNVDYFNQNLFPLPEAERPDF* |
| Ga0099828_112248652 | 3300009089 | Vadose Zone Soil | EDPDTLNEPLYMTRRWNKVPNQFLEVVCAENNGDHFGKNLFPIPQAQRADF* |
| Ga0099827_102525043 | 3300009090 | Vadose Zone Soil | LHMMQRWRKVANPLLETVCAENNGDHFNQGLFPIPQADKPDF* |
| Ga0099827_110122892 | 3300009090 | Vadose Zone Soil | TQRWRKVDNPLLETVCAEDNFDYFNQNLFPIPEAVKPDF* |
| Ga0099827_111346982 | 3300009090 | Vadose Zone Soil | ALVKVEDPDAFNEPLYMVRRWNKVPNQLLEMVCAENNGDHFGKNLFPVPRAHRPDF* |
| Ga0099827_112130682 | 3300009090 | Vadose Zone Soil | FNEPLYMVQRWRKVPNPRLETVCAENNVDYFGKNLFPIPQADKPDF* |
| Ga0099827_115840211 | 3300009090 | Vadose Zone Soil | QRWRKVKNELLETVCAENNADHFKQNLFPLPEATTPDF* |
| Ga0099827_118480641 | 3300009090 | Vadose Zone Soil | HVIVDDPDTFNEPLHMVQRWRKVKNDMLETVCAENNADHFKQNLFPLPEATTPDF* |
| Ga0111539_104465182 | 3300009094 | Populus Rhizosphere | EPLYMVRRWNKVPNQLLEMVCAENNGDHFGKNLFPVPRAHKPDF* |
| Ga0111539_126107311 | 3300009094 | Populus Rhizosphere | EPLYLIQRWRKVPNPLVETVCAENNEDHFNQGLFPIPRAKKPDF* |
| Ga0111539_130550961 | 3300009094 | Populus Rhizosphere | FNEPLTMMQRWRKVPNPLLETVCAENNADFFNQNLFPVPEATSPDF* |
| Ga0066709_1024151421 | 3300009137 | Grasslands Soil | EDPDTFNEPLHMTQRWRKVDNPLLETVCAEDNFDYFNQNLFPIPEAVKPDF* |
| Ga0066709_1039976312 | 3300009137 | Grasslands Soil | PLHMVQRWRKVNNPLMETVCAEDNFDYFHQNLFPIPEANKPDF* |
| Ga0099792_102580051 | 3300009143 | Vadose Zone Soil | TFNEPLHLVQRWRNVKNPLLETACAENNEDYFHQNLFPIPEADKPDF* |
| Ga0099792_103786761 | 3300009143 | Vadose Zone Soil | LHMIQRWRKVPNPMRETVCAENNGDHFGKNLFPIPQADNPDF* |
| Ga0114129_126856671 | 3300009147 | Populus Rhizosphere | QRWRKVPNPLLETVCAENNADHFDQGLFPIPQADKPDF* |
| Ga0075423_127785341 | 3300009162 | Populus Rhizosphere | RWRKVPNPLVETVCAENNEDHFNQGLFPIPRAQKPDF* |
| Ga0105248_115235172 | 3300009177 | Switchgrass Rhizosphere | RRWNKVPNPLLEMVCAENNGDRFGENLFPVPQGNKPDF* |
| Ga0116220_105958461 | 3300009525 | Peatlands Soil | MMRRWRKVPNQRLEMVCAKNNGDQFGKNLFPVPQAETPDF* |
| Ga0105347_11866561 | 3300009609 | Soil | LYMARRWNKVPNQRLEMVCAENNDDPFGGNLFPIPRADTPDF* |
| Ga0105347_13580821 | 3300009609 | Soil | TFNEPLTMMQRWRKVPNPLLETVCAENNIDPFSHNLYPIPEATKPDF* |
| Ga0116224_102952201 | 3300009683 | Peatlands Soil | GAFNEPLHMVQRWRKVGNQLLETVCAENNGDHFNKNLFPIPQADRPDF* |
| Ga0126374_113005212 | 3300009792 | Tropical Forest Soil | LHMIQRWRKVPNPTRETVCAENNGDHFNKNLFPIPQADKPDF* |
| Ga0116223_102150961 | 3300009839 | Peatlands Soil | QRWRKVRNAMLETVCSENNGDHFGHNLFPIPQADKPDF* |
| Ga0126380_116836912 | 3300010043 | Tropical Forest Soil | WRKVPNPLVETVCAENNEDHFNQGLFPLPRATKLDF* |
| Ga0126380_122715281 | 3300010043 | Tropical Forest Soil | DTFNESLYMTMRWRKVDNPLLETVCAEDNVDYFHQNLFPMPEAPKPDF* |
| Ga0126382_101363152 | 3300010047 | Tropical Forest Soil | VKVEDPDTFNEPLYMRRRWTKVPNQLLEMVCAENNGDHFGKNLFPIPRAHKRDF* |
| Ga0126382_115255292 | 3300010047 | Tropical Forest Soil | EPLYMRKRWRKSGNPHLETVCAENNADFFYHNLVPIPRAAKPDF* |
| Ga0126382_123386332 | 3300010047 | Tropical Forest Soil | DTFNEPLYMVRRWNKVPNQLLEMVCAENNGDHFGKNLFPVPRAHKPDF* |
| Ga0126373_110381001 | 3300010048 | Tropical Forest Soil | PLYMMRRWRKVPNPLLEMVCAENNGDHFGKNLFPIPQAERLDF* |
| Ga0126373_116151652 | 3300010048 | Tropical Forest Soil | HMVQRWRQVNNPFVETVCAEDNFDYFHQNLFPLPEAKKADF* |
| Ga0123356_120359091 | 3300010049 | Termite Gut | KVPNPLLEMVCAENNGDRFGENLFPVPQAEGPDF* |
| Ga0099796_104761671 | 3300010159 | Vadose Zone Soil | KVPNPMRETVCAENNGDHFGKNLFPIPQADKPDF* |
| Ga0134109_102294631 | 3300010320 | Grasslands Soil | MFKRWRKSDNPLLETVCAENNVDQFYSNLTPIPEAKKPEF* |
| Ga0134084_102930471 | 3300010322 | Grasslands Soil | FNEPLHMVQRWRKVNNPLMEMVCAEDNFDYFHQNLFPIPEADKPDF* |
| Ga0134080_101075954 | 3300010333 | Grasslands Soil | PLHMVQRWRKVNNPLMEMVCAEDNFDYFHQNLFPIPEADKPDF* |
| Ga0134063_105793821 | 3300010335 | Grasslands Soil | HMVQRWRKVPNPLLETVCAENNGDHFNQGLFPIPEATKPDF* |
| Ga0126370_102125883 | 3300010358 | Tropical Forest Soil | NSLEAYVVVEDSDTFNEPLHMVQRWRKVKNQLLETVCAENNEDVFHQNLFPLPEATTPDF |
| Ga0126370_111138361 | 3300010358 | Tropical Forest Soil | LHMVQRWRKVKNQLLETVCAENNADIFNQNLFPLPEATTPDF* |
| Ga0126370_126465442 | 3300010358 | Tropical Forest Soil | WRKVANPLVETVCAEDNVDYFHQNLFPLPEADKPDF* |
| Ga0126376_101639491 | 3300010359 | Tropical Forest Soil | EHVVERFSISPDGKKLTATVTVDDPDTFSEPLHMMQTWHKVANPLLETVCAEGNYNYFNQKLFPMPEARTPDF* |
| Ga0126376_102203761 | 3300010359 | Tropical Forest Soil | KVPNPTRETVCAENNGDHFNKNLFPIPQADKPDF* |
| Ga0126376_108864282 | 3300010359 | Tropical Forest Soil | MFKRWRKSDNPYLETVCAENNVDHFYHNLVPIPRATKADF* |
| Ga0126376_109226581 | 3300010359 | Tropical Forest Soil | RKVKNPLLETVCAENNGDHFKQNLFPLPEATTPDF* |
| Ga0126376_116776161 | 3300010359 | Tropical Forest Soil | VEDPDTFNEPIHMMQKWRKVVNPLLETVCAENNNDSIFFHQKLFPMPEATKADF* |
| Ga0126376_119494992 | 3300010359 | Tropical Forest Soil | LEAFVKVDDPNTFNEPLYMAQRWRKVPNPLLETVCAENNDDHFDQGLFPIPQADKPDF* |
| Ga0126376_125774521 | 3300010359 | Tropical Forest Soil | RWNKVPNQLLEMVCAENNGDHFGKNLFPVPRAHKPDF* |
| Ga0126376_130660622 | 3300010359 | Tropical Forest Soil | MLEALVKVDDPDTLNEPLYMMRRWRKVANPLLEMVCAENNGDHFGKNLFPIPQAERPDF* |
| Ga0126372_101907561 | 3300010360 | Tropical Forest Soil | DTFNEPLYLIQRWRKVPNPLVETVCAENNEDHFNQGLFPIPRATKPDF* |
| Ga0126372_116830901 | 3300010360 | Tropical Forest Soil | WRKVKNQLLETVCAENNGDHFKQNLFPLPEATTPDF* |
| Ga0126372_123787201 | 3300010360 | Tropical Forest Soil | DTFYEPLYLIQRWRKVPNPLVETVCAENNEDHFNQGLFPIPRATKPDF* |
| Ga0126372_130777831 | 3300010360 | Tropical Forest Soil | LHMVQRWRKVNNPLMETVCAEDNFDYFHQNLFPIPEAEKPDF* |
| Ga0126378_101381611 | 3300010361 | Tropical Forest Soil | PLYIVRRWNKVPSQPMEMVCAENNGDHFGKNLFPIPRAERPDF* |
| Ga0126377_112849991 | 3300010362 | Tropical Forest Soil | KVPNPTRETVCAENNGDHFNKNLFPIPQADMPDF* |
| Ga0126377_119768991 | 3300010362 | Tropical Forest Soil | NEPLYMRKRWRKSGNPHLETVCAENNADFFYHNLVPIPRAAKPDF* |
| Ga0126377_120268502 | 3300010362 | Tropical Forest Soil | QRWRKVDNPLLETVCAEDNVDYFNQNLFPIPEAKIPDF* |
| Ga0126377_129295461 | 3300010362 | Tropical Forest Soil | KVTDPDTFYEPLHLVQRWRKVPNPLVETVCAENNADRFGQNLFPIPRAKKPDF* |
| Ga0126379_104803622 | 3300010366 | Tropical Forest Soil | FNQPLYLVQRWRKVPNPLQESVCAENTDDFFYKNLVPIPQAEGPDF* |
| Ga0126379_105739582 | 3300010366 | Tropical Forest Soil | TFNEPLYMVQRWRKVRNPMLETVCAENNGDHFGKNLFPIPQADKPDF* |
| Ga0136449_1012290502 | 3300010379 | Peatlands Soil | HLVQQWRKVKNAMLETVCAENNIDPFHQNLFPLPEADKPDF* |
| Ga0136449_1046473212 | 3300010379 | Peatlands Soil | RWRKVRNAMLETVCSENNGDHFGHNLFPIPQTDNPDF* |
| Ga0126383_101320881 | 3300010398 | Tropical Forest Soil | MIQRWRKVPNPTRETVCAENNGDHFNKNLFPIPQADKPDF* |
| Ga0126383_116526642 | 3300010398 | Tropical Forest Soil | PLYLVRRWNKVPNQLLETVCAENNRDYFNKNLFPTPRADKPDF* |
| Ga0126383_129310471 | 3300010398 | Tropical Forest Soil | NEPLYMMRRWRKVPNLLLEMVCAENNGDRFGENLFPIPKADAPDF* |
| Ga0134127_131294112 | 3300010399 | Terrestrial Soil | LYLGRRWNKVPNPLLEMVCAENNGDRFGENLFPVPQANKPDF* |
| Ga0134122_133882881 | 3300010400 | Terrestrial Soil | KVRAPMAETVCAENNGDHFNENLHPIPQSDRPDF* |
| Ga0134121_117532101 | 3300010401 | Terrestrial Soil | KVPNQRLEMVCAENNGDHFGKNLFPIPQAATPDF* |
| Ga0134123_116652622 | 3300010403 | Terrestrial Soil | FRVDLPMIEVVCSENNEDFFNQNLFPIPEATKPDF* |
| Ga0150983_153370602 | 3300011120 | Forest Soil | WRKVDNPLLETACAENNQDYFHQNLFPIPEADKPDF* |
| Ga0137393_102758571 | 3300011271 | Vadose Zone Soil | LHMIQRWRKVPNPMRETVCAENNGDHFGKNLFPIPQADKPDF* |
| Ga0137314_10635461 | 3300011420 | Soil | SARVEDPDTFNEPLNLMQRWRKVPNPLLETVCSENNSDFFNQNLYPIPEATKLDF* |
| Ga0137436_10993992 | 3300011423 | Soil | DPDTFNETLYMVQRWRKVPNPLGESICAENNGDHFGANLFPIPEAKKFDF* |
| Ga0137389_108232622 | 3300012096 | Vadose Zone Soil | PRWRKVNNPMLETVCSENNVDYFNQNLFPIPEATRPDF* |
| Ga0137383_111786761 | 3300012199 | Vadose Zone Soil | PLYMVRRWNKVPNQLLEMVCAENNGDHFGKNLFPIPRADTPDF* |
| Ga0137363_101477933 | 3300012202 | Vadose Zone Soil | WRKVKNELLETVCSENNADHFKQNLFPLPEAATPDF* |
| Ga0137363_106239052 | 3300012202 | Vadose Zone Soil | LNEPLYMTRRWNKVPNQFLEVVCAENNGDHFGKNLFPIPQADKPDF* |
| Ga0137363_106379092 | 3300012202 | Vadose Zone Soil | WRKVKNELLETVCSENNADHFKQNLFPLPEAATPDV* |
| Ga0137363_106395643 | 3300012202 | Vadose Zone Soil | PLHMIKRWRKATNPRLETVCAENNGDHFNRNLFPIPEAKTPDF* |
| Ga0137363_107527492 | 3300012202 | Vadose Zone Soil | MMRRWRKVPNALLEMVCAENNGDHFGKNLFPIPQAERPDF* |
| Ga0137363_110509472 | 3300012202 | Vadose Zone Soil | QRWRKVPNPMRETVCAENNGDHFGKNLFPIPQADKPDF* |
| Ga0137362_110399241 | 3300012205 | Vadose Zone Soil | NAPLHMIKRWRKAANPGLETVCAENNGDHFSKNLFPIPEAKTLDF* |
| Ga0137362_113037281 | 3300012205 | Vadose Zone Soil | EDPDTFNEPLHMIQRWRKVKNQLLETVCAENNADHFKQNLFPLPEAATPDF* |
| Ga0137380_117039422 | 3300012206 | Vadose Zone Soil | FNEPLYLGRRWNKVPNQLLEMVCAENNGDHFGKNLFPIPQAERSDF* |
| Ga0137376_108767921 | 3300012208 | Vadose Zone Soil | NKVPNQLLEMVCAENERDQFGKNLFPIPQAARPDF* |
| Ga0137379_114571942 | 3300012209 | Vadose Zone Soil | NKVPNQLLEMVCAENNADHFGKNLFPVPRADRPDF* |
| Ga0137378_110795041 | 3300012210 | Vadose Zone Soil | KRWFKVDLPMIEVVCSENNDDHFNQNLYPIPQAEKPDF* |
| Ga0137377_115219141 | 3300012211 | Vadose Zone Soil | LHLVQRWRKVENPLVETVCAENNEDHFGHNLFRIPCAKRPDF* |
| Ga0137377_118338862 | 3300012211 | Vadose Zone Soil | YPDAYNEKIHMVQRWRKVPNPLLETVCAENNGDHFSQGLFPIPEATKPDF* |
| Ga0150985_1018601082 | 3300012212 | Avena Fatua Rhizosphere | YMVQRWRKVKNPLLETVCAENNSDHFGMNLFPIPQADTPDF* |
| Ga0150985_1141610712 | 3300012212 | Avena Fatua Rhizosphere | LDVLVKVEDPDAFNEPLYMTRRWNKVPNQLLEMVCAENERGQFGKNLFPIPRADKPDF* |
| Ga0137384_105106042 | 3300012357 | Vadose Zone Soil | MVEDPDTFNAPLYMVQRWRKVRNPLLETACAENNIDPFSKNLFPIPQAGRPDF* |
| Ga0137384_106652952 | 3300012357 | Vadose Zone Soil | WRKVDNPLLETVCAEDNFDYFNQNLFPIPEAVKPDF* |
| Ga0137384_108910501 | 3300012357 | Vadose Zone Soil | WRKVPNPLVETVCAENNEDHFNQGLFPIPRATKPDF* |
| Ga0137385_107907471 | 3300012359 | Vadose Zone Soil | NEPLHMMQRWRKVDNPLLETVCAEDNFDYFNQNLFPIPEADKPDF* |
| Ga0137360_109270811 | 3300012361 | Vadose Zone Soil | EPLYMVQRWRKVPNPLYETVCAENNVDYFYNNLVPIPTAAKPDF* |
| Ga0137361_101849802 | 3300012362 | Vadose Zone Soil | VVEVDDPDTLNEPLHMMRRWRKVPNALLEMVCAENNGDHFGKNLFPIPQAESPDF* |
| Ga0150984_1060225901 | 3300012469 | Avena Fatua Rhizosphere | MTMRWRKVPNEGLETVCAEDNEDYFHLNLFPMPEAAKPDF* |
| Ga0150984_1152688661 | 3300012469 | Avena Fatua Rhizosphere | DPDTFNEPIQMMQKWRKVANPLLETVCAENNNDAVFFHQKLPPMPIAAQADF* |
| Ga0137373_104858281 | 3300012532 | Vadose Zone Soil | MVQRWRKVPNPLLETVCAENNADHFEQGLFPIPQANKPDF* |
| Ga0137358_103936522 | 3300012582 | Vadose Zone Soil | GKELTALVTVEDPDTFNEPIHMMQKWRKVPNPLLETVCSEGNYNYFNQKLFPMPEAMKADF* |
| Ga0137398_112655441 | 3300012683 | Vadose Zone Soil | LYLIQRWRKVPNPLVETVCAENNEDHFNQGLFPIPRATKPDF* |
| Ga0137397_109027491 | 3300012685 | Vadose Zone Soil | DTFNEPLYMTRRWRKVPNPLLEMVCAENNGDHFGKNLFPIPQAERSDF* |
| Ga0137395_100674322 | 3300012917 | Vadose Zone Soil | MGPKSRYRRRRADDPDTLNEPLHMMRRWREVPNALLEMVCAENNGDHFGKNLFPIPQAERPDF* |
| Ga0137396_107842162 | 3300012918 | Vadose Zone Soil | SVTVEDPDAFNAPLHMIKRWRKAANPGLETVCAENNGDHFSKNLFPIPEAKTPDF* |
| Ga0137419_114102663 | 3300012925 | Vadose Zone Soil | RWRKVPNPLLEMVCAENNGDHFGKNLFPIPQAERSDF* |
| Ga0137416_106107742 | 3300012927 | Vadose Zone Soil | EALVTVDDPDTFNEPLHLQQAWRKVNNPMLETACAENNEDYFHQNLFPIPEADKPDF* |
| Ga0137407_104425043 | 3300012930 | Vadose Zone Soil | LVRIEDPDTFNEPLHLGRRWNKVPNQLLEMVCAENNGDHFGKNLFPVPQADVPDF* |
| Ga0137407_115618501 | 3300012930 | Vadose Zone Soil | QRWRKVENPLVETVCAENNEDHFGHNLFPIPRAKKPDF* |
| Ga0137407_117743341 | 3300012930 | Vadose Zone Soil | KVPNPLVETVCAENNEDHFNQGLFPMPRATKPDF* |
| Ga0126375_105024031 | 3300012948 | Tropical Forest Soil | PLHLVQRWRKVPNPLVETVCAENNADRFGQNLFPIPHAKKPDF* |
| Ga0126375_106845542 | 3300012948 | Tropical Forest Soil | LIQRWRKVPNPLVETVCAENNEDHFNQGLFPIPRATKPDF* |
| Ga0126369_100902062 | 3300012971 | Tropical Forest Soil | LSADVDDLDTLNEPLCMARRWRKVPNPLPEMVCAEKQRFGKNLFPIPQAERADF* |
| Ga0126369_115379721 | 3300012971 | Tropical Forest Soil | DPDTFNEPLHMVQRWRKVKNTLLETVCAENNADFFHQNLFPLPEAEKADF* |
| Ga0126369_123094951 | 3300012971 | Tropical Forest Soil | EDPDTFNEPLHMIQRWRKVKNELLETVCAENNSDHFKQNLFPLPEATTADF* |
| Ga0163162_109314771 | 3300013306 | Switchgrass Rhizosphere | DDPDTFNEPLYMVQRWRKVPNPLLETVCAENNVDFFYKNLFPIPTAAKPDF* |
| Ga0157372_125546291 | 3300013307 | Corn Rhizosphere | RWNKVPNPLLEMVCAENNGDRFGENLFPVPQAKTPDF* |
| Ga0134075_105206742 | 3300014154 | Grasslands Soil | YLIQRWRKVPNPLVETVCAENNEDHFNQGLFPLPRATKPDF* |
| Ga0181532_104835532 | 3300014164 | Bog | YMMRRWRKVPNQRLEMVCAENNGDHFRKNLFPIPQAETPDF* |
| Ga0182024_106924952 | 3300014501 | Permafrost | VDDPDALNEPLHLFQRWRKVKNELLETVCAENNEDFFHQNLFPLPVAEKADF* |
| Ga0181522_103622091 | 3300014657 | Bog | NVRRRGMRDEMVYAENNWDDFNQGLAPIPQADKPDF* |
| Ga0180074_10211174 | 3300014877 | Soil | NKVPNQRLEMVCAENNGDHFGGNLFPIPRADAPDF* |
| Ga0180062_10423151 | 3300014879 | Soil | RVEDPDTFNEPLYMARRWNKVPNQRLEMVCGENNGDHFGGNLFPIPQADAPDF* |
| Ga0167644_11637441 | 3300015206 | Glacier Forefield Soil | EDPDTFNAPLNMVRRWRRVPNPLYEMVCGENNRDYFGLNLFPIPHADTPDF* |
| Ga0137418_101102211 | 3300015241 | Vadose Zone Soil | LWQRDCDPDAYNEKIHMVQRWRKVPNPLLEMVCAENNGDHFGKNLFPVPYADTPDF* |
| Ga0137418_103629882 | 3300015241 | Vadose Zone Soil | RWRKLPNPLVETVCAENNEDHFNQGLFPIPRATKPDF* |
| Ga0137409_100374451 | 3300015245 | Vadose Zone Soil | PLHMIQRWRKVPNPMRETVCAENNGDHFGKNLFPIPQADKPDF* |
| Ga0137409_105779671 | 3300015245 | Vadose Zone Soil | DPEAFNEPLHMMQKWRKVENQRLETVCAEGNENYFNQKLFPMPEATKADF* |
| Ga0134089_103974751 | 3300015358 | Grasslands Soil | TFNEPLHMAQRWRKVNNPLMETVCAEDNFDYFHQNLFPIPEAAKPDF* |
| Ga0132257_1015611461 | 3300015373 | Arabidopsis Rhizosphere | LNLMQRWRKVQNELIETVCAENNQDHFNHNLFPIPEAKKFDF* |
| Ga0132255_1048801041 | 3300015374 | Arabidopsis Rhizosphere | DTFNEPLHLVQRWRKVENPLLETVCAENNEDHFGHNLFPMPRAKKPDF* |
| Ga0182036_101348421 | 3300016270 | Soil | HMIKRWRKVNNQMLETVCAENNGDHFSKNLFPIPQADTPDF |
| Ga0182041_112607822 | 3300016294 | Soil | DTFNEPLYMARRWRKVPNQRLEMVCAENNGDHFGKNLFPIPQAGTPDF |
| Ga0182033_109252511 | 3300016319 | Soil | MNPDALNEPLHLMQTWRKVPNPLLETACAENNEDFFHQNLIPVPEADKPDF |
| Ga0182035_112424362 | 3300016341 | Soil | VLVKVEDPDTFNEPLYLGRRWSKVPNQLLEMVCAENSGDHFGGNLFPVPRADRPDF |
| Ga0182032_100386076 | 3300016357 | Soil | ARRWRKVPNQRLEMVCAENNGDHFGKNLFPIPQAETPDF |
| Ga0182040_104982533 | 3300016387 | Soil | TMQQRWVKMNTPFRESVCAENNGDYFHQNLFPLPEAKTPDF |
| Ga0182040_107719211 | 3300016387 | Soil | VKVDDSDTFNEPLYMMRRWRKVPNPLQEMVCAENNFDRFGKNLFPVPHADTPDF |
| Ga0182037_115427991 | 3300016404 | Soil | GKELTAVVTVDDPDTFSEPIHMMQKWRKVPNPLLETICAEGNYNYFNQKLFPMPEAKTPD |
| Ga0182039_101186901 | 3300016422 | Soil | RKVKNTLLETVCAENNADFFHQNLFPLPEAEKADF |
| Ga0182039_114515292 | 3300016422 | Soil | DPDTFSEPIHMMQKWRKVPNPLLETICAEGNYNYFNQKLFPMPEAKTPDF |
| Ga0134074_12901081 | 3300017657 | Grasslands Soil | VEDSDTFNEPLHMVQRWRKVNNPLMETVCAEDNFDYFHQNLFPIPEADKPDF |
| Ga0187825_101975562 | 3300017930 | Freshwater Sediment | TVDDPDTFNEPLHMKQTWHKVRNPLIETVCAENNNDAIFFHQKLFPIPEAKSSDF |
| Ga0187814_103003641 | 3300017932 | Freshwater Sediment | IYMTRRWRKVPNLRLEMVCAENNGDHFGKNLFPIPQAQMLDF |
| Ga0187819_107223132 | 3300017943 | Freshwater Sediment | DPDTFNEPLHMIMRWRKVPNPMLETVCAENNGDIFGKNLFPVPHADKSDI |
| Ga0190266_102145231 | 3300017965 | Soil | DPDTFNEPIYMARRWNKVPNQRLEMVCAENNDDQFGGNLFPIPRADTPDF |
| Ga0187776_110136261 | 3300017966 | Tropical Peatland | LFSAQTVSNPGLETVCAENNGDHFSRNLFPIPEATTPDF |
| Ga0187782_101760941 | 3300017975 | Tropical Peatland | MTRRWNKVPNPLLEMVCAENNGDRFGENLFLPPQADTPDF |
| Ga0187822_103800781 | 3300017994 | Freshwater Sediment | NAPLFMVRRWRKVVNPLLEMVCAENNSDHFGENLYPVPRADTPDF |
| Ga0184605_101408391 | 3300018027 | Groundwater Sediment | YMMQRWRKVPNPLLETVCAENNGDHFGKNLFPIPQADKPDF |
| Ga0184608_100375482 | 3300018028 | Groundwater Sediment | RPKVSNALVESVCGENTEDQFNQGLFPIPCAPKRDF |
| Ga0187883_107198662 | 3300018037 | Peatland | WRKVKNPMLETVCAENNVDYFHQNLFPLPEATTPDF |
| Ga0187784_105736721 | 3300018062 | Tropical Peatland | DPDTLNEPLYMKRRWRKVPNALLEIVCAENNGDHFGKNLFPIPQAERPDF |
| Ga0184635_103374941 | 3300018072 | Groundwater Sediment | DAFNETLYMMQRWRKVPNPLRESICAENNVDHFGANLFPIPEAKKFDF |
| Ga0184628_100238621 | 3300018083 | Groundwater Sediment | PLTMMQRWRRVENQLLETVCAENNADFFNQNLYPIPEATKPDF |
| Ga0187772_109378062 | 3300018085 | Tropical Peatland | VQRWRKVKNTLLETVCAENNADFFHQNLFPLPEADKADF |
| Ga0066655_103429981 | 3300018431 | Grasslands Soil | PDTFNEPLHMVQRWRKVDNPLLETVCAENNFDYFNQNLFPIPEAAKPDF |
| Ga0066667_104112451 | 3300018433 | Grasslands Soil | MVQRWRKVNNPLMETVCAEDNFDYFHQNLFPIPEADKPDF |
| Ga0066662_101521342 | 3300018468 | Grasslands Soil | HMAQRWRKVDNPLLETVCAENNADHFNQGLFPIPEAKKVDF |
| Ga0066662_126430151 | 3300018468 | Grasslands Soil | AFNEPLHMVQRWRKVENELLETVCAENHEEFFSQNLFPIPRADQPDF |
| Ga0066669_116501351 | 3300018482 | Grasslands Soil | TQRWRKVPNPLLETVCAENNVDFFYKNLFPVPTAEKTDF |
| Ga0193733_11698441 | 3300020022 | Soil | EDPDAYKEPIYLAQRWRKVDNPLHETVCAENNEDHFNQGLFPIPEAKKFDF |
| Ga0193753_103359022 | 3300020034 | Soil | DADTLNAPLHMLKRWRKMENPLLETVCSENNSDLFGQNLFPIPQANNPDF |
| Ga0179594_101385481 | 3300020170 | Vadose Zone Soil | LHMIKRWRKAANPGLETVCAENNGDHFSKNLFPIPEAKTPDF |
| Ga0179592_101637072 | 3300020199 | Vadose Zone Soil | MGPKSRYRRRRADDPDTLNEPLHMMRRWRKVPNALLEMVCAENNGDHFGKNLFPIPQAERPDF |
| Ga0210407_100855783 | 3300020579 | Soil | KMLQATVTVDDPDTFNEPLHLQQGWRKVDNPLLETACAENNEDYFHQNLFPIPEADKPDF |
| Ga0210399_110743461 | 3300020581 | Soil | MIKRWRKAANPGLETVCAENNGDHFSKNLFPIPEAKTPDF |
| Ga0210382_105173941 | 3300021080 | Groundwater Sediment | NETLYMVQRWRKVPNPLRESICAENNGDHFGANLFPIPEAKKFDF |
| Ga0179596_100116981 | 3300021086 | Vadose Zone Soil | NEPLYMVQRWRKVPNPLYETVCAENNVDYFYNNLVPIPTAAKPDF |
| Ga0210406_105317141 | 3300021168 | Soil | VEDPDTFNEPLHMVQRWRKVKNQLLETVCAENNEDHFHQNLFPLPEATTPDF |
| Ga0210406_106422572 | 3300021168 | Soil | DAFNEPLHMVQRWRKVKNELQETVCAENHEEFFNQNLFPIPQADKPDF |
| Ga0210406_109984042 | 3300021168 | Soil | KTLDVDVTVDDPDAFNEPLHLGQRWRNVKNLMLETVCAENNEDYFHQNLFPIPEADRPDF |
| Ga0210400_100964105 | 3300021170 | Soil | RKATNPGLETVCAENNGDHFSKNLFPIPEATTPDF |
| Ga0210400_104135471 | 3300021170 | Soil | DPDTFNEPLHLRQGWRRVDNPLLETACAENNEDYFHQNLFPIPEADKPDF |
| Ga0210400_112608882 | 3300021170 | Soil | MIKRWRRANNPGLETVCAENNGDHFNRNLFPIPQAEKADF |
| Ga0210405_110407621 | 3300021171 | Soil | RKVKNQLLETVCAENNGDHFSKNLFPIPQAATPDF |
| Ga0210408_106554832 | 3300021178 | Soil | AFNEPLHLRQGWRKVDNLLLETACAENNGDYFHQNLFPIPEDDKPDF |
| Ga0210383_102922121 | 3300021407 | Soil | RAAPYDKRWRRAANPGLETVCAENNGDHFSKNLFPIPEAKTPDF |
| Ga0210383_106109222 | 3300021407 | Soil | MVQRWRKVKNQLLETVCAENNGDHFSKNLFPIPQAATPDF |
| Ga0210384_110623752 | 3300021432 | Soil | ATVDDSDTFNAPLTMMQQWRKVDNPLLETVCSENNADFFHQNLFPIPEAGTPDF |
| Ga0210402_103015973 | 3300021478 | Soil | DPDTFNEPLYMVRRWRKVPNQRLEMVCAENNGDHFGKNLFPIPQAETPDF |
| Ga0210402_104365112 | 3300021478 | Soil | DPGTFNEPLHMVQRWRKVQNALLETVCAENNVDIFHQNLFPMPEAETADF |
| Ga0210402_106963091 | 3300021478 | Soil | ALVTVEDPDTFNAPLHMLKRWRRTDNPTLETVCAENNGDHFSKNLFPIPQADKPDF |
| Ga0210402_107796921 | 3300021478 | Soil | LAADGKTLEAVVKVDDPGTFNEPLYLARRWRKVPNLLQEMVCAENNGDHFGLNLFPIPHADTPDF |
| Ga0210410_111419431 | 3300021479 | Soil | DGKTLDAVVKVDDPDTFNAPLYMARSWRKVPNPLFEMVCAENNGDHFGKNLFPIPHADTADF |
| Ga0213852_14867831 | 3300021858 | Watersheds | QQWHKVNNPLIETVCSENNADFFHQNLFPIPQADKPDF |
| Ga0213851_11741591 | 3300021860 | Watersheds | MVQRWRKVKNALLETVCAENNVDHFKQNLFPLPEADKPDF |
| Ga0242648_10298321 | 3300022506 | Soil | LHLRQGWRKVDNAVQETACAENNEDYFHQNLFPIPEADKPDF |
| Ga0242662_101705542 | 3300022533 | Soil | DDPGAFNEPLHMVQRWRKVKNQMLETVCSENNGDHFSKNLFPIPQATTPDF |
| Ga0212123_109175582 | 3300022557 | Iron-Sulfur Acid Spring | PDTFNEPLYMVRRWRKVPNPLLEMVCAENNGDHFGKNLFPIPQADRADF |
| Ga0222623_103508352 | 3300022694 | Groundwater Sediment | VQRWRKVENPLVETVCAENNEDHFGHNLFPIPRAKKPDF |
| Ga0222622_101583912 | 3300022756 | Groundwater Sediment | TFNEPLYMVRLWNKVPNQLLEMVCAENNGDHFGKNLFPVPRAHKPDF |
| Ga0247679_10349812 | 3300024251 | Soil | LVKVEDPDTFNEPLYMGRRWNKVPNQLLEMVCAENNSDHFGLNLFPVPQADTPDF |
| Ga0179589_104410301 | 3300024288 | Vadose Zone Soil | RWFKVDLPMLEVVCSENNDDHFQQNLFPIPQADKPDF |
| Ga0247668_10123161 | 3300024331 | Soil | MVEDPDTFNEPLHMMQTWHKVRNPLLETVCAENNNDSLFFHQKLFPMPEAIKADF |
| Ga0207663_109678211 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | LTALVTVEDPDTFNEPIHMKQTWHKVVNPLLETVCAENNNDSIFFHQKLFPMPEAAKPDF |
| Ga0207650_116089251 | 3300025925 | Switchgrass Rhizosphere | LYLGRRWNKVPNPLLEMVCAENNGDRFGENLFPIPQTDRPDF |
| Ga0207700_108661392 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | DTFNEPLHMKQTWHKVRNPLIETVCAENNNDAVFFHQKLFPIPEAKSSDF |
| Ga0207701_111424942 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | NKVANPLLEMVCAENNFDPFGKNLFPVPQAAAPDF |
| Ga0207706_104066843 | 3300025933 | Corn Rhizosphere | YMARRWNKVPNQRLEMVCAENNGNHFGGNLFPIPRADTPDF |
| Ga0207677_118781521 | 3300026023 | Miscanthus Rhizosphere | ARRWNKVPNQRLEMVCAENNGNHFGGNLFPIPRADTPDF |
| Ga0207708_113515301 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | DTFNEPLYMARRWNKVPNQRLEMVCAENNGNHFGGNLFPIPRADTPDF |
| Ga0207683_109483162 | 3300026121 | Miscanthus Rhizosphere | RWNKVPNPLLEMVCAENNGDRFGENLFPIPQTDRPDF |
| Ga0209240_12042521 | 3300026304 | Grasslands Soil | RWRKVPNPMRETVCAENNGDHFGKNLFPIPQADKPDF |
| Ga0209240_12860802 | 3300026304 | Grasslands Soil | HLVQRWRNVKNPMLETVCAENNEDYFHQNLFPIPQADAPDF |
| Ga0209801_11240821 | 3300026326 | Soil | DTFNEPLHMVQRWRQVANPLLETVCAEDNFDYFHQNLFPIPEADKPDF |
| Ga0209802_11850681 | 3300026328 | Soil | DPDTFNEPLHMVQRWRKVNNPLMETVCAEDNFDYFHQNLFPIPEADKPDF |
| Ga0257162_10371912 | 3300026340 | Soil | DTLNEPLHMMRRWRKVPNALLEMVCAENNGDHFGKNLFPIPQAERPDF |
| Ga0257167_10413182 | 3300026376 | Soil | NEPLHMIQRWRKVKNELLETVCAENNEDHFKQNLFPLPEATTPDF |
| Ga0257169_10588502 | 3300026469 | Soil | EDPDAFNAPLHMIKRWRKAANPGLETVCAENNGDHFSKNLFPIPEAKTPDF |
| Ga0257168_10368391 | 3300026514 | Soil | FNAPLHMIKRWRKAANPGLETVCAENNGDHFSKNLFPIPEAKTPDF |
| Ga0209648_107125011 | 3300026551 | Grasslands Soil | RWRKVKNQLLETVCAENNEDHFKQNLFPLPEATTPDF |
| Ga0209577_105910712 | 3300026552 | Soil | PDAYNEKIHMVQRWRKVPNPLLETVCAENNADHFNQGLFPIPEAKKVDF |
| Ga0179593_11299211 | 3300026555 | Vadose Zone Soil | DGVWNKVPNQLLEMVCAENNGDHFGKNLFPVPQADVPDF |
| Ga0179587_107078042 | 3300026557 | Vadose Zone Soil | HLRQAWRKVNNPMLETPCAENNEDYFNQNLFPIPEADKPDF |
| Ga0179587_111383711 | 3300026557 | Vadose Zone Soil | LRQGWRKVDNLMLETACAENNEDYFHQNLFPIPEADKPDF |
| Ga0209625_10949022 | 3300027635 | Forest Soil | FNEPLHMIQRWRKVPNQMRETVCAENNGDHFGKNLFPIPQADKPDF |
| Ga0208827_11418872 | 3300027641 | Peatlands Soil | AFNEPLHMIKRWRKATNPRLETVCSENNGDHFNQNLFPIPEAKTPDF |
| Ga0208981_11651131 | 3300027669 | Forest Soil | EALVTVDDPDAFNEPLHLIQRWRKVNNPMLETACAENNEDYFHQNLFPIPEADKPDF |
| Ga0208991_12002771 | 3300027681 | Forest Soil | DADTFNEPLHMMQRWRRVRNQMLETVCAENNGDHFNKNLFPIPQSDKPDF |
| Ga0209626_11627772 | 3300027684 | Forest Soil | PLYMVRRWRKVPNPLLEMVCAENNGDHFGKNLFLVPQADRPDF |
| Ga0209038_101730361 | 3300027737 | Bog Forest Soil | KRWRRAANPMLETVCAENNGDRFTKNLFPIPQADKADF |
| Ga0209074_103903801 | 3300027787 | Agricultural Soil | PDTFNEPLHMKQTWHKVRNPLIETVCAENNNDAIFFHQKLFPIPEAKSSDF |
| Ga0209283_106164532 | 3300027875 | Vadose Zone Soil | YMMRRWRKAPNPLLEMVCAENNGDHFGKNLFPIPQAQRADF |
| Ga0209590_107060571 | 3300027882 | Vadose Zone Soil | ALVKVEDPDAFNEPLYMVRRWNKVPNQLLEMVCAENNGDHFGKNLFPVPRAHRPDF |
| Ga0207428_106841052 | 3300027907 | Populus Rhizosphere | MEAFVKVDDPDTFHEPLYLIQRWRKVPNPLVETVCAENNEDHFNQGLFPIPRAKKPDF |
| Ga0209583_104268551 | 3300027910 | Watersheds | NEPLHMVQRWRKVNNPMLETACAENNEDYFHQNLFPIPEADKPDF |
| Ga0209698_105635211 | 3300027911 | Watersheds | RFMTKRWRRATNPRLETVCAENNGDHFNRNLFPIPEAKTPDF |
| Ga0268266_122783751 | 3300028379 | Switchgrass Rhizosphere | DGKLLMTLGKPGVAGDGPDTFNEPLHMQQKWRKVVNPLLETVCAENNNDAIFFKQKLPPIPEAKTPDF |
| Ga0265336_102527352 | 3300028666 | Rhizosphere | TVDDPDTFNEPLHMMQTWHKVRNPLLETVCAENNNDSVFFHQKLFPMPEATKVDF |
| Ga0222749_103237561 | 3300029636 | Soil | PLHLRQGWRKVNNPMLETACAENNEDFFHQNLFPIPQADKPDF |
| Ga0222749_108194801 | 3300029636 | Soil | MSRSWRKVPNPLFEMVCAENNGDHFGKNLFPVPHADTADF |
| Ga0311357_103665942 | 3300030524 | Palsa | DDSDTFNEPLHLVQRWRKVKNPLLETVCAENNGDYFHQNLFPLPEADKPDF |
| Ga0311355_102955541 | 3300030580 | Palsa | VDDSDTFNEPLHLVQRWRKVKNPLLETVCAENNGDYFHQNLFPLPEADKPDF |
| Ga0316363_104407431 | 3300030659 | Peatlands Soil | PLYMMRRWRKVPNQLLEMVCAENNGDHFGKNLFPIPQADTPDF |
| Ga0302323_1010952532 | 3300031232 | Fen | TLNAPLHMLKRWRRAENPMLETVCAENNEDRFSRNLFPIPQADQPDF |
| Ga0170818_1150576601 | 3300031474 | Forest Soil | MARRWNKVPNPLLEMVCAENNGDQFGKNLFPVPQADRPDF |
| Ga0318571_102776532 | 3300031549 | Soil | RWSKVPNQLLEMVCAENSGDHFGGNLFPVPRADRPDF |
| Ga0318528_104389302 | 3300031561 | Soil | VQRWRKVKNQMLETVCSENNGDHFSKNLFPIPQATTPDF |
| Ga0318515_105662202 | 3300031572 | Soil | FNEPLHMVQRWRKVKNQMLETVCSENNGDHFSKNLFPIPQATTPDF |
| Ga0310686_1195289321 | 3300031708 | Soil | NDPDTFNEPLRMLKRWRKVPNPMRETVCGENNGDTFSKNLFPIPQTDTPDF |
| Ga0318496_107190061 | 3300031713 | Soil | RWRKVKNQMLETVCSENNGDHFSKNLFPIPQATTPDF |
| Ga0307476_102030933 | 3300031715 | Hardwood Forest Soil | VEDPDTFNEPLSMIKRWRRATNPGLETVCAENNGDHFSRNLFPIPEAKTPDF |
| Ga0307469_116845532 | 3300031720 | Hardwood Forest Soil | RWRKVPNPLVETVCAENNEDHFNQGLFPIPRATKPDF |
| Ga0307469_119433191 | 3300031720 | Hardwood Forest Soil | DTFNEPLHLVQRWRKVDNPLVETVCAENNEDHFGHNLFPMPRAKKPDF |
| Ga0306918_114913581 | 3300031744 | Soil | DAFNEPLYMLKRWRKVNNQLLETVCAENNGDRFSHNLFPIPEAKTPDF |
| Ga0307477_109697851 | 3300031753 | Hardwood Forest Soil | DDPDTFNAPLHLRQAWRKVDNPMLETACAENNEDYFHQNLFPIPQAEKPDF |
| Ga0318523_106638081 | 3300031798 | Soil | EPLHMVQRWRKVKNQMLETVCSENNGDHFSKNLFPIPQATTPDF |
| Ga0310913_104415412 | 3300031945 | Soil | FNEPLYMMRRWRKVPNPLQEMVCAENNFDRFGKNLFPVPHADTPDF |
| Ga0310910_104965291 | 3300031946 | Soil | LKRWRRTDNPTLETVCAENNGDHFSKNLFPIPQADKPDF |
| Ga0310910_107192241 | 3300031946 | Soil | FNEPLYMIKRWRKAENPLIETVCAENNVDQFYQNLVPIPQASKPDF |
| Ga0310909_112840392 | 3300031947 | Soil | KRWRKAENPLIETVCAENNVDQFYQNLVPIPQASKPDF |
| Ga0306926_109694601 | 3300031954 | Soil | AYNEPLYMIKRWRKAENPLIETVCAENNVDQFYQNLVPIPQASKPDF |
| Ga0306922_115300922 | 3300032001 | Soil | DTFNEPLHMIQRWRKVPNPMRETVCAENNGDHFNKNLFPIPQADKPDF |
| Ga0318545_102990573 | 3300032042 | Soil | RLTMPLGMVQRWRRVRNQMLETVCAENNGDHFGKNLFPIPHADTPDF |
| Ga0318575_106932892 | 3300032055 | Soil | DALVKVDDPDAFNEPLYMAQRWRKVPNPLIEYSCAENNGDHFGKNLFPIPQATKPDF |
| Ga0311301_105473301 | 3300032160 | Peatlands Soil | WRKVKNAMLETVCAENNIDPFHQNLFPLPEADKPDF |
| Ga0311301_128783562 | 3300032160 | Peatlands Soil | MMRRWRKVPNQRLEMVCAKNNGDQFGKNLFPVPQAETPDF |
| Ga0307470_103145722 | 3300032174 | Hardwood Forest Soil | PDTLHEPLYQIQRWRKVPNPLVETVCAENNEDHYNQGLFPIPRAHKPDF |
| Ga0307471_1032186011 | 3300032180 | Hardwood Forest Soil | FHEPLYLIQRWRKVPNPLVETVCAENNEDHFNQGLFPIPRAKKPDF |
| Ga0307472_1020160472 | 3300032205 | Hardwood Forest Soil | LVQRWRKVTNPLLETVCAENNADHFDQGLFPIPQANKPDF |
| Ga0307472_1022113002 | 3300032205 | Hardwood Forest Soil | WNKVPNQLLETVCAENERDQFGKNLFPIPRADKPDF |
| Ga0306920_1025555953 | 3300032261 | Soil | PDTFNEPLYMVRRWRKVPNPLLEMVCAENNGDHFGKNLFPVPHADTPDF |
| Ga0348332_116198561 | 3300032515 | Plant Litter | WRKVNNPMLETVCSENNADYYHQNLFPIPEADEADF |
| Ga0335081_116679021 | 3300032892 | Soil | ARRWRRVPNQRLEMVCAENNGDHFGKNLFPIPQAEKPDF |
| Ga0326726_122130121 | 3300033433 | Peat Soil | RRWNKVPNPLLEMVCAENNGDRFGGNLFPVPQADRPDF |
| Ga0314865_144901_517_630 | 3300033806 | Peatland | RWRKATNPGLETVCAENNGDHFNKNLFPIPEAKTADF |
| Ga0314867_153801_376_540 | 3300033808 | Peatland | VVVDDPDTFNEPLHMVQRWRKVKNALLETVCAENNVDIFHQNLFPMPEAETADF |
| Ga0364945_0276953_338_520 | 3300034115 | Sediment | KALDVVVRVEDPDTFNEPLYMARRWNKVPNQRLEMVCGENNGDHFGGNLFPIPQADAPDF |
| Ga0364929_0366051_3_110 | 3300034149 | Sediment | RKVPNPLLETACAENNGDHFGKNLFPIPEAKKFDF |
| ⦗Top⦘ |