| Basic Information | |
|---|---|
| Family ID | F008096 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 339 |
| Average Sequence Length | 44 residues |
| Representative Sequence | HLAEFMEGLYNTVVRQWAVDLTGPHKLTDRVRSAVEFFLRGIRP |
| Number of Associated Samples | 241 |
| Number of Associated Scaffolds | 339 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.98 % |
| % of genes near scaffold ends (potentially truncated) | 88.50 % |
| % of genes from short scaffolds (< 2000 bps) | 79.06 % |
| Associated GOLD sequencing projects | 221 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.791 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (20.354 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.844 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (58.407 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.83% β-sheet: 0.00% Coil/Unstructured: 54.17% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 339 Family Scaffolds |
|---|---|---|
| PF08240 | ADH_N | 82.01 |
| PF13620 | CarboxypepD_reg | 6.19 |
| PF00106 | adh_short | 2.65 |
| PF02129 | Peptidase_S15 | 0.88 |
| PF00501 | AMP-binding | 0.59 |
| PF13561 | adh_short_C2 | 0.59 |
| PF00593 | TonB_dep_Rec | 0.59 |
| PF13193 | AMP-binding_C | 0.59 |
| PF00300 | His_Phos_1 | 0.59 |
| PF12697 | Abhydrolase_6 | 0.29 |
| PF08530 | PepX_C | 0.29 |
| PF02737 | 3HCDH_N | 0.29 |
| PF00108 | Thiolase_N | 0.29 |
| PF00378 | ECH_1 | 0.29 |
| PF00440 | TetR_N | 0.29 |
| PF00561 | Abhydrolase_1 | 0.29 |
| COG ID | Name | Functional Category | % Frequency in 339 Family Scaffolds |
|---|---|---|---|
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.29 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.29 |
| COG0287 | Prephenate dehydrogenase | Amino acid transport and metabolism [E] | 0.29 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.29 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.29 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.29 |
| COG1748 | Saccharopine dehydrogenase, NADP-dependent | Amino acid transport and metabolism [E] | 0.29 |
| COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 0.29 |
| COG2936 | Predicted acyl esterase | General function prediction only [R] | 0.29 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.79 % |
| Unclassified | root | N/A | 11.21 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10217707 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300001356|JGI12269J14319_10169900 | Not Available | 900 | Open in IMG/M |
| 3300001593|JGI12635J15846_10607155 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300001867|JGI12627J18819_10008454 | All Organisms → cellular organisms → Bacteria | 4006 | Open in IMG/M |
| 3300001867|JGI12627J18819_10224229 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100002137 | All Organisms → cellular organisms → Bacteria | 13587 | Open in IMG/M |
| 3300002910|JGI25615J43890_1036527 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300002914|JGI25617J43924_10015783 | All Organisms → cellular organisms → Bacteria | 2552 | Open in IMG/M |
| 3300002914|JGI25617J43924_10350534 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300002917|JGI25616J43925_10071962 | All Organisms → cellular organisms → Bacteria | 1460 | Open in IMG/M |
| 3300003351|JGI26346J50198_1005635 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
| 3300003370|JGI26337J50220_1030071 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10439797 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300004082|Ga0062384_100484242 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300004082|Ga0062384_101222468 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300004092|Ga0062389_100986069 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
| 3300004092|Ga0062389_104300424 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300004152|Ga0062386_100525705 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300004631|Ga0058899_12080508 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300005177|Ga0066690_10113131 | All Organisms → cellular organisms → Bacteria | 1756 | Open in IMG/M |
| 3300005177|Ga0066690_10404435 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300005435|Ga0070714_100732108 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300005451|Ga0066681_10274111 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1028 | Open in IMG/M |
| 3300005467|Ga0070706_100305074 | All Organisms → cellular organisms → Bacteria | 1485 | Open in IMG/M |
| 3300005471|Ga0070698_100395958 | All Organisms → cellular organisms → Bacteria | 1314 | Open in IMG/M |
| 3300005541|Ga0070733_10415829 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300005541|Ga0070733_10607402 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300005542|Ga0070732_10447336 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300005542|Ga0070732_10564282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Caldilineae → unclassified Caldilineae → Caldilineae bacterium | 691 | Open in IMG/M |
| 3300005602|Ga0070762_11099988 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300005610|Ga0070763_10615043 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300005610|Ga0070763_10810654 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300005764|Ga0066903_100206946 | All Organisms → cellular organisms → Bacteria | 2947 | Open in IMG/M |
| 3300005944|Ga0066788_10083271 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300005950|Ga0066787_10013077 | All Organisms → cellular organisms → Bacteria | 1355 | Open in IMG/M |
| 3300006041|Ga0075023_100298443 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300006047|Ga0075024_100404696 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 695 | Open in IMG/M |
| 3300006050|Ga0075028_100521323 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300006052|Ga0075029_100265733 | Not Available | 1087 | Open in IMG/M |
| 3300006059|Ga0075017_100283021 | All Organisms → cellular organisms → Bacteria | 1220 | Open in IMG/M |
| 3300006059|Ga0075017_100582950 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300006059|Ga0075017_101473507 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300006162|Ga0075030_100171736 | All Organisms → cellular organisms → Bacteria | 1750 | Open in IMG/M |
| 3300006173|Ga0070716_100369853 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
| 3300006174|Ga0075014_100695195 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300006174|Ga0075014_100887997 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300006176|Ga0070765_100347517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1378 | Open in IMG/M |
| 3300006176|Ga0070765_102150131 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300006176|Ga0070765_102313218 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300006804|Ga0079221_10913148 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
| 3300007258|Ga0099793_10021674 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2646 | Open in IMG/M |
| 3300009038|Ga0099829_10399816 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
| 3300009038|Ga0099829_10747262 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300009038|Ga0099829_11211012 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300009038|Ga0099829_11418172 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300009038|Ga0099829_11709162 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300009088|Ga0099830_10173336 | All Organisms → cellular organisms → Bacteria | 1674 | Open in IMG/M |
| 3300009088|Ga0099830_10594435 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 907 | Open in IMG/M |
| 3300009088|Ga0099830_11477142 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300009089|Ga0099828_10017882 | All Organisms → cellular organisms → Bacteria | 5463 | Open in IMG/M |
| 3300009090|Ga0099827_10259172 | All Organisms → cellular organisms → Bacteria | 1463 | Open in IMG/M |
| 3300009521|Ga0116222_1002263 | All Organisms → cellular organisms → Bacteria | 10204 | Open in IMG/M |
| 3300009521|Ga0116222_1004366 | All Organisms → cellular organisms → Bacteria | 7075 | Open in IMG/M |
| 3300009523|Ga0116221_1033690 | All Organisms → cellular organisms → Bacteria | 2510 | Open in IMG/M |
| 3300009523|Ga0116221_1543341 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300009524|Ga0116225_1320143 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300009524|Ga0116225_1437934 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300009548|Ga0116107_1206500 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300009624|Ga0116105_1087361 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300009632|Ga0116102_1113471 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300009632|Ga0116102_1115926 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300009637|Ga0116118_1123245 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300009640|Ga0116126_1161208 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300009643|Ga0116110_1101851 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300009645|Ga0116106_1220064 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300009683|Ga0116224_10025600 | All Organisms → cellular organisms → Bacteria | 2902 | Open in IMG/M |
| 3300009700|Ga0116217_10416855 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300009824|Ga0116219_10021192 | All Organisms → cellular organisms → Bacteria | 4002 | Open in IMG/M |
| 3300009824|Ga0116219_10024023 | All Organisms → cellular organisms → Bacteria | 3725 | Open in IMG/M |
| 3300009824|Ga0116219_10125341 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1492 | Open in IMG/M |
| 3300009824|Ga0116219_10316479 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300009824|Ga0116219_10711622 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300010048|Ga0126373_10093891 | All Organisms → cellular organisms → Bacteria | 2761 | Open in IMG/M |
| 3300010048|Ga0126373_10480887 | All Organisms → cellular organisms → Bacteria | 1281 | Open in IMG/M |
| 3300010048|Ga0126373_11002344 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300010048|Ga0126373_11027330 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300010048|Ga0126373_11224657 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300010343|Ga0074044_10713367 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300010343|Ga0074044_10905031 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300010360|Ga0126372_13208906 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300010366|Ga0126379_10576934 | All Organisms → cellular organisms → Bacteria | 1207 | Open in IMG/M |
| 3300011120|Ga0150983_15504095 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300011270|Ga0137391_10790758 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 782 | Open in IMG/M |
| 3300011271|Ga0137393_10769818 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300012189|Ga0137388_11723502 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
| 3300012202|Ga0137363_10879226 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300012205|Ga0137362_10399196 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
| 3300012205|Ga0137362_11386132 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 589 | Open in IMG/M |
| 3300012206|Ga0137380_11532835 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300012351|Ga0137386_10429875 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300012361|Ga0137360_11354205 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300012925|Ga0137419_10212726 | All Organisms → cellular organisms → Bacteria | 1438 | Open in IMG/M |
| 3300012927|Ga0137416_10830192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 819 | Open in IMG/M |
| 3300014159|Ga0181530_10433821 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300014162|Ga0181538_10622371 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300014165|Ga0181523_10473873 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300014169|Ga0181531_10744059 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300014200|Ga0181526_10360129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 925 | Open in IMG/M |
| 3300014489|Ga0182018_10334672 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300014495|Ga0182015_10731618 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300014501|Ga0182024_10576950 | All Organisms → cellular organisms → Bacteria | 1413 | Open in IMG/M |
| 3300014638|Ga0181536_10270181 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300015193|Ga0167668_1071724 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300016270|Ga0182036_10104980 | All Organisms → cellular organisms → Bacteria | 1929 | Open in IMG/M |
| 3300016341|Ga0182035_11063575 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300016404|Ga0182037_11589485 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300016730|Ga0181515_1329506 | All Organisms → cellular organisms → Bacteria | 1556 | Open in IMG/M |
| 3300017823|Ga0187818_10035270 | All Organisms → cellular organisms → Bacteria | 2148 | Open in IMG/M |
| 3300017823|Ga0187818_10042035 | All Organisms → cellular organisms → Bacteria | 1963 | Open in IMG/M |
| 3300017823|Ga0187818_10191279 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300017823|Ga0187818_10385291 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300017929|Ga0187849_1171241 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300017930|Ga0187825_10141431 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 847 | Open in IMG/M |
| 3300017933|Ga0187801_10016599 | All Organisms → cellular organisms → Bacteria | 2464 | Open in IMG/M |
| 3300017933|Ga0187801_10224406 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300017933|Ga0187801_10343783 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300017934|Ga0187803_10351396 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300017940|Ga0187853_10338870 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300017943|Ga0187819_10220231 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
| 3300017943|Ga0187819_10523915 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300017961|Ga0187778_10666779 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300017970|Ga0187783_10014501 | All Organisms → cellular organisms → Bacteria | 5814 | Open in IMG/M |
| 3300017975|Ga0187782_11369656 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300018004|Ga0187865_1309251 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300018006|Ga0187804_10089688 | All Organisms → cellular organisms → Bacteria | 1252 | Open in IMG/M |
| 3300018008|Ga0187888_1214702 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300018012|Ga0187810_10289348 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300018013|Ga0187873_1066912 | All Organisms → cellular organisms → Bacteria | 1494 | Open in IMG/M |
| 3300018014|Ga0187860_1318909 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300018016|Ga0187880_1341318 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300018021|Ga0187882_1201797 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300018023|Ga0187889_10328590 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300018025|Ga0187885_10351071 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300018034|Ga0187863_10401509 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300018034|Ga0187863_10547488 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300018037|Ga0187883_10065022 | All Organisms → cellular organisms → Bacteria | 1920 | Open in IMG/M |
| 3300018057|Ga0187858_10228760 | All Organisms → cellular organisms → Bacteria | 1202 | Open in IMG/M |
| 3300018058|Ga0187766_11091925 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300018062|Ga0187784_10129342 | All Organisms → cellular organisms → Bacteria | 2062 | Open in IMG/M |
| 3300018062|Ga0187784_10276202 | All Organisms → cellular organisms → Bacteria | 1366 | Open in IMG/M |
| 3300018085|Ga0187772_10185049 | All Organisms → cellular organisms → Bacteria | 1393 | Open in IMG/M |
| 3300018085|Ga0187772_10360472 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
| 3300018090|Ga0187770_10637501 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300018090|Ga0187770_11068064 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
| 3300019786|Ga0182025_1008344 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
| 3300019786|Ga0182025_1082839 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
| 3300019786|Ga0182025_1095423 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300019786|Ga0182025_1220250 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2522 | Open in IMG/M |
| 3300019789|Ga0137408_1257397 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300020199|Ga0179592_10530280 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300020579|Ga0210407_10485720 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300020579|Ga0210407_10876108 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300020579|Ga0210407_10884772 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
| 3300020580|Ga0210403_10206046 | All Organisms → cellular organisms → Bacteria | 1614 | Open in IMG/M |
| 3300020580|Ga0210403_10699395 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300020580|Ga0210403_10754877 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300020580|Ga0210403_11528079 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300020581|Ga0210399_10134446 | All Organisms → cellular organisms → Bacteria | 2037 | Open in IMG/M |
| 3300020581|Ga0210399_10139747 | All Organisms → cellular organisms → Bacteria | 1998 | Open in IMG/M |
| 3300020581|Ga0210399_10759074 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300020581|Ga0210399_11023176 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300020582|Ga0210395_10136467 | All Organisms → cellular organisms → Bacteria | 1826 | Open in IMG/M |
| 3300020583|Ga0210401_11279209 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300021088|Ga0210404_10007279 | All Organisms → cellular organisms → Bacteria | 4474 | Open in IMG/M |
| 3300021088|Ga0210404_10195662 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300021088|Ga0210404_10558345 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300021168|Ga0210406_10620819 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300021170|Ga0210400_10311783 | All Organisms → cellular organisms → Bacteria | 1292 | Open in IMG/M |
| 3300021170|Ga0210400_10348365 | All Organisms → cellular organisms → Bacteria | 1219 | Open in IMG/M |
| 3300021170|Ga0210400_10499755 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300021170|Ga0210400_10874221 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300021171|Ga0210405_11072776 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300021178|Ga0210408_10525093 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300021178|Ga0210408_11315894 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300021180|Ga0210396_11325008 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300021181|Ga0210388_10272673 | All Organisms → cellular organisms → Bacteria | 1485 | Open in IMG/M |
| 3300021181|Ga0210388_10628720 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300021181|Ga0210388_10676253 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300021181|Ga0210388_10989723 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300021402|Ga0210385_10698031 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300021405|Ga0210387_10442601 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
| 3300021405|Ga0210387_10844118 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300021405|Ga0210387_11023879 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300021405|Ga0210387_11403616 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300021406|Ga0210386_11038705 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
| 3300021406|Ga0210386_11119923 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300021407|Ga0210383_11569361 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300021420|Ga0210394_10410734 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
| 3300021432|Ga0210384_10308514 | All Organisms → cellular organisms → Bacteria | 1425 | Open in IMG/M |
| 3300021432|Ga0210384_10579483 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
| 3300021432|Ga0210384_10633865 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300021474|Ga0210390_11431313 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300021475|Ga0210392_11259758 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300021477|Ga0210398_10000784 | All Organisms → cellular organisms → Bacteria | 35141 | Open in IMG/M |
| 3300021478|Ga0210402_11831143 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300021479|Ga0210410_10018375 | All Organisms → cellular organisms → Bacteria | 6041 | Open in IMG/M |
| 3300021479|Ga0210410_10135072 | All Organisms → cellular organisms → Bacteria | 2194 | Open in IMG/M |
| 3300021479|Ga0210410_10780457 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300021479|Ga0210410_11017372 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300021479|Ga0210410_11222012 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300021560|Ga0126371_11713280 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300023250|Ga0224544_1038303 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300024347|Ga0179591_1245343 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3162 | Open in IMG/M |
| 3300025414|Ga0208935_1037609 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300025439|Ga0208323_1045399 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300025453|Ga0208455_1045969 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300025576|Ga0208820_1096381 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300026285|Ga0209438_1128800 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300026304|Ga0209240_1047407 | All Organisms → cellular organisms → Bacteria | 1623 | Open in IMG/M |
| 3300026304|Ga0209240_1283424 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300026333|Ga0209158_1165891 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 801 | Open in IMG/M |
| 3300026334|Ga0209377_1268749 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300026548|Ga0209161_10054817 | All Organisms → cellular organisms → Bacteria | 2586 | Open in IMG/M |
| 3300027061|Ga0209729_1014603 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
| 3300027173|Ga0208097_1038186 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300027266|Ga0209215_1008738 | All Organisms → cellular organisms → Bacteria | 1213 | Open in IMG/M |
| 3300027376|Ga0209004_1076374 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300027502|Ga0209622_1071317 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300027570|Ga0208043_1028165 | All Organisms → cellular organisms → Bacteria | 1749 | Open in IMG/M |
| 3300027575|Ga0209525_1063937 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
| 3300027609|Ga0209221_1057650 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300027629|Ga0209422_1021919 | All Organisms → cellular organisms → Bacteria | 1587 | Open in IMG/M |
| 3300027652|Ga0209007_1057252 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300027667|Ga0209009_1047695 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300027696|Ga0208696_1023641 | All Organisms → cellular organisms → Bacteria | 2288 | Open in IMG/M |
| 3300027698|Ga0209446_1157798 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300027729|Ga0209248_10052377 | All Organisms → cellular organisms → Bacteria | 1252 | Open in IMG/M |
| 3300027737|Ga0209038_10071718 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
| 3300027745|Ga0209908_10054125 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300027768|Ga0209772_10238629 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300027846|Ga0209180_10557922 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300027854|Ga0209517_10142447 | All Organisms → cellular organisms → Bacteria | 1545 | Open in IMG/M |
| 3300027855|Ga0209693_10041233 | All Organisms → cellular organisms → Bacteria | 2266 | Open in IMG/M |
| 3300027855|Ga0209693_10406677 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300027857|Ga0209166_10700064 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300027862|Ga0209701_10002684 | All Organisms → cellular organisms → Bacteria | 11583 | Open in IMG/M |
| 3300027862|Ga0209701_10249330 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1039 | Open in IMG/M |
| 3300027862|Ga0209701_10533857 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300027889|Ga0209380_10516731 | Not Available | 696 | Open in IMG/M |
| 3300027905|Ga0209415_10167801 | All Organisms → cellular organisms → Bacteria | 2155 | Open in IMG/M |
| 3300027908|Ga0209006_10756849 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 791 | Open in IMG/M |
| 3300028017|Ga0265356_1002355 | All Organisms → cellular organisms → Bacteria | 2542 | Open in IMG/M |
| 3300028731|Ga0302301_1102255 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300028759|Ga0302224_10088852 | All Organisms → cellular organisms → Bacteria | 1182 | Open in IMG/M |
| 3300028789|Ga0302232_10441911 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300028806|Ga0302221_10151668 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
| 3300028906|Ga0308309_10029407 | All Organisms → cellular organisms → Bacteria | 3748 | Open in IMG/M |
| 3300029944|Ga0311352_10382665 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
| 3300030058|Ga0302179_10170568 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300030598|Ga0210287_1182167 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300030617|Ga0311356_10082781 | All Organisms → cellular organisms → Bacteria | 3385 | Open in IMG/M |
| 3300030707|Ga0310038_10050100 | All Organisms → cellular organisms → Bacteria | 2360 | Open in IMG/M |
| 3300030730|Ga0307482_1281411 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300030741|Ga0265459_11067426 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300030759|Ga0265745_1006146 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300030760|Ga0265762_1125924 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300030763|Ga0265763_1043666 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300030764|Ga0265720_1009743 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300030815|Ga0265746_1004636 | All Organisms → cellular organisms → Bacteria | 1407 | Open in IMG/M |
| 3300031446|Ga0170820_10307040 | All Organisms → cellular organisms → Bacteria | 1249 | Open in IMG/M |
| 3300031545|Ga0318541_10622582 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300031682|Ga0318560_10473124 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
| 3300031708|Ga0310686_103580880 | All Organisms → cellular organisms → Bacteria | 2032 | Open in IMG/M |
| 3300031708|Ga0310686_103951860 | All Organisms → cellular organisms → Bacteria | 1846 | Open in IMG/M |
| 3300031708|Ga0310686_107069993 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
| 3300031718|Ga0307474_11397110 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300031747|Ga0318502_10149680 | All Organisms → cellular organisms → Bacteria | 1331 | Open in IMG/M |
| 3300031747|Ga0318502_10540465 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 700 | Open in IMG/M |
| 3300031753|Ga0307477_10294306 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
| 3300031754|Ga0307475_10390736 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1118 | Open in IMG/M |
| 3300031754|Ga0307475_11281102 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300031754|Ga0307475_11412829 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300031770|Ga0318521_10743311 | Not Available | 597 | Open in IMG/M |
| 3300031771|Ga0318546_11039898 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300031788|Ga0302319_11067975 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300031799|Ga0318565_10331239 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300031910|Ga0306923_10125985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2910 | Open in IMG/M |
| 3300031942|Ga0310916_10501297 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
| 3300031945|Ga0310913_10323911 | All Organisms → cellular organisms → Bacteria | 1089 | Open in IMG/M |
| 3300031962|Ga0307479_11487713 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300031962|Ga0307479_11592875 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300032039|Ga0318559_10285993 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300032180|Ga0307471_100065089 | All Organisms → cellular organisms → Bacteria | 3106 | Open in IMG/M |
| 3300032205|Ga0307472_101294996 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300032515|Ga0348332_11894300 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300032770|Ga0335085_11688342 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300032828|Ga0335080_10461144 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1355 | Open in IMG/M |
| 3300032895|Ga0335074_10057208 | All Organisms → cellular organisms → Bacteria | 5337 | Open in IMG/M |
| 3300032954|Ga0335083_11007045 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300032955|Ga0335076_11422473 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300033004|Ga0335084_10397126 | All Organisms → cellular organisms → Bacteria | 1421 | Open in IMG/M |
| 3300033134|Ga0335073_11302644 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300033134|Ga0335073_11963496 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300033290|Ga0318519_10876356 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300033547|Ga0316212_1061934 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.35% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.14% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.90% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.90% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.42% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.13% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.83% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.54% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.54% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.24% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.95% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.95% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.36% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.06% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.06% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.77% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.77% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.47% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.47% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.89% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.29% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.29% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.29% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.29% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.29% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.29% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.29% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.29% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.29% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.29% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.29% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.59% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.59% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.59% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002910 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300003351 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 | Environmental | Open in IMG/M |
| 3300003370 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
| 3300005950 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009548 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
| 3300009637 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 | Environmental | Open in IMG/M |
| 3300009640 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 | Environmental | Open in IMG/M |
| 3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300016730 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018004 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300018014 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40 | Environmental | Open in IMG/M |
| 3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
| 3300018021 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150 | Environmental | Open in IMG/M |
| 3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
| 3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300023250 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 10-14 | Environmental | Open in IMG/M |
| 3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025414 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025439 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025453 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025576 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026868 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 32 (SPAdes) | Environmental | Open in IMG/M |
| 3300027061 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027173 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF036 (SPAdes) | Environmental | Open in IMG/M |
| 3300027266 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027371 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027609 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Host-Associated | Open in IMG/M |
| 3300028731 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029701 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030598 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE048SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030741 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assembly | Environmental | Open in IMG/M |
| 3300030759 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030764 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030815 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_102177071 | 3300000567 | Peatlands Soil | LAEFMEGLYNTVVRQWAVDLTGPHKLTDRMRSAVEFFLRGIRS* |
| JGI12269J14319_101699002 | 3300001356 | Peatlands Soil | LAEFMEGLYNTVVRQWAVDLTGPHKLTERARSAVEFFLRGIRP* |
| JGI12635J15846_106071551 | 3300001593 | Forest Soil | MEGLYNTIVRQWAVDLTGPHKLSDRVSSAVEFFLRGVRP* |
| JGI12627J18819_100084545 | 3300001867 | Forest Soil | LPVLHMAQFMEGLYNTVVRQWAVDLTGPHKLTDRVRNAVELFLRGIQP* |
| JGI12627J18819_102242291 | 3300001867 | Forest Soil | GEITSAFPVVHLAEFMEALYHTVVRQWTVDLTGPHKLTERVDSAVEFFLRGVKP* |
| JGIcombinedJ26739_1000021371 | 3300002245 | Forest Soil | GLYNTVVRQWAVDLTGPHKLTDRVLSAVEFFLRGLEP* |
| JGI25615J43890_10365271 | 3300002910 | Grasslands Soil | LDFPVVHLAEFMEGLFNTVVRQWAVDLTGPHKLTERVRNAVEFFLRGAKP* |
| JGI25617J43924_100157831 | 3300002914 | Grasslands Soil | LAEFMEGLYNTIVRQWAVDLTGPHKLSERVTSAVEFFLRGVRP* |
| JGI25617J43924_103505341 | 3300002914 | Grasslands Soil | LHLSEFMEGLYQTVVRQWAVDLTGPHKLGERVDSAVEFFLRGVQP* |
| JGI25616J43925_100719622 | 3300002917 | Grasslands Soil | AEFMEGLFNTVVRQWAVDLTGPHKLTERVRNAVEFFLRGAKP* |
| JGI26346J50198_10056352 | 3300003351 | Bog Forest Soil | AFPVVHLAEFMEGLYNTVVRQWAVDLTGPHKLTDRVRSAVEFFLRGIRP* |
| JGI26337J50220_10300712 | 3300003370 | Bog Forest Soil | EFMEALYLTVVRQWAVDLPGPHKLTERVRSAVAFFLRGIQP* |
| JGIcombinedJ51221_104397971 | 3300003505 | Forest Soil | ITSAFPVVHLAEFMEALYHTVVRQWTVDLTGPHRLTERVDSAVEFFLRGVKP* |
| Ga0062384_1004842421 | 3300004082 | Bog Forest Soil | TLDFPVVHLAEFMEGLFNTVVRQWAVDLTGPHKLTERVRNAVEFFLRGAKP* |
| Ga0062384_1012224682 | 3300004082 | Bog Forest Soil | LAEFMEGLYSTVVRQWAVNLTGPHKLADRVRSAVEFFLCGIRP* |
| Ga0062387_1012481071 | 3300004091 | Bog Forest Soil | YTTIVRRWAVDFPGRHSLSERVRSAVEFFLEGTRPGGGDRT* |
| Ga0062389_1009860692 | 3300004092 | Bog Forest Soil | AEFMEGLFNTVVRQWAVDLHGPHTLADRVGSSVEFFLRGVKP* |
| Ga0062389_1043004241 | 3300004092 | Bog Forest Soil | FPVVHLAEFMEGLYNTVVRQWAVDLTGPHKLTDRVRSAVEFFLRGIQP* |
| Ga0062386_1005257051 | 3300004152 | Bog Forest Soil | MEGLYNTVVRQWAVDLTGPHELTDRVQSAVEFFLRGIQP* |
| Ga0062386_1017196342 | 3300004152 | Bog Forest Soil | MEGLYRTIVRGWAVDLSGPHSLRERVRSAVDFFLQAAEA* |
| Ga0058899_120805081 | 3300004631 | Forest Soil | AEFMEALYHTVVRQWTVDLTGPHKLTERVDSAVEFFLRGVKP* |
| Ga0066690_101131313 | 3300005177 | Soil | FPVLHLAEFMEGLYQTVVRQWAVDLTGPHKLGERVDSAVEFFLRGVQP* |
| Ga0066690_104044352 | 3300005177 | Soil | HLAEFMEGLYTTVVRRWAVDLFGTHSLSERVRSALEFFLRGVQQ* |
| Ga0066388_1003637311 | 3300005332 | Tropical Forest Soil | EFLEGLYTTVVRRWAVDLSGPHSLSERVRSAVAFFLEGAQP* |
| Ga0066388_1010517642 | 3300005332 | Tropical Forest Soil | HLAEFMEGLYTTVVRRWAVDLSEPHNLSERVRSALEFFLKGVQS* |
| Ga0066388_1035014402 | 3300005332 | Tropical Forest Soil | EFLEGLYTTVVRRWAVDLSGPHSLSERVRSAVAFFLEGARP* |
| Ga0070714_1007321082 | 3300005435 | Agricultural Soil | TRVFPVLHLAEFMEGLYQTVVRQWAVDLTGPHKLAERVDSAVEFFLRGVQP* |
| Ga0066681_102741112 | 3300005451 | Soil | EFMEGLYQTVVRQWAVDLTGPHKLGERVDSAVEFFLRGVQP* |
| Ga0070706_1003050742 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | LAEFMEGLYTTVVRQWAVDLTGPHKLTERVDSAVEFFIRAVKS* |
| Ga0070698_1003959582 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MEGLYQTVVRQWAVDLTGPHKLGERVDSAVEFFLRGAQP* |
| Ga0070733_104158291 | 3300005541 | Surface Soil | RAFPVVHLAEFMEGLYNTVVRQWAVDLTGPHKLTERVRSAVEFFLRGIRP* |
| Ga0070733_106074021 | 3300005541 | Surface Soil | LHLAEFMEGLYNTVVRQWVVDLTGPHKLSERVRSAVEFFLRAVRP* |
| Ga0070732_104473362 | 3300005542 | Surface Soil | PVAHLTEFMRGLYITIVRRWAVDLTGPHSLSERVVSAVDFFLRGVQV* |
| Ga0070732_105642821 | 3300005542 | Surface Soil | LAEFMEGLYRTIVRNWAIDLTGPHKLAERVDSAVEFFLRGVQP* |
| Ga0070762_110999881 | 3300005602 | Soil | FPVVHLAEFMEALYHTVVRQWTVDLTGPHKLTERVDSAVEFFLRGVKP* |
| Ga0070763_106150431 | 3300005610 | Soil | VHLAEFMEALYHTVVRQWTVDLTGPHKLTERVDSAVEFFLRGVKP* |
| Ga0070763_108106542 | 3300005610 | Soil | PVVHLAEFMEGLYNTVVRQWAVDLTGPHKLTDRVRSAVEFFLRGLEP* |
| Ga0066903_1002069461 | 3300005764 | Tropical Forest Soil | YNTVVRQWAVDLTGPHKLTDRVRNAVELFLRGIQP* |
| Ga0066903_1025679031 | 3300005764 | Tropical Forest Soil | RTFPVAHLAEFMEGLYTTVVRRWAVDLGEPHSLNERVRSAVEFFLRAVKP* |
| Ga0066788_100832712 | 3300005944 | Soil | HLAEFMEGLFNTVVRQWAVDLTGPHKLTERVRNAVEFFLRGAKP* |
| Ga0066787_100130773 | 3300005950 | Soil | FNTVVRQWAVDLHGPHTLADRVNSAVEFFLRGAKS* |
| Ga0075023_1002984432 | 3300006041 | Watersheds | VVHLAEFMEALYHTVVRQWTVDLTGPHKLTERVDSAVEFFLRGVKP* |
| Ga0075024_1004046962 | 3300006047 | Watersheds | RAFPVVHLAEFMQGLFNTVVRQWAVDLTGPHKLTERVRSAVEFFLRAAKP* |
| Ga0075028_1005213231 | 3300006050 | Watersheds | AEFMEGLFNTVVRQWAVDLTGPHKLTERVRNAVEFFLRGAKPYSEI* |
| Ga0075029_1002657332 | 3300006052 | Watersheds | LAEFMEGLYNTVVRQWAVDLTGPHKLTDRVRSAVEFFLCGIRP* |
| Ga0075017_1002830211 | 3300006059 | Watersheds | FMEGLYNTVVRQWAVDLTGPHKLADRVRSAVEFFLRGIRP* |
| Ga0075017_1005829502 | 3300006059 | Watersheds | FNTVVREWAVDLTGPHKLTERVRNAVEFFLRGAKP* |
| Ga0075017_1014735072 | 3300006059 | Watersheds | FMEGLYNTVVRQWAVDLTGPHRLTERVRSAVDFFLRGIRP* |
| Ga0075030_1001717363 | 3300006162 | Watersheds | MEGLYNTVVRQWVVDLTGPHKLTDRVASAVDFFLRGIRP* |
| Ga0070716_1003698532 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | LHLAEFMEGLYQTVVRQWAVDLTGPHKLAERVDSAVEFFLRGVQP* |
| Ga0075014_1006951952 | 3300006174 | Watersheds | VHLAEFMEGLYNTVVRQWAVDLTGPHKLTERVRSAVAFFLRAMRP* |
| Ga0075014_1008879972 | 3300006174 | Watersheds | EFMEGLYNTIVRQWAVDLTGPHKLSDRVNSAVEFFLRGVRL* |
| Ga0070765_1003475171 | 3300006176 | Soil | GLYNTVVRQWAVDLTGPHQLTERVRSAVEFFLRGIRS* |
| Ga0070765_1021501312 | 3300006176 | Soil | YNTVVRQWAVDLTGPHKLAERVRSAVEFFLCGIRP* |
| Ga0070765_1023132181 | 3300006176 | Soil | VVHLAEFMEGLFNTVVRQWAVDLHGPHTLADRVRNAVEFFLRGAKP* |
| Ga0079221_109131482 | 3300006804 | Agricultural Soil | AEFMEGLYRTVVRNWALDITGPHKLAERVRSAVEFFLRAIEP* |
| Ga0099793_100216744 | 3300007258 | Vadose Zone Soil | VHLAEFMEGLFNTVVRQWAVDLTGPHKLTERVRNAVEFFLRGAKP* |
| Ga0099829_103998162 | 3300009038 | Vadose Zone Soil | VSRAIPAEHLAEFMEGLYNTVVRQWAVDLTGPHKLSDRVSSAVDFFLRGVRP* |
| Ga0099829_107472621 | 3300009038 | Vadose Zone Soil | HLAEFMEGLFNTVVRQWAVDLTGPHKLTERVRSAVEFFLRGARP* |
| Ga0099829_112110122 | 3300009038 | Vadose Zone Soil | FNTVVRQWAVDLTGPHKLTERVRNAVEFFLRGAKP* |
| Ga0099829_114181721 | 3300009038 | Vadose Zone Soil | GLFNTVVRQWAVDLTGPHKLSERVRSAVDFFLRAAKP* |
| Ga0099829_117091622 | 3300009038 | Vadose Zone Soil | VHLAEFMEGLYNTVVRQWAVDLTGPHELAERVRSAVDFFLLGAKP* |
| Ga0099830_101733362 | 3300009088 | Vadose Zone Soil | LAEFMEGLFNTVVRQWAVDLTGPHKLTERVRNAVEFFLRGAKP* |
| Ga0099830_105944351 | 3300009088 | Vadose Zone Soil | HLAEFMEGLYNTVVRQWAVDLTGPHKLSDRVSSAVDFFLRGVRP* |
| Ga0099830_114771422 | 3300009088 | Vadose Zone Soil | HLAEFMEGLYNTVVRQWAVDLTGPHKLTDRVRSAVDFFLRGIRP* |
| Ga0099828_100178825 | 3300009089 | Vadose Zone Soil | AEFMDGLYHTLVRQWAVDLTGPHKLTERVDSAVEFFLRGVKP* |
| Ga0099827_102591722 | 3300009090 | Vadose Zone Soil | YNTVVRQWAVDLTGPHKLSERVSSAVEFFLRGVRP* |
| Ga0116222_10022637 | 3300009521 | Peatlands Soil | VHLAEFMEALYHTVVRQWTVDLTGPHKLTERVDSAIEFFLRGVKP* |
| Ga0116222_10043666 | 3300009521 | Peatlands Soil | AEFMEGLYNTVVRQWAVDLTGPHRLTDRVRSAVEFFLRGIRP* |
| Ga0116221_10336904 | 3300009523 | Peatlands Soil | VTRAFPVVHLAEFMEGLYNTVVREWAVDLTGPHKLTDRVRSAVEFFLRGIRP* |
| Ga0116221_15433412 | 3300009523 | Peatlands Soil | YNTVVRQWAVDLTGPHKLTDRVRSAVEFFLRGIRP* |
| Ga0116225_13201431 | 3300009524 | Peatlands Soil | LYNTVVRQWAVDVTGPHKLTDRVRSAVEFFLRGVRP* |
| Ga0116225_14379342 | 3300009524 | Peatlands Soil | EGLYNTVVRQWAVDLTGPHKLTDRVRSAVEFFLRGIRP* |
| Ga0116107_12065002 | 3300009548 | Peatland | VHLAEFMEGLYNTVVRQWAVDLTGPHKLTDRVRSAVEFFLRGIRP* |
| Ga0116105_10873612 | 3300009624 | Peatland | RDFPVVHLAEFMEGLFNTVVRQWAVDLTGPHKLTERVRNAVEFFLRGAKP* |
| Ga0116102_11134712 | 3300009632 | Peatland | VHLAEFMEGLYNTVVRQWAVDLTGPHKLTDRMRSAVEFFLRGIRA* |
| Ga0116102_11159261 | 3300009632 | Peatland | MEGLYNTVVRQWAVDLTGPHKLTDRMRSAVEFFLRGIRP* |
| Ga0116118_11232451 | 3300009637 | Peatland | TTVVRRWAVDLTGPHSLGERVRSAVEFFLRGVQP* |
| Ga0116126_11612082 | 3300009640 | Peatland | AEFMEGLYNTVVRQWAVDLTGPHKLTDRMRSAVEFFLRGIRP* |
| Ga0116110_11018512 | 3300009643 | Peatland | PVVHLAEFMEGLYNTVVRQWAVDLTGPHKLTDRMRSAVEFFLRGIRA* |
| Ga0116106_12200641 | 3300009645 | Peatland | MEGLYNTVVRQWAVDLTGPHKLTDRMRSAVEFFLRGIRS* |
| Ga0116224_100256004 | 3300009683 | Peatlands Soil | FPVVHLAEFMEGLYNTVVRQWAVDLTGPHRLTDRVRSAVEFFLRGIRP* |
| Ga0116217_104168552 | 3300009700 | Peatlands Soil | RAFPVVHLAEFMEGLYNTVVRQWAVDLTGPHKLTERVRSAVEFFLRGIQP* |
| Ga0116219_100211921 | 3300009824 | Peatlands Soil | VHLAEFMEGLYNTVVRQWAVDLTGPHKLTERARSAVEFFLRGIRP* |
| Ga0116219_100240231 | 3300009824 | Peatlands Soil | RAFPVVHLAEFMEGLYNTVVRQWAVDLTGPHKLTDRMRSAVEFFLRGIRS* |
| Ga0116219_101253413 | 3300009824 | Peatlands Soil | EVTRAFPVVHLAEFMEGLYNTVVRQWAVDLTGPHKLTDRVRSAVEFFLRGIRP* |
| Ga0116219_103164791 | 3300009824 | Peatlands Soil | EVSRAFPVVHLAEFMEGLYNTVVRQWAVDLTGPHKLTDRVRSAVEFFLRGIRP* |
| Ga0116219_107116222 | 3300009824 | Peatlands Soil | VTRAFPVVHLAEFMEGLYNTVVRQWAVDLTGPHQLTDRVRSAVEFFLRGIRS* |
| Ga0126380_106106701 | 3300010043 | Tropical Forest Soil | FMEGLYTTVVRRWAVDLSGPHSLSERVASAVEFFLQGARA* |
| Ga0126373_100938911 | 3300010048 | Tropical Forest Soil | LAQFMEGLYNTVVRQWAVDLTGPHKLTDRVRNAVELFLRGIQP* |
| Ga0126373_104808872 | 3300010048 | Tropical Forest Soil | VVRQWTVDLTGPHKLQDRVLSAVEFFLRGVAPLFRL* |
| Ga0126373_110023442 | 3300010048 | Tropical Forest Soil | EFMEALYHTVVRQWTVDLTGPHKLTDRVDSAVEFFLRGVKP* |
| Ga0126373_110273302 | 3300010048 | Tropical Forest Soil | GEITRAFPVVHLTEFMEGLYTTVVRQWAVDLTGPHKVTERVQSAVEFFLRGAEA* |
| Ga0126373_112246571 | 3300010048 | Tropical Forest Soil | REFPVLHMAQFMEGLYNTVVRQWAVDLTGPHKLTDRVRNAVELFLRGIQP* |
| Ga0074044_107133672 | 3300010343 | Bog Forest Soil | TRAFPVVHLAEFMEGLYNTVVRQWAVDLTGPHELTDRVQSAVEFFLRGIQP* |
| Ga0074044_109050312 | 3300010343 | Bog Forest Soil | AEFMEGLYNTVVRQWAVDLTGPHKLTDRMRSAVEFFLRGIRS* |
| Ga0126372_120090451 | 3300010360 | Tropical Forest Soil | EFMEGLYTTVVRRWAVDLSGPHSLSERVRSALDFFLKAVQP* |
| Ga0126372_132089062 | 3300010360 | Tropical Forest Soil | RTFPVAHLADFMEGLYTTVVRRWAVDLGEPHSLNERVRSAVEFFLRAVKP* |
| Ga0126379_105769343 | 3300010366 | Tropical Forest Soil | AFPVDHLAEFMEGLYSTVVRRWAVDLPEPHSLNERVRSAVEFFLRAVEP* |
| Ga0126381_1000025841 | 3300010376 | Tropical Forest Soil | EFMEGLYTTVVRRWAVDLSGPHSLSERVRSALAFFVKGVQL* |
| Ga0126381_1026284491 | 3300010376 | Tropical Forest Soil | EFMEGLYTTVVRRWAVDLSGPHSLSERVRSALAFFVKGVQP* |
| Ga0150983_155040951 | 3300011120 | Forest Soil | QDFPVVHLAEFMEGLFNTVVRQWAVDLTGPHKLTERVRNAVEFFLRGAKP* |
| Ga0137391_107907582 | 3300011270 | Vadose Zone Soil | EHLAEFLEGVYNTVVRQWAVDLTGPHKLSERVSSAVEFFLRGVRP* |
| Ga0137393_107698181 | 3300011271 | Vadose Zone Soil | HLGEFMEGLFTTVVRHWAVDLTGPHKLSERVGSAVEFFLRGAQA* |
| Ga0137389_103704502 | 3300012096 | Vadose Zone Soil | AHLAEFMEGLYTTVVRRWAVDLSGPHNLSERVRSALEFFLKAVQA* |
| Ga0137388_117235021 | 3300012189 | Vadose Zone Soil | AEFMEGLFNTVVRQWAVDLTGPHKLSERVRTAVEFFLRAAKP* |
| Ga0137363_108792261 | 3300012202 | Vadose Zone Soil | HLAEFMEGLFNTVVRQWAVDLTGPHKLTERVRNAVEFFLRGVKP* |
| Ga0137362_103991962 | 3300012205 | Vadose Zone Soil | HLAEFMEGLYNTVVRHWAVDLTGPHKLSERVSSAVEFFLRGVRP* |
| Ga0137362_113861321 | 3300012205 | Vadose Zone Soil | LYNTVVRHWAVDLTGPHKLSDRVSSAVEFFLRGVRP* |
| Ga0137380_115328352 | 3300012206 | Vadose Zone Soil | GEVTRVIPIVHLAEFMEGLYNTVVRQWAVDLTGPHELAERVRSAVDFFLLGAKP* |
| Ga0137378_114899132 | 3300012210 | Vadose Zone Soil | EFLQALCNDVVRRWAVDLLRPHSLSERVRSAVEFFLRAVQP* |
| Ga0137386_104298752 | 3300012351 | Vadose Zone Soil | FMEALYHTVVRQWTVDLTGPHKLTERVDSAVEFFLRGVKP* |
| Ga0137360_113542052 | 3300012361 | Vadose Zone Soil | AEFMEGLFTTVVRHWAVDLTGPHKLGERVGSAVEFFLRGARA* |
| Ga0137419_102127261 | 3300012925 | Vadose Zone Soil | TLDFPVVHLAEFMEGLFNTVVRQWAVDLTGPHKLTERVRSAVEFFLRGAKP* |
| Ga0137416_108301921 | 3300012927 | Vadose Zone Soil | RAFPVVHLAEFMEGLFNTVVRQWAVDLTGPHKLTERVRSAVEFFLRAAKP* |
| Ga0181530_104338211 | 3300014159 | Bog | FMEGLYNTVVRQWAVDLTGPHKLTDRVRSAVEFFLRGIRP* |
| Ga0181538_106223712 | 3300014162 | Bog | PVVHLAEFMEGLYNTVVRQWAVDLTGPHKLTDRVRSAVEFFLRGIRP* |
| Ga0181523_104738732 | 3300014165 | Bog | VHLAEFMEGLYNTVVRQWAVDLTGPHKLTDRVRSAVDFFLRGIRP* |
| Ga0181531_107440592 | 3300014169 | Bog | EFMEGLYSTVVRQWAVDLTGPHKLTDRVRSAVDFFMCGIRP* |
| Ga0181526_103601292 | 3300014200 | Bog | VHLAEFMEGIYNTVVRQWAVDLTGPHKLADRVRSAVEFFLRGIQP* |
| Ga0182018_103346721 | 3300014489 | Palsa | GEITHDFPVVHLAEFMEGLYNTVVRQWAVDLTGPHKLTDRVLSAVEFFLRGLQP* |
| Ga0182015_107316182 | 3300014495 | Palsa | EITRDFPVVHLAEFMEGLFNTVVRQWAVDLTGPHKLTERVRNAVEFFLRGAKP* |
| Ga0182024_105769501 | 3300014501 | Permafrost | SVFPVVHLAEFMEALYHTVVRQWTVDLTGPHKLTERVDSAVEFFLRGVKP* |
| Ga0181536_102701812 | 3300014638 | Bog | AEFMEGLYNTVVRQWAVDLTGPHKLTDRMRSAVEFFLRGIRA* |
| Ga0167668_10717241 | 3300015193 | Glacier Forefield Soil | AEFMEALYHTVVRQWTVDLTGPHKLTERVDSAVEFFLRGVEP* |
| Ga0182036_101049803 | 3300016270 | Soil | GLYSTVVRRWAVDLPQPHNLDERVKSAVEFFLRAVEP |
| Ga0182035_110635752 | 3300016341 | Soil | VHLAEFMEALYHTVVRQWTVDLTGPHKQTERVDSAVEFFLRGVKP |
| Ga0182037_115894851 | 3300016404 | Soil | KGEVSREFPAIHLAEFMEGLYATVVRQWAVDLTGPHKLRDRVLSAVEFFLRGIAP |
| Ga0182038_102444152 | 3300016445 | Soil | EFMEGLYTTVVRRWAVDLSGPHSLNERVRSAVTFFLEGAEP |
| Ga0181515_13295063 | 3300016730 | Peatland | AFPVVHLAEFMEGLYNTVVRQWAVDLTGPHKLTDRMRSAVEFFLRGIRP |
| Ga0187818_100352704 | 3300017823 | Freshwater Sediment | REVPVIHLAQFMGALYRTVVRHWAVDITGPHKLTDRVRNAVDFFLRGAKA |
| Ga0187818_100420353 | 3300017823 | Freshwater Sediment | VHLAEFMEGLYNTVVRQWAVDLTGPHKLTDRVRSAVEFFLRGIRP |
| Ga0187818_101912792 | 3300017823 | Freshwater Sediment | VHLAEFMEGLYNTVVRQWAVDLTGPHKLTDRMRSAVEFYLRGIRT |
| Ga0187818_103852911 | 3300017823 | Freshwater Sediment | GEVTRAFPVVHLAEFMEGLYNTVVRQWAVDLTGPHKLTDRVRSAVEFFLRGIQP |
| Ga0187849_11712411 | 3300017929 | Peatland | RAFPVVHLAEFMEGLYNTVVRQWAVDLTGPHKLTDRVRSAVEFFLRGIRP |
| Ga0187825_101414312 | 3300017930 | Freshwater Sediment | AEFMEGLFNTVVRQWAVDLTGPHKLSERVRSAVEFFLRAAKP |
| Ga0187801_100165993 | 3300017933 | Freshwater Sediment | AFPVAHLAEFMDGLYHTIVRQWAVDLAGPHKLSERVASAVEFFLRGVRP |
| Ga0187801_102244062 | 3300017933 | Freshwater Sediment | LAEFLEWISLTVVRLWAVDLTGPHKLTDRVRSAVEFFLGGIRP |
| Ga0187801_103437832 | 3300017933 | Freshwater Sediment | AFPVVHLAEFMEGLYNTVVRQWAVDLTGPHKLTERVRSAVEFFLRGIRP |
| Ga0187803_103513962 | 3300017934 | Freshwater Sediment | EFMEALYHTVVRQWTVDLTGPHKLTERVDSAVEFFLRGVKP |
| Ga0187853_103388702 | 3300017940 | Peatland | GEVTHAFPVVHLAEFMEGLYNTVVRQWAVDLTGPHKLTDRMRSAVEFFLRGIRS |
| Ga0187819_102202311 | 3300017943 | Freshwater Sediment | PVVHLAEFMEGLYNTVVRQWAVDLTGPHKLTERVRSAVEFFLRGLEP |
| Ga0187819_105239152 | 3300017943 | Freshwater Sediment | LYHTVVRQWTVDLTGPHKLTERVDSAVEFFLRGVKP |
| Ga0187778_106667791 | 3300017961 | Tropical Peatland | LYRTVVRHWTVDITGAHKLTDRVRSAVDFFLRGAKA |
| Ga0187783_100145014 | 3300017970 | Tropical Peatland | EALYTTIVRCWAVDLTGPHSLAERVRSAVEFFLRAVQP |
| Ga0187782_113696561 | 3300017975 | Tropical Peatland | LAEFMEALYHTVVRQWTVDLTGPHKLSERVDSAVEFFLRAVKP |
| Ga0187865_13092512 | 3300018004 | Peatland | PVVHLAEFMEGLYNTVVRQWAVDLTGPHKLTDRVRSAVEFFLRGIRP |
| Ga0187804_100896882 | 3300018006 | Freshwater Sediment | GEVTRAFPVVHLAEFMEGLYNTVVRQWAVDLTGPHKLTDRVRSAVEFFLRGIRP |
| Ga0187888_12147021 | 3300018008 | Peatland | AFPVVHLAEFMEGLYNTVVRQWAVDLTGPHKLTDRMRSAVEFFLRGIRA |
| Ga0187810_102893481 | 3300018012 | Freshwater Sediment | HLAEFMEGLFNTVVRQWAVDLTGPHKLSERARNAVEFFLRGVQP |
| Ga0187810_103436071 | 3300018012 | Freshwater Sediment | MAGLYTTTVRRWAVDLPEPHNLSERVSSALDFFLKGAQP |
| Ga0187873_10669121 | 3300018013 | Peatland | VTRAFPVVHLAEFMEGLYNTVVRQWAVDLTGPHKLTDRVRSAVEFFLRGIRP |
| Ga0187860_13189092 | 3300018014 | Peatland | VVHLAEFMEGLYNTVVRQWAVDLTGPHKLTDRVRSAVEFFLRGLQP |
| Ga0187880_13413182 | 3300018016 | Peatland | HLAEFMEGLYNTVVRQWAVDLTGPHKLTDRMRSAVEFFLRGIRP |
| Ga0187882_12017971 | 3300018021 | Peatland | GLYNTVVRQWAVDLTGPHKLTNRVRSAVEFFLRGIRA |
| Ga0187889_103285902 | 3300018023 | Peatland | PVVHLAEFMEGLYNTVVRQWAVDLTGPHKLTDRMRSAVEFFLRGIRA |
| Ga0187885_103510712 | 3300018025 | Peatland | VVHLAEFMEGLYNTVVRQWAVDLTGPHKLTDRMRSAVEFFLRGIRA |
| Ga0187863_104015092 | 3300018034 | Peatland | FMEGLFNTVVRQWAVDLTGPHKLTERVRSAVDFFLRGARP |
| Ga0187863_105474882 | 3300018034 | Peatland | VHLAEFMEGLYNTVVRQWAVDLTGPHELTDRVRSAVDFFLRGIRP |
| Ga0187883_100650223 | 3300018037 | Peatland | VHLAEFMEGLYNTVVRQWAVDLTGPHKLTERVRSAVEFFLRGIRS |
| Ga0187858_102287602 | 3300018057 | Peatland | LYSTIVRQWAVDLTGPHRLSERVRSAVEFFLRAAQP |
| Ga0187766_110919251 | 3300018058 | Tropical Peatland | RGEITNAFPVVHLAEFMEALYHTVVRKWTVDLTGPHKLTERVDSAVEFFLRGVRP |
| Ga0187784_101293421 | 3300018062 | Tropical Peatland | FMEGLYNTVVRRWAVDLTGPHKLDDRVRGAVEFFLRGIRS |
| Ga0187784_102762022 | 3300018062 | Tropical Peatland | EVTGAFPVLHLAEFMEALYHTVVRQWTVDLTGPHKLSERVDSAVEFFLRAVKP |
| Ga0187772_101850492 | 3300018085 | Tropical Peatland | GEITNAFPVVHLAEFMEALYHTVVRQWTVDLTGPHKLTERVDSAVEFFLRGVEP |
| Ga0187772_103604722 | 3300018085 | Tropical Peatland | YRTIVRGWVVNLGGPHSLKERVRSAVDFFLEAAKP |
| Ga0187769_102460301 | 3300018086 | Tropical Peatland | FMEGLYTTLVRRWAVDLTGPHSLSERVRSAVEFFLIGAQA |
| Ga0187770_101621441 | 3300018090 | Tropical Peatland | AEFMEGLYTTVVRRWAVDLDEPHSLSERVGAAVEFFLRAVQP |
| Ga0187770_106375012 | 3300018090 | Tropical Peatland | AEFMEGLYFTVVRHWAVDLPGPHKLTERVRSAVEFFLTGATP |
| Ga0187770_110680641 | 3300018090 | Tropical Peatland | GEVSREFPAIHLAEFMEGLYATVVRQWAVDLTGPHKLRDRVLSAVEFFLRGVAP |
| Ga0182025_10083442 | 3300019786 | Permafrost | PAVHLAEFMEGLYNTVVRQWAVALTGPHKLTDRVRSAVEFFLRGIRP |
| Ga0182025_10828391 | 3300019786 | Permafrost | VVRQWVVRQWAVDLTGPHKLTDRVRSAVEFFLRGIRP |
| Ga0182025_10954231 | 3300019786 | Permafrost | EGLMEGLFNTVVRQWAVDLTGPHKLTERVRNAVEFFLRGAKP |
| Ga0182025_12202504 | 3300019786 | Permafrost | VHLAEFMEALYHTVVRQWTVDLTGPHKLTERVDSAVEFFLRGVKP |
| Ga0137408_12573972 | 3300019789 | Vadose Zone Soil | DFPVVHLAEFMEGLFNTVVRQWAVDLTGPHKLTERVRNAVEFFLRGAKP |
| Ga0179592_105302802 | 3300020199 | Vadose Zone Soil | VHLAEFMEGLFNTVVRQWAVDLTGPHKLTERVRNAVEFFLRGAKS |
| Ga0210407_104857202 | 3300020579 | Soil | LYNTIVRQWAVDLTGPHKLSDRVSSAVEFFLRGVRP |
| Ga0210407_108761081 | 3300020579 | Soil | EVTQDFPVVHLAEFMEGLFNTVVRQWAVDLTGPHKLTERVRNAVEFFLRGAKP |
| Ga0210407_108847721 | 3300020579 | Soil | DVTRAFPVVHLAEFMQGLFNTVVRQWAVDLTGPHKLSERVRSAVEFFLRAAKP |
| Ga0210403_102060461 | 3300020580 | Soil | PVVHLAEFMEGLYNTVVRQWAVDLTGPHKLTDRVRSAVEFFLRGVEP |
| Ga0210403_106993952 | 3300020580 | Soil | FMEGLFNTVVRQWAVDLTGPHKLTERVRNAVEFFLRGAKP |
| Ga0210403_107548772 | 3300020580 | Soil | EFMEGMFNTVVRQWTVDLTGPHKLTERVHNAVEFFLRAAKP |
| Ga0210403_115280792 | 3300020580 | Soil | AEFMEGLYNTIVRQWAVDLTGPHKLSDRVSSAVEFFLRGVRP |
| Ga0210399_101344461 | 3300020581 | Soil | VVHLAEFMEGLYNTVVRQWAVDLTGPHKLTDRVRSAVEFFLRGIQP |
| Ga0210399_101397473 | 3300020581 | Soil | VVHLAEFMEGLFNTVVRQWAVDLHGPHTLADRVGSAVEFFLRGAKP |
| Ga0210399_107590741 | 3300020581 | Soil | FNTVVRQWTVDLTGPHKLTERVHNAVEFFLRAAKP |
| Ga0210399_110231761 | 3300020581 | Soil | FPVEHLAEFMEGLYNTIVRQWAVDLTGPHKLSDRVSSAVEFFLRGVRP |
| Ga0210395_101364673 | 3300020582 | Soil | RGEITRDFPAVHLAEFMEGLYNTVVRQWAVDLTGPHKLTVRVRSAVEFFLRGLQP |
| Ga0210401_112792092 | 3300020583 | Soil | LAEFMEGLFNTVVRQWAVDLTGPHKLTERVRNAVEFFLRGAKP |
| Ga0210404_100072791 | 3300021088 | Soil | RAFPVEHLAEFMEGLYNTIVRQWAVDLTGPHKLSDRVSSAVEFFLRGVRP |
| Ga0210404_101956622 | 3300021088 | Soil | VVHLAEFMEGLFNTVVRQWAVDLTGPHKLTERVHNAVEFFLRGARP |
| Ga0210404_105583451 | 3300021088 | Soil | GLYTTVVRQWAVDLTGPHKLTERVDSAVEFFIRAVKT |
| Ga0210406_106208192 | 3300021168 | Soil | PVVHLAEFMEGLYNTVVRQWAVDLTGPHKLTDRVLSAVEFFLRGLQP |
| Ga0210400_103117832 | 3300021170 | Soil | GEITSLFPVVHLAEFMEALYHTVVRQWTVDLTGPHKLTERVDSAVEFFLRGVKP |
| Ga0210400_103483652 | 3300021170 | Soil | MEALYHTVVRQWTVDLTGPHKLTERVDSAVEFFLRGVKP |
| Ga0210400_104997551 | 3300021170 | Soil | CDFPVVHLAEFMEGLFNTVVRQWAVDLTGPHKLTERVRNAVEFFLRGAKP |
| Ga0210400_108742211 | 3300021170 | Soil | GLFNTVVRQWAVDLTGPHKLTERVRNAVEFFLRGARP |
| Ga0210405_110727762 | 3300021171 | Soil | DFPVVHLAEFMEGLFNTVVRQWAVDLTGPHKLTERVRNSVEFFLRGAKP |
| Ga0210408_105250931 | 3300021178 | Soil | FNTVVRQWAVDLTGPHKLTERVRNAVEFFLRGAKP |
| Ga0210408_113158942 | 3300021178 | Soil | VLHLAEFMEALYQTVVRKWTVDITGPHKLTERVDSAVEFFLRAVAP |
| Ga0210396_113250082 | 3300021180 | Soil | AEFMEALYHTVVRQWTVDLTGPHKLTERVDSAVEFFLRGVKP |
| Ga0210388_102726731 | 3300021181 | Soil | FPVVHLAEFMEGLFNTVVRQWAVDLTGPHKLTERVRNAVEFFLRGARP |
| Ga0210388_106287202 | 3300021181 | Soil | VDFPIVHLAEFMEGLFNTVVRQWAVDLTGPHKLTERVHNAVEFFLRGAKP |
| Ga0210388_106762532 | 3300021181 | Soil | EGLYNTVVRQWAVDLTGPHKLTERVRSAVEFFLRGLER |
| Ga0210388_109897231 | 3300021181 | Soil | FMEGLYNTVVRQWAVDLTGPHKLTDRVLSAVEFFLRGIQP |
| Ga0210385_106980311 | 3300021402 | Soil | FMEGLYNTVVRQWAVDLTGPHKLSERVRSAVEFFSRGIQP |
| Ga0210387_104426012 | 3300021405 | Soil | FPIVHLAEFMEGLYNTVVRQWAVDLTGPHKLTDRALSAVEFFLRGLEP |
| Ga0210387_108441182 | 3300021405 | Soil | PVVHLAEFMEGLFNTVVRQWAVDLHGPHKLVDRAANAVEFFLRGAKP |
| Ga0210387_110238792 | 3300021405 | Soil | VVHLAEFMEGLFNTVVRQWTVDLTGPHKLTERVHSAVEFFLRAAKP |
| Ga0210387_114036161 | 3300021405 | Soil | AEFMEGLFNTVVRQWAVDLTGPHKLTERVHNAVEFFLRGAKP |
| Ga0210386_110387051 | 3300021406 | Soil | RGDITRAFPVVHLAEFMEGLFNTVVRQWAVDLHGPHKLVDRAANAVEFFLRGAKP |
| Ga0210386_111199232 | 3300021406 | Soil | FIEGLYNTVVRQWAVDLTGPHKLTERVRSAVEFFLRGIRP |
| Ga0210383_115693612 | 3300021407 | Soil | YYSVVRQWAVDLTGPHRLTERVRSAVEFFLRGIRS |
| Ga0210394_104107342 | 3300021420 | Soil | LFNTVVRQWAVDLTGPHKLTERVRSAVEFFLRGAKP |
| Ga0210384_103085141 | 3300021432 | Soil | GEVTVDFPIVHLAEFMEGLFNTVVRQWAVDLTGPHKLTERVHNAVEFFLRGAKP |
| Ga0210384_105794831 | 3300021432 | Soil | EGLYNTVVRQWAVDLTGPHKLTERVRSAVEFFLRGLQP |
| Ga0210384_106338652 | 3300021432 | Soil | EFMEGLFNTVVRQWAVDLTGPHKLTERVRNAVEFFLRGAKP |
| Ga0210390_114313131 | 3300021474 | Soil | HLAEFMEGLFNTVVRQWAVDLHGPHKLVDRAANAVEFFLRGAKP |
| Ga0210392_112597581 | 3300021475 | Soil | FPVVHLAEFMEGLFNTVVRQWAVDLTGPHKLTERVRNAVEFFLRGAKPECEI |
| Ga0187846_100908221 | 3300021476 | Biofilm | FPVVHLAEFMEGLYTTVVRRWAVDLTGPHKLTERVQSAVEFFLRSAKA |
| Ga0210398_100007841 | 3300021477 | Soil | MEGLFNTVVRQWAVDLTGPHKLTERVRNAVEFFLRGARP |
| Ga0210402_100907011 | 3300021478 | Soil | PSHLAEFMEGLYTTVVRRWAVDLSGPHSLNERVRSAVAFFLEGVEP |
| Ga0210402_118311432 | 3300021478 | Soil | GEITDAFPVLHLAEFMEALYQTVVRKWTVDITGPHKLTERVDSAVEFFLRAVAP |
| Ga0210410_100183751 | 3300021479 | Soil | TSAFPVVHLAEFMEALYHTVVRQWTVDLTGPHKLTERVDSAVEFFLRGVRA |
| Ga0210410_101350721 | 3300021479 | Soil | EGLYNTVVRQWAVDLTGPHKLTDRVRSAVEFFLRGLQP |
| Ga0210410_107804571 | 3300021479 | Soil | PIVHLAEFMEGLYNTVVRQWAVDLTGPHKLTDRVLSAVEFFLRGIQP |
| Ga0210410_110173722 | 3300021479 | Soil | GLYNTVVRQWAVDLTGPHKLTVRVRSAVEFFLRGLQP |
| Ga0210410_112220121 | 3300021479 | Soil | ALYHTVVRQWTVDLTGPHKLTERVDSAVEFFLRGVKP |
| Ga0126371_117132802 | 3300021560 | Tropical Forest Soil | AFPVVHLAEFMEALYHTVVRQWTVDLTGPHKLTERVDSAVEFFLRGVQP |
| Ga0126371_125928862 | 3300021560 | Tropical Forest Soil | LYTTVVRRWAVDLSGPHSLSERVRSAVAFFLEGARP |
| Ga0224544_10383032 | 3300023250 | Soil | DFPVVHLAEFMEGLYNTVVRQWAVDLTGPHKLTDRVLSAVEFFLRGLQP |
| Ga0179591_12453432 | 3300024347 | Vadose Zone Soil | MEGLFNTVVRQWAVDLTGPHKLTERVKNAVEFFLRGANLSQK |
| Ga0208935_10376091 | 3300025414 | Peatland | TRDFPVVHLAEFMEGLFNTVVRQWAVDLTGPHKLTERVRNAVEFFLRGAKP |
| Ga0208323_10453992 | 3300025439 | Peatland | HLAEFMEGLYNTVVRQWAVDLTGPHKLTDRVRSAVEFFLRGIRP |
| Ga0208455_10459691 | 3300025453 | Peatland | MEGLYNTVVRQWAVDLTGPHKLTDRMRSAVEFFLRGIRP |
| Ga0208820_10963811 | 3300025576 | Peatland | AEFMEGLYNTVVRQWAVDLTGPHKLTDRMRSAVEFFLRGIRP |
| Ga0209438_11288001 | 3300026285 | Grasslands Soil | HLAEFMEGLFNTVVRQWAVDLTGPHKLTERVRNAVEFFLRGAKP |
| Ga0209240_10474072 | 3300026304 | Grasslands Soil | PVVHLAEFMEGLFNTVVRQWAVDLTGPHKLTERVRNAVEFFLRGAKP |
| Ga0209240_12834242 | 3300026304 | Grasslands Soil | TSVFPVVHLAEFMEALYHTVVRQWTVDLTGPHKLTERVDSAVEFFLRGVKP |
| Ga0209158_11658911 | 3300026333 | Soil | EFLEGVYNTVVRQWAVDLTGPHKLSERVSSAVEFFLRGVRP |
| Ga0209377_12687491 | 3300026334 | Soil | HLAEFMEGLYNTVVRQWAVDLTGPHELAERVRSAVDFFLLGAKP |
| Ga0209161_100548171 | 3300026548 | Soil | EGLYQTVVRQWAVDLTGPHKLGERVDSAVEFFLRGVQP |
| Ga0207818_10130062 | 3300026868 | Tropical Forest Soil | GLYTTVVRRWAVDLSGPHSLTERVRSAVAFFLEGAQP |
| Ga0209729_10146032 | 3300027061 | Forest Soil | FMEGLYQTVVRQWAVDLTGPHKLGERVDSAVEFFLRGVQP |
| Ga0209729_10314702 | 3300027061 | Forest Soil | FLEGLYTTVVRRWAVDLSGPHSLTERVRSAVAFFLEGAEP |
| Ga0208097_10381862 | 3300027173 | Forest Soil | VSRAFPVEHLAEFMEGLYNTIVRQWAVDLTGPHKLSDRVNSAVEFFLCGVRP |
| Ga0209215_10087382 | 3300027266 | Forest Soil | EALYHTVVRQWTVDLTGPHKLTERVDSAVEFFLRGVKP |
| Ga0209418_10454222 | 3300027371 | Forest Soil | MAEFLEGLYTTVVRRWAVDLSGPHSLTERVRSAVAFFLEGAEP |
| Ga0209004_10763741 | 3300027376 | Forest Soil | LAEFMEGLFNTVVRQWAVDLTGPHKLTERVRNAVEFFLRGARP |
| Ga0209622_10713172 | 3300027502 | Forest Soil | AFPVVHLAEFMEALYHTVVRQWTVDLTGPHKLAERVDSAVEFFLRGVRP |
| Ga0208043_10281653 | 3300027570 | Peatlands Soil | VHLAEFMEALYHTVVRQWTVDLTGPHKLTERVDSAIEFFLRGVKP |
| Ga0209525_10639372 | 3300027575 | Forest Soil | FPVVHLAEFMEGLFNTVVRQWAVDLTGPHKLTERVHNAVEFFLRGGKP |
| Ga0209221_10576501 | 3300027609 | Forest Soil | AEFMEGLFNTVVRQWAVDLHGPHKLVDRAANAVEFFLRGAKP |
| Ga0209422_10219191 | 3300027629 | Forest Soil | MEGLFNTVVRQWAVDLTGPHKLTERVRNAVEFFLRGAKS |
| Ga0209007_10572521 | 3300027652 | Forest Soil | PIVHLAEFMEGLYNTVVRQWAVDLTGPHKLTDRVLSAVEFFLRGLEP |
| Ga0209009_10476952 | 3300027667 | Forest Soil | THDFPVVHLAEFMEGLYNTVVRQWAVDLTGPHKLTDRVRSAVEFFLRGLQP |
| Ga0208696_10236413 | 3300027696 | Peatlands Soil | HLAEFMEGLYNTVVRQWAVDLTGPHRLTDRVRSAVEFFLRGIRP |
| Ga0209446_11577981 | 3300027698 | Bog Forest Soil | VHLAEFMEGLYSTVVRQWAVDLTGPHKLTDRVRSAVEFFLRGIRP |
| Ga0209248_100523771 | 3300027729 | Bog Forest Soil | RGDITNDFPVVHLAEFMEGLYNTVVRQWAVDLTGPHKLTDRVRSAVEFFLRGLER |
| Ga0209038_100717181 | 3300027737 | Bog Forest Soil | LAEFMEGLYSTVVRQWAVNLTGPHKLADRVRSAVEFFLCGIRP |
| Ga0209908_100541252 | 3300027745 | Thawing Permafrost | AFPVIHLAEFMEGLFNTVVRQWAVDLHGPHTLADRVNSAVEFFLRGAKS |
| Ga0209772_102386291 | 3300027768 | Bog Forest Soil | EGLFNTVVRQWAVDLHGPHKLADRVGSAVEFFLRGARP |
| Ga0209180_105579222 | 3300027846 | Vadose Zone Soil | MEGLYNTVVRQWAVDLTGPHELAERVRSAVDFFLLGAKP |
| Ga0209517_101424471 | 3300027854 | Peatlands Soil | AEFMEGLYNTVVRQWAVDLTGPHKLTDRMRSAVEFFLRGIRS |
| Ga0209693_100412334 | 3300027855 | Soil | LPVVHLAEFMEGLFNTVVRQWAVDLHGPHKLVDRAANAVEFFLRGAKP |
| Ga0209693_104066771 | 3300027855 | Soil | FNTVVRQWAVDLTGPHKLAERAHNAVEFFLRGARP |
| Ga0209166_107000641 | 3300027857 | Surface Soil | SAFPVVHLAEFMEALYHTVVRQWTVDLTGPHKLTERVDSAVEFFLRGVKP |
| Ga0209701_1000268410 | 3300027862 | Vadose Zone Soil | PIVHLAEFMEGLYNTVVRQWAVDLTGPHELAERVRSAVDFFLLGAKP |
| Ga0209701_102493301 | 3300027862 | Vadose Zone Soil | AEFMEGLYNTVVRQWAVDLTGPHKLTDRVRSAVDFFLRGIRP |
| Ga0209701_105338572 | 3300027862 | Vadose Zone Soil | DFPVVHLAEFMDGLYHTLVRQWAVDLTGPHKLTERVDSAVEFFLRGVKP |
| Ga0209380_105167312 | 3300027889 | Soil | GLFNTVVRQWAVDLTGPHKLTDRVRSAVEFFLRGIRP |
| Ga0209415_101678011 | 3300027905 | Peatlands Soil | AEFMEGLYNTVVRQWAVDLTGPHKLTERARSAVEFFLRGIRP |
| Ga0209006_107568491 | 3300027908 | Forest Soil | GLFNTVVRQWAVDLHGPHKLVDRAANAVEFFLRGAKP |
| Ga0265356_10023551 | 3300028017 | Rhizosphere | ALYHTVVRQWTVDLTGPHKLTERVDSAVQFFLRGVKP |
| Ga0302301_11022551 | 3300028731 | Palsa | FPVVHLAEFMEALYHTVVRQWTVDLTGPHKLTERVDSAVEFFLRGVKP |
| Ga0302224_100888521 | 3300028759 | Palsa | EGLYSTVVRQWAVDLTGPHKLTDRVRSAVDFFMCGIRP |
| Ga0302232_104419111 | 3300028789 | Palsa | MEGLYNTVVRQWAVDLTGPHKLTDRVLSAVEFFLRGLQP |
| Ga0302221_101516681 | 3300028806 | Palsa | VHLAEFMEALYNTVVRQWAVDLTGPHKLTDRVRSAVEFFLRGLQP |
| Ga0308309_100294071 | 3300028906 | Soil | VVHLAEFMEGLYNTVVRQWAVDLTGPHKLTDRVRSAVEFFLRGIRP |
| Ga0222748_11326391 | 3300029701 | Soil | KKMARSRRIFRSFHLAEFMEGLFNTVVRQWAVDLTGPHKLTERVRNAVEFFLRGAKP |
| Ga0311352_103826651 | 3300029944 | Palsa | VVHLAEFMEGLYNTVVRQWAVDLTGPHKLTDRVRSAVEFFLRGVRP |
| Ga0302179_101705681 | 3300030058 | Palsa | LAEFMEGLYNTVVRQWAVDLTGPHKLTDRVRSAVEFFLRGIQP |
| Ga0210287_11821672 | 3300030598 | Soil | FMEGLYNTVVRQWAVDLTGPHKLTDRVRSAVEFFLRGLEP |
| Ga0311356_100827811 | 3300030617 | Palsa | EGLYNTIVRQWAVDLTGPHKLSERVGSAVEFFLRAAQA |
| Ga0310038_100501001 | 3300030707 | Peatlands Soil | LAEFMEGLYNTVVRQWAVDLTGPHKLTDRVRSAVEFFLRGIRP |
| Ga0307482_12814112 | 3300030730 | Hardwood Forest Soil | VFPVLHLSEFMEGLYQTVVRQWAVDLTGPHKLGERVESAVEFFLRGVQP |
| Ga0265459_110674261 | 3300030741 | Soil | PLVHLAEFMEALYHTVVRQWTVDLTGPHKLTERVDSAIEFFLRGVKP |
| Ga0265745_10061462 | 3300030759 | Soil | EALYHTVVRQWTVDLTGPHKLTERVDSAVQFFLRGVKP |
| Ga0265762_11259242 | 3300030760 | Soil | YNTVVRQWAVDLTGPHKLTDRVRSAVEFFLRGLEP |
| Ga0265763_10436662 | 3300030763 | Soil | DFPTVHLAEFMEGLFNTVVRQWAVDLTGPHKLTERVHNAVEFFLRGAKP |
| Ga0265720_10097431 | 3300030764 | Soil | AEFMEGLFNTVVRQWAVDLTGPHKLTERVRSAVEFFLRGAKP |
| Ga0265746_10046361 | 3300030815 | Soil | EITHDFPVVHLAEFMEGLYNTVVRQWAVDLTGPHKLTDRVRSAVEFFLRGLAP |
| Ga0170820_103070401 | 3300031446 | Forest Soil | EFMEGLFNTVVRQWAVDLTGPHKLTERVHNAVEFFLRGAKP |
| Ga0318516_107356611 | 3300031543 | Soil | LEGLYTTVVRRWAVDLSGPHSLSERVRSAVAFFLEGAQP |
| Ga0318541_106225822 | 3300031545 | Soil | YNTVVRQWAVDLTGPHKLTDRVRNAVELFLRGIQP |
| Ga0318542_102655401 | 3300031668 | Soil | AHMAEFLEGLYTTVVRRWAVELSGPHSLTERVRSAVGFFLEGAQP |
| Ga0318561_104669222 | 3300031679 | Soil | LYTTVVRRWAVDLSGPHSLSERVRSAVAFFLEGAQP |
| Ga0318560_104731242 | 3300031682 | Soil | YTTLVRHWAIDLTGPHSLSERVGSAVEFFLRAVQS |
| Ga0310686_1035808803 | 3300031708 | Soil | HLAEFMEGMFNTVVRQWAVDLTGPHKLTERVRNAVEFFLRGARP |
| Ga0310686_1039518603 | 3300031708 | Soil | VVHLAEFMEALYHTVVRQWTVDLTGPHKLTERVDSAVEFFLRGVKP |
| Ga0310686_1070699932 | 3300031708 | Soil | PVVHLAEFMEGLYNTVVRQWAVDLSGPHKLAPRVRSAVEFFLRAIRP |
| Ga0307474_113971101 | 3300031718 | Hardwood Forest Soil | EITRDFPVLHLAEFMEGLYNTVVRQWVVDLTGPHKLSERVRSAVEFFLRAVRP |
| Ga0306918_103988991 | 3300031744 | Soil | HMAEFMEGLYTTVVRRWAVDLSGPHSLTERVRSAVAFFLDGAEP |
| Ga0318502_101496802 | 3300031747 | Soil | LYNTVVRQWAVDLTGPHKLTDRVRNAVELFLRGIQP |
| Ga0318502_105404651 | 3300031747 | Soil | LYTTLVRHWAIDLTGPHSLSERVGSAVEFFLRAVQS |
| Ga0307477_102943062 | 3300031753 | Hardwood Forest Soil | AEFMEGLYNTIVRQWAVDLTGPHKLSERVNSAVEFFLRGVRP |
| Ga0307475_103907361 | 3300031754 | Hardwood Forest Soil | LYNTVVRQWAVDLTGPHKLTDRVRSAVDFFLRGIRP |
| Ga0307475_112811021 | 3300031754 | Hardwood Forest Soil | RAFPVAHLAEFMEGLYNTVVRQWAVDLSGPHKLADRVRSAVEFFLRGIRP |
| Ga0307475_114128292 | 3300031754 | Hardwood Forest Soil | EVTADFPTVHLAEFMEGLFNTVVRQWAVDLTGPHKLTERVHNAVEFFLRGAKP |
| Ga0318521_107433112 | 3300031770 | Soil | FMRALYTTLVRHWAIDLTGPHSLSERVGSAVEFFLRAVQS |
| Ga0318521_107590621 | 3300031770 | Soil | FMEGLYTTVVRRWAVDLSGPHSLTERVRSAVAFFLAGAQP |
| Ga0318546_110398982 | 3300031771 | Soil | FMEGLYNTVVRQWAVDLTGPHKLTDRVRNAVELFLRGIQP |
| Ga0302319_110679752 | 3300031788 | Bog | LAEFMEGLFNTVVRQWAVDLTGPHKLAERAHSAVEFFLRGVKP |
| Ga0318565_103312391 | 3300031799 | Soil | FPVLHMAQFMEGLYNTVVRQWAVDLTGPHKLTDRVRNAVELFLRGIQP |
| Ga0306923_101259853 | 3300031910 | Soil | RALYTTLVRHWAIDLTGPHSLSERVGSAVEFFLRAVQS |
| Ga0306923_110794261 | 3300031910 | Soil | EFMEGLYTTVVRRWAVDLSGPHSLNERVRSAVAFFLAGARP |
| Ga0310916_105012971 | 3300031942 | Soil | MEALYHTVVRQWTVDLTGPHKLAERVDSAVEFFLRGVKP |
| Ga0310913_103239112 | 3300031945 | Soil | HLAEFMEGLYATVVRQWTVDLTGPHKLQDRVLSAVEFFLRGVAPLFRL |
| Ga0307479_114877132 | 3300031962 | Hardwood Forest Soil | GLYNTIVRQWAVDLTGPHKLSDRVSSAVEFFLRGVRP |
| Ga0307479_115928751 | 3300031962 | Hardwood Forest Soil | FPVEHLAEFMEGLYNTIVRQWAVDLTGPHKLSDRVNSAVEFFLRGVRP |
| Ga0306922_103734282 | 3300032001 | Soil | AHLAEFMEGLYTTVVRRWAVDLSGPHSLNERVHSAVAFFLVGAQP |
| Ga0318559_102859932 | 3300032039 | Soil | DFPVLHMAQFMEGLYNTVVRQWAVDLTGPHKLTDRVRNAVELFLRGIQP |
| Ga0307471_1000650891 | 3300032180 | Hardwood Forest Soil | TTDFPVVHLAEFMEGLFNTVVRQWAVDLTGPHKLTERVRNAVEFFLRGAKP |
| Ga0307472_1012949961 | 3300032205 | Hardwood Forest Soil | AEFMEGLFNTVVRQWAVDLTGPHKLTERVRNAVEFFLRGAKP |
| Ga0306920_1007442342 | 3300032261 | Soil | FAPGHMAEFLEGLYTTVVRRWAVDLSGPHSLSERVRSAVAFFLEGAEP |
| Ga0348332_118943001 | 3300032515 | Plant Litter | MEALYHTVVRQWTVDLTGPHKLTERVDSAVQFFLRGVKP |
| Ga0335085_116883422 | 3300032770 | Soil | KRGEITTTFPAAHMAEFMDGLYSIVVRHWAVDVTGPHRLADRVRDAVEFFLRGVQS |
| Ga0335080_101409482 | 3300032828 | Soil | AEFMEGLYTTVVRRWAVALSSPQDLCERVRTAVDFFLAGARA |
| Ga0335080_104611441 | 3300032828 | Soil | GEITRAFPIVHLAEFMEALHNTVVRQWAVDLTGPHKLTERVRSAVAFFLRGVQP |
| Ga0335081_100404461 | 3300032892 | Soil | QFMEGLYTTAVRRWVVDLPQPHSLSERVRSAVDFFLQGAKT |
| Ga0335069_119970201 | 3300032893 | Soil | YTTAVRRWAVGLSGPEKLSERVQSAVVFFLEGARP |
| Ga0335074_100572084 | 3300032895 | Soil | LAEFMEGLYTTVVRRWAVDLEGPHDLSERVLSAVEFFLRGVQA |
| Ga0335083_110070452 | 3300032954 | Soil | AHLAEFMEGLYTTVVRRWAVGLSGPEKLSDRVRSAVEFFLEGARP |
| Ga0335076_114224731 | 3300032955 | Soil | KELSRAFAVAHLAEFMEGLYTTVVRRWAVGLSGPEKLSDRVRSAVEFFLEGARP |
| Ga0335084_103971261 | 3300033004 | Soil | AVAHLAEFMEGLYTTVVRRWAVGLSGPEKLSDRVRSAVEFFLEGARP |
| Ga0335073_113026442 | 3300033134 | Soil | VVHLAEFMEALYHTVVRQWTVDLTGPHKLTERVDSAVEFFLCGVKP |
| Ga0335073_119634961 | 3300033134 | Soil | MEGLYTTVVRRWAVDLEGPHDLSERVLSAVEFFLRGVQA |
| Ga0318519_108763561 | 3300033290 | Soil | GLYNTVVRQWAVDLTGPHKLTDRVRNAVELFLRGIQP |
| Ga0316212_10619341 | 3300033547 | Roots | HLAEFMEGLYNTVVRQWAVDLTGPHQLTDRVRSAVEFFLRGIRP |
| ⦗Top⦘ |