| Basic Information | |
|---|---|
| Family ID | F008070 |
| Family Type | Metagenome |
| Number of Sequences | 339 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MTRRKREIVGLTNERDFPHLVELALPPGGFRSVFLEIDAFHR |
| Number of Associated Samples | 157 |
| Number of Associated Scaffolds | 339 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 96.39 % |
| % of genes near scaffold ends (potentially truncated) | 94.69 % |
| % of genes from short scaffolds (< 2000 bps) | 91.74 % |
| Associated GOLD sequencing projects | 145 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.22 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (77.581 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (43.658 % of family members) |
| Environment Ontology (ENVO) | Unclassified (60.767 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.313 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.43% β-sheet: 0.00% Coil/Unstructured: 68.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.22 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 339 Family Scaffolds |
|---|---|---|
| PF01068 | DNA_ligase_A_M | 12.39 |
| PF02735 | Ku | 3.24 |
| PF03401 | TctC | 1.77 |
| PF04392 | ABC_sub_bind | 1.47 |
| PF13412 | HTH_24 | 1.47 |
| PF01255 | Prenyltransf | 0.88 |
| PF02230 | Abhydrolase_2 | 0.88 |
| PF13374 | TPR_10 | 0.88 |
| PF08734 | GYD | 0.59 |
| PF05860 | TPS | 0.59 |
| PF13358 | DDE_3 | 0.59 |
| PF13560 | HTH_31 | 0.59 |
| PF01381 | HTH_3 | 0.59 |
| PF00043 | GST_C | 0.59 |
| PF14347 | DUF4399 | 0.59 |
| PF00027 | cNMP_binding | 0.59 |
| PF00533 | BRCT | 0.59 |
| PF04519 | Bactofilin | 0.29 |
| PF13505 | OMP_b-brl | 0.29 |
| PF13676 | TIR_2 | 0.29 |
| PF12844 | HTH_19 | 0.29 |
| PF02308 | MgtC | 0.29 |
| PF00857 | Isochorismatase | 0.29 |
| PF04545 | Sigma70_r4 | 0.29 |
| PF13202 | EF-hand_5 | 0.29 |
| PF11953 | DUF3470 | 0.29 |
| PF13924 | Lipocalin_5 | 0.29 |
| PF03466 | LysR_substrate | 0.29 |
| PF13185 | GAF_2 | 0.29 |
| PF00924 | MS_channel | 0.29 |
| PF02518 | HATPase_c | 0.29 |
| PF13683 | rve_3 | 0.29 |
| PF04959 | ARS2 | 0.29 |
| PF13629 | T2SS-T3SS_pil_N | 0.29 |
| PF00589 | Phage_integrase | 0.29 |
| PF05656 | DUF805 | 0.29 |
| PF07045 | DUF1330 | 0.29 |
| PF04055 | Radical_SAM | 0.29 |
| PF12071 | DUF3551 | 0.29 |
| PF13432 | TPR_16 | 0.29 |
| PF13458 | Peripla_BP_6 | 0.29 |
| PF00196 | GerE | 0.29 |
| PF06055 | ExoD | 0.29 |
| PF05532 | CsbD | 0.29 |
| COG ID | Name | Functional Category | % Frequency in 339 Family Scaffolds |
|---|---|---|---|
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 12.39 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 12.39 |
| COG1273 | Non-homologous end joining protein Ku, dsDNA break repair | Replication, recombination and repair [L] | 3.24 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 1.77 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.47 |
| COG0020 | Undecaprenyl pyrophosphate synthase | Lipid transport and metabolism [I] | 0.88 |
| COG0435 | Glutathionyl-hydroquinone reductase | Energy production and conversion [C] | 0.59 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.59 |
| COG3210 | Large exoprotein involved in heme utilization or adhesion | Intracellular trafficking, secretion, and vesicular transport [U] | 0.59 |
| COG0625 | Glutathione S-transferase | Posttranslational modification, protein turnover, chaperones [O] | 0.59 |
| COG1664 | Cytoskeletal protein CcmA, bactofilin family | Cytoskeleton [Z] | 0.29 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.29 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.29 |
| COG3152 | Uncharacterized membrane protein YhaH, DUF805 family | Function unknown [S] | 0.29 |
| COG3174 | Membrane component of predicted Mg2+ transport system, contains DUF4010 domain | Inorganic ion transport and metabolism [P] | 0.29 |
| COG1285 | Magnesium uptake protein YhiD/SapB, involved in acid resistance | Inorganic ion transport and metabolism [P] | 0.29 |
| COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.29 |
| COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 0.29 |
| COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 0.29 |
| COG3932 | Exopolysaccharide synthesis protein ExoD | Cell wall/membrane/envelope biogenesis [M] | 0.29 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.29 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 77.58 % |
| Unclassified | root | N/A | 22.42 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000156|NODE_c0710113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4663 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10043997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1175 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10019217 | All Organisms → cellular organisms → Bacteria | 1641 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10041568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1049 | Open in IMG/M |
| 3300000837|AP72_2010_repI_A100DRAFT_1021691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 902 | Open in IMG/M |
| 3300004633|Ga0066395_10637107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 628 | Open in IMG/M |
| 3300004633|Ga0066395_10689572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 605 | Open in IMG/M |
| 3300005186|Ga0066676_10471808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 851 | Open in IMG/M |
| 3300005332|Ga0066388_100214686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2551 | Open in IMG/M |
| 3300005332|Ga0066388_105374557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 649 | Open in IMG/M |
| 3300005332|Ga0066388_106065207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 610 | Open in IMG/M |
| 3300005332|Ga0066388_106242916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 601 | Open in IMG/M |
| 3300005332|Ga0066388_106810876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 575 | Open in IMG/M |
| 3300005332|Ga0066388_107143555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 561 | Open in IMG/M |
| 3300005332|Ga0066388_108669713 | Not Available | 505 | Open in IMG/M |
| 3300005435|Ga0070714_102043291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 559 | Open in IMG/M |
| 3300005445|Ga0070708_101765481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 574 | Open in IMG/M |
| 3300005467|Ga0070706_100037569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4472 | Open in IMG/M |
| 3300005536|Ga0070697_101936670 | Not Available | 527 | Open in IMG/M |
| 3300005554|Ga0066661_10506019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 729 | Open in IMG/M |
| 3300005554|Ga0066661_10595523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 657 | Open in IMG/M |
| 3300005559|Ga0066700_10276127 | Not Available | 1180 | Open in IMG/M |
| 3300005713|Ga0066905_101378033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 637 | Open in IMG/M |
| 3300005713|Ga0066905_101485885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 616 | Open in IMG/M |
| 3300005713|Ga0066905_101496141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 614 | Open in IMG/M |
| 3300005713|Ga0066905_101894757 | Not Available | 551 | Open in IMG/M |
| 3300005764|Ga0066903_100319975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2476 | Open in IMG/M |
| 3300005764|Ga0066903_101949754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1126 | Open in IMG/M |
| 3300005764|Ga0066903_102387693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1022 | Open in IMG/M |
| 3300005764|Ga0066903_102786702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 948 | Open in IMG/M |
| 3300005764|Ga0066903_103865220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 804 | Open in IMG/M |
| 3300005764|Ga0066903_104299479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 761 | Open in IMG/M |
| 3300005764|Ga0066903_104333163 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300005764|Ga0066903_105301926 | Not Available | 681 | Open in IMG/M |
| 3300005764|Ga0066903_105737677 | Not Available | 652 | Open in IMG/M |
| 3300005764|Ga0066903_105819273 | Not Available | 647 | Open in IMG/M |
| 3300005764|Ga0066903_105834563 | Not Available | 646 | Open in IMG/M |
| 3300005764|Ga0066903_106283202 | Not Available | 620 | Open in IMG/M |
| 3300005764|Ga0066903_106900994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 589 | Open in IMG/M |
| 3300005764|Ga0066903_107119266 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 579 | Open in IMG/M |
| 3300005764|Ga0066903_108206609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_57_22 | 534 | Open in IMG/M |
| 3300005764|Ga0066903_109120688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 501 | Open in IMG/M |
| 3300006028|Ga0070717_10356341 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1309 | Open in IMG/M |
| 3300006028|Ga0070717_11532931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 604 | Open in IMG/M |
| 3300006046|Ga0066652_100085080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2507 | Open in IMG/M |
| 3300006046|Ga0066652_101354220 | Not Available | 669 | Open in IMG/M |
| 3300006844|Ga0075428_101529367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 699 | Open in IMG/M |
| 3300006871|Ga0075434_100460687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1293 | Open in IMG/M |
| 3300009147|Ga0114129_12081519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 685 | Open in IMG/M |
| 3300009792|Ga0126374_10862487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 698 | Open in IMG/M |
| 3300010043|Ga0126380_11387306 | Not Available | 616 | Open in IMG/M |
| 3300010046|Ga0126384_10268322 | Not Available | 1388 | Open in IMG/M |
| 3300010046|Ga0126384_11924083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 564 | Open in IMG/M |
| 3300010046|Ga0126384_12163874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 535 | Open in IMG/M |
| 3300010046|Ga0126384_12177295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 533 | Open in IMG/M |
| 3300010046|Ga0126384_12248331 | Not Available | 526 | Open in IMG/M |
| 3300010047|Ga0126382_10278097 | All Organisms → cellular organisms → Bacteria | 1244 | Open in IMG/M |
| 3300010047|Ga0126382_10540860 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 946 | Open in IMG/M |
| 3300010047|Ga0126382_10545423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum → Magnetospirillum gryphiswaldense → Magnetospirillum gryphiswaldense MSR-1 | 942 | Open in IMG/M |
| 3300010047|Ga0126382_10789316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 808 | Open in IMG/M |
| 3300010047|Ga0126382_11220809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 675 | Open in IMG/M |
| 3300010047|Ga0126382_11678188 | Not Available | 592 | Open in IMG/M |
| 3300010048|Ga0126373_10425872 | Not Available | 1357 | Open in IMG/M |
| 3300010048|Ga0126373_12923668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 533 | Open in IMG/M |
| 3300010358|Ga0126370_10234737 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1411 | Open in IMG/M |
| 3300010358|Ga0126370_11752813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 599 | Open in IMG/M |
| 3300010358|Ga0126370_12523872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 512 | Open in IMG/M |
| 3300010360|Ga0126372_11833252 | Not Available | 650 | Open in IMG/M |
| 3300010360|Ga0126372_13297701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300010361|Ga0126378_10558276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1260 | Open in IMG/M |
| 3300010361|Ga0126378_10597257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1218 | Open in IMG/M |
| 3300010361|Ga0126378_11911623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 676 | Open in IMG/M |
| 3300010361|Ga0126378_12003726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 660 | Open in IMG/M |
| 3300010361|Ga0126378_13182418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 522 | Open in IMG/M |
| 3300010366|Ga0126379_13767799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 508 | Open in IMG/M |
| 3300010366|Ga0126379_13778772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 507 | Open in IMG/M |
| 3300010376|Ga0126381_100377438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1968 | Open in IMG/M |
| 3300010376|Ga0126381_102604712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 724 | Open in IMG/M |
| 3300010376|Ga0126381_103012257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 669 | Open in IMG/M |
| 3300010376|Ga0126381_103077015 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 661 | Open in IMG/M |
| 3300010376|Ga0126381_104586191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 533 | Open in IMG/M |
| 3300010398|Ga0126383_10365461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1468 | Open in IMG/M |
| 3300010398|Ga0126383_10718803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1078 | Open in IMG/M |
| 3300010398|Ga0126383_11633764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 734 | Open in IMG/M |
| 3300010398|Ga0126383_13267967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 529 | Open in IMG/M |
| 3300012189|Ga0137388_10918163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 809 | Open in IMG/M |
| 3300012189|Ga0137388_11718100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 561 | Open in IMG/M |
| 3300012199|Ga0137383_11157380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 558 | Open in IMG/M |
| 3300012200|Ga0137382_10165818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1505 | Open in IMG/M |
| 3300012200|Ga0137382_10237603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1260 | Open in IMG/M |
| 3300012201|Ga0137365_10467034 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300012202|Ga0137363_11575518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 549 | Open in IMG/M |
| 3300012204|Ga0137374_10067767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3535 | Open in IMG/M |
| 3300012205|Ga0137362_11649206 | Not Available | 528 | Open in IMG/M |
| 3300012206|Ga0137380_10382955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1251 | Open in IMG/M |
| 3300012206|Ga0137380_11400524 | Not Available | 584 | Open in IMG/M |
| 3300012211|Ga0137377_10241915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1734 | Open in IMG/M |
| 3300012211|Ga0137377_10560062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1081 | Open in IMG/M |
| 3300012357|Ga0137384_11478029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 528 | Open in IMG/M |
| 3300012923|Ga0137359_10759999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 842 | Open in IMG/M |
| 3300012948|Ga0126375_11759016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 539 | Open in IMG/M |
| 3300012960|Ga0164301_10460622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 907 | Open in IMG/M |
| 3300012961|Ga0164302_10561251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 819 | Open in IMG/M |
| 3300012971|Ga0126369_11869199 | Not Available | 689 | Open in IMG/M |
| 3300012971|Ga0126369_11957922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 674 | Open in IMG/M |
| 3300012971|Ga0126369_13251144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 532 | Open in IMG/M |
| 3300014157|Ga0134078_10118546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1010 | Open in IMG/M |
| 3300015372|Ga0132256_103729552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 512 | Open in IMG/M |
| 3300015373|Ga0132257_104393606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 513 | Open in IMG/M |
| 3300016270|Ga0182036_10056320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2496 | Open in IMG/M |
| 3300016270|Ga0182036_10550673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 919 | Open in IMG/M |
| 3300016270|Ga0182036_10569904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 905 | Open in IMG/M |
| 3300016294|Ga0182041_10329960 | Not Available | 1275 | Open in IMG/M |
| 3300016294|Ga0182041_10427337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1133 | Open in IMG/M |
| 3300016294|Ga0182041_10678387 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 912 | Open in IMG/M |
| 3300016294|Ga0182041_11538410 | Not Available | 613 | Open in IMG/M |
| 3300016294|Ga0182041_11694727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 585 | Open in IMG/M |
| 3300016319|Ga0182033_10758436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 853 | Open in IMG/M |
| 3300016319|Ga0182033_11786438 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300016341|Ga0182035_10565713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 978 | Open in IMG/M |
| 3300016341|Ga0182035_10644565 | Not Available | 919 | Open in IMG/M |
| 3300016341|Ga0182035_11933410 | Not Available | 535 | Open in IMG/M |
| 3300016357|Ga0182032_11304484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 627 | Open in IMG/M |
| 3300016357|Ga0182032_11586290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 569 | Open in IMG/M |
| 3300016371|Ga0182034_11000690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 722 | Open in IMG/M |
| 3300016371|Ga0182034_11503466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 590 | Open in IMG/M |
| 3300016371|Ga0182034_11765967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 545 | Open in IMG/M |
| 3300016371|Ga0182034_11946072 | Not Available | 519 | Open in IMG/M |
| 3300016387|Ga0182040_10843378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 757 | Open in IMG/M |
| 3300016387|Ga0182040_10846985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 756 | Open in IMG/M |
| 3300016387|Ga0182040_10875254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 744 | Open in IMG/M |
| 3300016387|Ga0182040_11507811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 571 | Open in IMG/M |
| 3300016387|Ga0182040_11586777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 557 | Open in IMG/M |
| 3300016387|Ga0182040_11847991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 517 | Open in IMG/M |
| 3300016404|Ga0182037_10811290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 807 | Open in IMG/M |
| 3300016404|Ga0182037_11805867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 546 | Open in IMG/M |
| 3300016404|Ga0182037_12067746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 512 | Open in IMG/M |
| 3300016422|Ga0182039_10707295 | Not Available | 889 | Open in IMG/M |
| 3300016422|Ga0182039_11578438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 599 | Open in IMG/M |
| 3300016445|Ga0182038_10356365 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1214 | Open in IMG/M |
| 3300016445|Ga0182038_10359445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1209 | Open in IMG/M |
| 3300016445|Ga0182038_10875790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 790 | Open in IMG/M |
| 3300016445|Ga0182038_11407881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 625 | Open in IMG/M |
| 3300021078|Ga0210381_10284623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 594 | Open in IMG/M |
| 3300021432|Ga0210384_11648123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 547 | Open in IMG/M |
| 3300021560|Ga0126371_10043373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4275 | Open in IMG/M |
| 3300021560|Ga0126371_10164767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2289 | Open in IMG/M |
| 3300021560|Ga0126371_11110793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 929 | Open in IMG/M |
| 3300021560|Ga0126371_12221587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 662 | Open in IMG/M |
| 3300025910|Ga0207684_10494957 | Not Available | 1048 | Open in IMG/M |
| 3300025939|Ga0207665_10423165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1018 | Open in IMG/M |
| 3300026277|Ga0209350_1086522 | Not Available | 820 | Open in IMG/M |
| 3300026296|Ga0209235_1287723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300026309|Ga0209055_1244993 | Not Available | 553 | Open in IMG/M |
| 3300026332|Ga0209803_1323706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 531 | Open in IMG/M |
| 3300026446|Ga0257178_1028245 | Not Available | 691 | Open in IMG/M |
| 3300027527|Ga0209684_1039280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 725 | Open in IMG/M |
| 3300027874|Ga0209465_10439210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 653 | Open in IMG/M |
| 3300027882|Ga0209590_10684040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 657 | Open in IMG/M |
| 3300028754|Ga0307297_10185859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 722 | Open in IMG/M |
| 3300028755|Ga0307316_10054995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1341 | Open in IMG/M |
| 3300031543|Ga0318516_10038059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2571 | Open in IMG/M |
| 3300031543|Ga0318516_10114978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1530 | Open in IMG/M |
| 3300031543|Ga0318516_10190292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1183 | Open in IMG/M |
| 3300031543|Ga0318516_10190796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1182 | Open in IMG/M |
| 3300031543|Ga0318516_10243930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1039 | Open in IMG/M |
| 3300031543|Ga0318516_10496531 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 700 | Open in IMG/M |
| 3300031543|Ga0318516_10751546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 552 | Open in IMG/M |
| 3300031544|Ga0318534_10222101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1090 | Open in IMG/M |
| 3300031544|Ga0318534_10313944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 903 | Open in IMG/M |
| 3300031544|Ga0318534_10525548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 675 | Open in IMG/M |
| 3300031545|Ga0318541_10027850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2773 | Open in IMG/M |
| 3300031545|Ga0318541_10447395 | Not Available | 722 | Open in IMG/M |
| 3300031545|Ga0318541_10678942 | Not Available | 575 | Open in IMG/M |
| 3300031545|Ga0318541_10859314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 506 | Open in IMG/M |
| 3300031546|Ga0318538_10385757 | Not Available | 758 | Open in IMG/M |
| 3300031546|Ga0318538_10438175 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 707 | Open in IMG/M |
| 3300031561|Ga0318528_10010848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4135 | Open in IMG/M |
| 3300031561|Ga0318528_10254295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 942 | Open in IMG/M |
| 3300031561|Ga0318528_10451234 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 690 | Open in IMG/M |
| 3300031564|Ga0318573_10604072 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300031572|Ga0318515_10285058 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300031572|Ga0318515_10362018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 777 | Open in IMG/M |
| 3300031572|Ga0318515_10785864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300031573|Ga0310915_10667805 | Not Available | 734 | Open in IMG/M |
| 3300031573|Ga0310915_10823197 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 652 | Open in IMG/M |
| 3300031573|Ga0310915_10860360 | Not Available | 636 | Open in IMG/M |
| 3300031573|Ga0310915_10899107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 620 | Open in IMG/M |
| 3300031573|Ga0310915_11170384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 532 | Open in IMG/M |
| 3300031640|Ga0318555_10102089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1512 | Open in IMG/M |
| 3300031679|Ga0318561_10309809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 864 | Open in IMG/M |
| 3300031680|Ga0318574_10320828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 901 | Open in IMG/M |
| 3300031682|Ga0318560_10239978 | Not Available | 972 | Open in IMG/M |
| 3300031713|Ga0318496_10225140 | Not Available | 1033 | Open in IMG/M |
| 3300031713|Ga0318496_10416378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 743 | Open in IMG/M |
| 3300031713|Ga0318496_10699979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 559 | Open in IMG/M |
| 3300031713|Ga0318496_10776917 | Not Available | 528 | Open in IMG/M |
| 3300031719|Ga0306917_10032371 | All Organisms → cellular organisms → Bacteria | 3371 | Open in IMG/M |
| 3300031719|Ga0306917_10310159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1220 | Open in IMG/M |
| 3300031719|Ga0306917_11001447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 652 | Open in IMG/M |
| 3300031719|Ga0306917_11359331 | Not Available | 548 | Open in IMG/M |
| 3300031719|Ga0306917_11427246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 533 | Open in IMG/M |
| 3300031719|Ga0306917_11433059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 532 | Open in IMG/M |
| 3300031720|Ga0307469_10512632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1054 | Open in IMG/M |
| 3300031723|Ga0318493_10145304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1223 | Open in IMG/M |
| 3300031723|Ga0318493_10597844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 615 | Open in IMG/M |
| 3300031724|Ga0318500_10191114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 978 | Open in IMG/M |
| 3300031736|Ga0318501_10155162 | Not Available | 1180 | Open in IMG/M |
| 3300031736|Ga0318501_10175940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1111 | Open in IMG/M |
| 3300031736|Ga0318501_10251969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 934 | Open in IMG/M |
| 3300031744|Ga0306918_10067154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2447 | Open in IMG/M |
| 3300031744|Ga0306918_11183692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 590 | Open in IMG/M |
| 3300031748|Ga0318492_10085697 | Not Available | 1530 | Open in IMG/M |
| 3300031748|Ga0318492_10442511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 686 | Open in IMG/M |
| 3300031748|Ga0318492_10581037 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
| 3300031751|Ga0318494_10306438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 916 | Open in IMG/M |
| 3300031763|Ga0318537_10330276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 563 | Open in IMG/M |
| 3300031763|Ga0318537_10372319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 527 | Open in IMG/M |
| 3300031765|Ga0318554_10045293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2398 | Open in IMG/M |
| 3300031765|Ga0318554_10448405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 731 | Open in IMG/M |
| 3300031768|Ga0318509_10461279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 710 | Open in IMG/M |
| 3300031768|Ga0318509_10463154 | Not Available | 709 | Open in IMG/M |
| 3300031769|Ga0318526_10457197 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300031770|Ga0318521_10222578 | Not Available | 1095 | Open in IMG/M |
| 3300031770|Ga0318521_10886519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 545 | Open in IMG/M |
| 3300031771|Ga0318546_10289793 | Not Available | 1132 | Open in IMG/M |
| 3300031771|Ga0318546_10847134 | Not Available | 643 | Open in IMG/M |
| 3300031771|Ga0318546_10957277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 602 | Open in IMG/M |
| 3300031777|Ga0318543_10390223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 624 | Open in IMG/M |
| 3300031777|Ga0318543_10478231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 558 | Open in IMG/M |
| 3300031780|Ga0318508_1031588 | All Organisms → cellular organisms → Bacteria | 1345 | Open in IMG/M |
| 3300031780|Ga0318508_1137927 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300031780|Ga0318508_1184780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 596 | Open in IMG/M |
| 3300031780|Ga0318508_1211170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 556 | Open in IMG/M |
| 3300031781|Ga0318547_10242360 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1085 | Open in IMG/M |
| 3300031782|Ga0318552_10432076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 672 | Open in IMG/M |
| 3300031782|Ga0318552_10479793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 635 | Open in IMG/M |
| 3300031792|Ga0318529_10452367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 597 | Open in IMG/M |
| 3300031793|Ga0318548_10294351 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 797 | Open in IMG/M |
| 3300031794|Ga0318503_10060674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1165 | Open in IMG/M |
| 3300031794|Ga0318503_10229145 | Not Available | 603 | Open in IMG/M |
| 3300031795|Ga0318557_10298261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 739 | Open in IMG/M |
| 3300031796|Ga0318576_10064263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1619 | Open in IMG/M |
| 3300031796|Ga0318576_10084569 | Not Available | 1430 | Open in IMG/M |
| 3300031797|Ga0318550_10001877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6763 | Open in IMG/M |
| 3300031797|Ga0318550_10493083 | Not Available | 591 | Open in IMG/M |
| 3300031797|Ga0318550_10576671 | Not Available | 541 | Open in IMG/M |
| 3300031798|Ga0318523_10075913 | Not Available | 1621 | Open in IMG/M |
| 3300031798|Ga0318523_10079426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1586 | Open in IMG/M |
| 3300031798|Ga0318523_10133795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1228 | Open in IMG/M |
| 3300031821|Ga0318567_10102221 | All Organisms → cellular organisms → Bacteria | 1552 | Open in IMG/M |
| 3300031821|Ga0318567_10682555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 583 | Open in IMG/M |
| 3300031821|Ga0318567_10831441 | Not Available | 523 | Open in IMG/M |
| 3300031821|Ga0318567_10881142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium RH AL1 | 507 | Open in IMG/M |
| 3300031832|Ga0318499_10384481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 538 | Open in IMG/M |
| 3300031833|Ga0310917_10612096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 739 | Open in IMG/M |
| 3300031835|Ga0318517_10412338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 610 | Open in IMG/M |
| 3300031860|Ga0318495_10381932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 622 | Open in IMG/M |
| 3300031879|Ga0306919_10540057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 899 | Open in IMG/M |
| 3300031880|Ga0318544_10439132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 508 | Open in IMG/M |
| 3300031890|Ga0306925_10244613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1933 | Open in IMG/M |
| 3300031890|Ga0306925_10526158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1256 | Open in IMG/M |
| 3300031890|Ga0306925_11828984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 580 | Open in IMG/M |
| 3300031890|Ga0306925_12117952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 526 | Open in IMG/M |
| 3300031893|Ga0318536_10103024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1432 | Open in IMG/M |
| 3300031893|Ga0318536_10430374 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300031896|Ga0318551_10432960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 750 | Open in IMG/M |
| 3300031897|Ga0318520_11080753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 508 | Open in IMG/M |
| 3300031910|Ga0306923_10572707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1270 | Open in IMG/M |
| 3300031910|Ga0306923_11464011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 716 | Open in IMG/M |
| 3300031910|Ga0306923_11580806 | Not Available | 682 | Open in IMG/M |
| 3300031912|Ga0306921_11932371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 630 | Open in IMG/M |
| 3300031912|Ga0306921_12511554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 534 | Open in IMG/M |
| 3300031912|Ga0306921_12715816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 508 | Open in IMG/M |
| 3300031941|Ga0310912_10524033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 923 | Open in IMG/M |
| 3300031941|Ga0310912_10812615 | Not Available | 722 | Open in IMG/M |
| 3300031941|Ga0310912_11269972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 559 | Open in IMG/M |
| 3300031942|Ga0310916_10215548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1610 | Open in IMG/M |
| 3300031942|Ga0310916_10448996 | Not Available | 1098 | Open in IMG/M |
| 3300031942|Ga0310916_11465604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 557 | Open in IMG/M |
| 3300031942|Ga0310916_11718136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 507 | Open in IMG/M |
| 3300031945|Ga0310913_10001836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 11132 | Open in IMG/M |
| 3300031945|Ga0310913_10631412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 759 | Open in IMG/M |
| 3300031945|Ga0310913_11026139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 577 | Open in IMG/M |
| 3300031946|Ga0310910_10307735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1247 | Open in IMG/M |
| 3300031946|Ga0310910_11549737 | Not Available | 507 | Open in IMG/M |
| 3300031947|Ga0310909_10159379 | All Organisms → cellular organisms → Bacteria | 1859 | Open in IMG/M |
| 3300031947|Ga0310909_10433730 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1103 | Open in IMG/M |
| 3300031947|Ga0310909_11538665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 529 | Open in IMG/M |
| 3300031954|Ga0306926_11027367 | Not Available | 979 | Open in IMG/M |
| 3300031954|Ga0306926_12093316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NBAIM14 | 633 | Open in IMG/M |
| 3300032001|Ga0306922_10105074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2990 | Open in IMG/M |
| 3300032010|Ga0318569_10120939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1193 | Open in IMG/M |
| 3300032010|Ga0318569_10312461 | Not Available | 731 | Open in IMG/M |
| 3300032025|Ga0318507_10125309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1086 | Open in IMG/M |
| 3300032035|Ga0310911_10131592 | Not Available | 1396 | Open in IMG/M |
| 3300032035|Ga0310911_10152506 | Not Available | 1300 | Open in IMG/M |
| 3300032035|Ga0310911_10193217 | Not Available | 1156 | Open in IMG/M |
| 3300032039|Ga0318559_10249481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 821 | Open in IMG/M |
| 3300032042|Ga0318545_10303183 | Not Available | 574 | Open in IMG/M |
| 3300032042|Ga0318545_10325194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 553 | Open in IMG/M |
| 3300032042|Ga0318545_10343252 | Not Available | 537 | Open in IMG/M |
| 3300032043|Ga0318556_10057059 | All Organisms → cellular organisms → Bacteria | 1903 | Open in IMG/M |
| 3300032043|Ga0318556_10348617 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 774 | Open in IMG/M |
| 3300032044|Ga0318558_10163929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1074 | Open in IMG/M |
| 3300032044|Ga0318558_10501430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 606 | Open in IMG/M |
| 3300032044|Ga0318558_10710735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300032051|Ga0318532_10022346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2052 | Open in IMG/M |
| 3300032051|Ga0318532_10227310 | Not Available | 662 | Open in IMG/M |
| 3300032052|Ga0318506_10452328 | Not Available | 569 | Open in IMG/M |
| 3300032054|Ga0318570_10019663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2542 | Open in IMG/M |
| 3300032055|Ga0318575_10725913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300032059|Ga0318533_10674083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 759 | Open in IMG/M |
| 3300032059|Ga0318533_10938155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 635 | Open in IMG/M |
| 3300032060|Ga0318505_10052711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1748 | Open in IMG/M |
| 3300032060|Ga0318505_10572165 | Not Available | 531 | Open in IMG/M |
| 3300032063|Ga0318504_10131699 | Not Available | 1141 | Open in IMG/M |
| 3300032063|Ga0318504_10167746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1016 | Open in IMG/M |
| 3300032063|Ga0318504_10239571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 852 | Open in IMG/M |
| 3300032067|Ga0318524_10240569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 930 | Open in IMG/M |
| 3300032090|Ga0318518_10578995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 573 | Open in IMG/M |
| 3300032091|Ga0318577_10191305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 978 | Open in IMG/M |
| 3300032091|Ga0318577_10609137 | Not Available | 519 | Open in IMG/M |
| 3300032094|Ga0318540_10306284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 767 | Open in IMG/M |
| 3300032205|Ga0307472_101800279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 608 | Open in IMG/M |
| 3300032261|Ga0306920_100340610 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2231 | Open in IMG/M |
| 3300032261|Ga0306920_100555687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1701 | Open in IMG/M |
| 3300032261|Ga0306920_101291516 | Not Available | 1050 | Open in IMG/M |
| 3300033289|Ga0310914_11635817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 548 | Open in IMG/M |
| 3300033290|Ga0318519_10478160 | Not Available | 749 | Open in IMG/M |
| 3300033290|Ga0318519_10541534 | Not Available | 704 | Open in IMG/M |
| 3300033290|Ga0318519_10556972 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 694 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 43.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.70% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 13.27% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 9.14% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.72% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.18% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.18% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.18% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.29% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.29% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.29% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.29% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.29% |
| Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.29% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.59% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.59% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300000837 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026446 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-B | Environmental | Open in IMG/M |
| 3300027527 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| NODE_07101131 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | MTRRKREIVGLRNERDFPYVVELALPLGPFRRVFLEITSTSAPSRSRRI* |
| AF_2010_repII_A1DRAFT_100439972 | 3300000597 | Forest Soil | MTHRKREIVGLRNERDFPHLVELPLPPGPFRSVFLDVSP* |
| AF_2010_repII_A001DRAFT_100192171 | 3300000793 | Forest Soil | MTRRKREIVGLRNERDFPYVVELALPLSPFRRVFLEITST |
| AF_2010_repII_A001DRAFT_100415684 | 3300000793 | Forest Soil | MTRRKHEITGLANEQDFPHLVELAVPPEGFGRGFLDFDAF |
| AP72_2010_repI_A100DRAFT_10216911 | 3300000837 | Forest Soil | MTRRKLEITGLSNEQDFPHLVELALPPEGFRGVLLEMDAFH |
| Ga0066395_106371071 | 3300004633 | Tropical Forest Soil | MTRRKREIIGLTNKRDFPHLVELTLPPGGFRSVFLEIDAFH |
| Ga0066395_106895721 | 3300004633 | Tropical Forest Soil | MTRRKREIVGLTNERDFPHLVELALPPGGFRSVFLEIDTFHRE |
| Ga0066676_104718083 | 3300005186 | Soil | MSRRKREIVGLTNERDFPHLVELALPPGGFRSVFLEIDAFHR |
| Ga0066388_1002146861 | 3300005332 | Tropical Forest Soil | MTRRKREIIGLANEQDFPHVVELAVPPEGFRGAFQEFDAFHRERR |
| Ga0066388_1053745571 | 3300005332 | Tropical Forest Soil | MTRRKSHFVRLTNERDFPHLVELALPPEGFRDVLLQIGAFHRERRIPV |
| Ga0066388_1060652071 | 3300005332 | Tropical Forest Soil | LGEMTRRKREIVGLRNERDFPHLVELALPLGPFRSVFLEIDA |
| Ga0066388_1062429162 | 3300005332 | Tropical Forest Soil | MTRGPKRKILRLTNERDFPNLVELALPPEGFRSVLLEIDAFHRD* |
| Ga0066388_1068108761 | 3300005332 | Tropical Forest Soil | MTRHIRRKSEFVRLTNERDFPHLVELALPPEGFRDVLLQIGAFHRERRIP |
| Ga0066388_1071435552 | 3300005332 | Tropical Forest Soil | MTRRKREIVGLTNERDFPYLVELALPPGGFRSVFQEIDAFHRERRIP |
| Ga0066388_1086697132 | 3300005332 | Tropical Forest Soil | MTRRKRKIISLRNERYFPHLVELALPLGPFRSVILEIDAFHRERRIP |
| Ga0070714_1020432911 | 3300005435 | Agricultural Soil | MTRRKREIVGLTNERDFPHLVELALPPGGFRSVFLEIDAFHRE |
| Ga0070708_1012620651 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRRVPRKSEFVRRTNERDFPHLVELVLPLEGFHSVYLEIDAFHRERH |
| Ga0070708_1017654812 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRRKREIVGLMNERDFPYLVELALPPGGFRSVFLEIDAFHR |
| Ga0070706_1000375698 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRRKREIAGLANEQDFPYLVELALPPEGFRSVLLEIDTFHRE |
| Ga0070698_1009742991 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRRVPRKSEFVRRTNERDFPHLVELVLPLEGFRSVLLEID |
| Ga0070697_1019366702 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRRKREIVGLMNERDFPHLVELALPPGGFRSVFLEIDAFHRDRRILV |
| Ga0066661_105060192 | 3300005554 | Soil | MTHRKREIIGLRNERDFPHLVELALPPGPFRSVFLEIDAFHRERRIPVRR |
| Ga0066661_105955232 | 3300005554 | Soil | MTRRKREIVGLTNERDFPHLVELALPPGGFRSVFLEID |
| Ga0066700_102761271 | 3300005559 | Soil | MTRRKREIVGLRNEQDFPHLVELALPLGPFRSVFLEIDAFHRERRIPVRR |
| Ga0066905_1013780331 | 3300005713 | Tropical Forest Soil | MTRRKREIAGLANEQDFPHLVELTFPPGGFRSVFLEIDAFHRD |
| Ga0066905_1014858852 | 3300005713 | Tropical Forest Soil | MSRRKREITGLANEQDFPHLVELALPPGGFRSVFLEIDTFH |
| Ga0066905_1014961412 | 3300005713 | Tropical Forest Soil | MTRRKREITGLANEQDFPHLVELALPPGGFRSVFLEID |
| Ga0066905_1018947572 | 3300005713 | Tropical Forest Soil | MTRRKRESIGLTNERDFPHLVELTFPPGGFRSVFL |
| Ga0066903_1003199752 | 3300005764 | Tropical Forest Soil | MTRRKREIVGLANEQDFPHLVELALPPGGFRSVFLEIDMFAGDRCAFGE* |
| Ga0066903_1019497541 | 3300005764 | Tropical Forest Soil | MTRGPKREIIRLTNERDFPHLVELALPPEGFRSVLLE |
| Ga0066903_1023876933 | 3300005764 | Tropical Forest Soil | MTHRKREIIGLRNERDFPHLVELALPPGPFRSVFLEIDAFHRERRIP |
| Ga0066903_1027867021 | 3300005764 | Tropical Forest Soil | MTRRKREFVGLTNERDFPYLVELALPPGGFRSVFQEIDAFHRERRIP |
| Ga0066903_1038652201 | 3300005764 | Tropical Forest Soil | MTRRNRGIVGVMNERDFPHLVELALPPGGFRSVVLEID |
| Ga0066903_1042994791 | 3300005764 | Tropical Forest Soil | MTRRKREIVGLTNERDFPYLIELALPPGGFRSVFQEID |
| Ga0066903_1043331631 | 3300005764 | Tropical Forest Soil | MTRRKREIIGVRNERDFPHLVEFALPPGGFRGVFLEIDAFHRERRI |
| Ga0066903_1053019261 | 3300005764 | Tropical Forest Soil | MTRRKREIAGLANERDFPYLVEFELPPGGFRSVFQE |
| Ga0066903_1057376771 | 3300005764 | Tropical Forest Soil | MTRRKREIVSLRNERYFPHLVELALPLGPFRSVILEIDAFHRERRIPV |
| Ga0066903_1058192732 | 3300005764 | Tropical Forest Soil | MTRRKREINGLTNERDFPHLVELALPPGGFRSVFQEIDAFHRERRIPV |
| Ga0066903_1058345632 | 3300005764 | Tropical Forest Soil | MTRRKREINGLANEQDFPHLVELVLPPGGFRSVFLEID |
| Ga0066903_1062832022 | 3300005764 | Tropical Forest Soil | MTRRKREINGLANERDFPHLVELVLPPGGFRSVFLEIDTFHRERRIP |
| Ga0066903_1069009941 | 3300005764 | Tropical Forest Soil | MTRRKREIIGLRNERDFPYLVELALPPEGFRSVFLEIDA |
| Ga0066903_1071192662 | 3300005764 | Tropical Forest Soil | MTRRKREIVALRNERDFPHLVELALPLGPFRSVFLEI |
| Ga0066903_1082066091 | 3300005764 | Tropical Forest Soil | MTRRKRKIISLRNERDFPHLVELALPLGPFRSVILEIDAFHRERRIPVRRGRSRH |
| Ga0066903_1091206881 | 3300005764 | Tropical Forest Soil | MSRRKRETVGFTNERDFPHLVELTFPPGGFRSVFLEIDAFHRDRRIPVRR |
| Ga0070717_103563411 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRRVRRKSATVRFKNERDFPHVVEIALPPEGFRGVLLEIDTFHRERRIPV |
| Ga0070717_115329312 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRRKREIVGLRNERDFPHVVELALPPGGFRSVFLEIDAFHRDRR |
| Ga0066652_1000850807 | 3300006046 | Soil | MTRRKREIVGLTNERDFPHLVELALPPGGFRSVFLEIDAF |
| Ga0066652_1013542202 | 3300006046 | Soil | MTRRKREIVGLTNERDFPHLVELALPPGGFRSVFLEIDAFHRDRRI |
| Ga0075428_1015293672 | 3300006844 | Populus Rhizosphere | MTRRKREIVGLTNERDFPHLVELALPPEGFRDVLLQIDAFHRERRIPVRR |
| Ga0075434_1004606872 | 3300006871 | Populus Rhizosphere | MTRRKREIIGLTNERDFPHLVELTFPPGGFRSVFP |
| Ga0114129_120815191 | 3300009147 | Populus Rhizosphere | MSRRKQEITGLSNERDFPHLVELALPPGGFRSVFLEFDAF |
| Ga0111538_124450202 | 3300009156 | Populus Rhizosphere | MSRRKSEITGHVNERDFPHLVELELPPGGFRNKSQEF |
| Ga0126374_108624873 | 3300009792 | Tropical Forest Soil | MTGRKREITGLVNERDFPHLVELALPPGGFRSVFLDFDAF |
| Ga0126380_113873061 | 3300010043 | Tropical Forest Soil | MTRRKREMVGLANEQDFPHLVELAVPSGGFRDAFLEFDAFHQERRIP |
| Ga0126384_102683225 | 3300010046 | Tropical Forest Soil | MTRRKREIVGLRNERDFPHLVELALPLGPFRSVFLEIDAFH |
| Ga0126384_119240832 | 3300010046 | Tropical Forest Soil | MTRRKREIVGLTNERDFPYLIELALPPGGFRSVFQE |
| Ga0126384_121638741 | 3300010046 | Tropical Forest Soil | MTRHIRRKSEFVRLTNERDFPHLVELALPPEGFRDVLLQIG |
| Ga0126384_121772951 | 3300010046 | Tropical Forest Soil | MTRRKREMVGLTNERDYPHLVELTLPPGGFRSVLLGT |
| Ga0126384_122483311 | 3300010046 | Tropical Forest Soil | MTRRKREIVGLTNEQDFPHVVELALPPGGFRSVFLEFDAFHRERRIPVRRG |
| Ga0126382_102780974 | 3300010047 | Tropical Forest Soil | MTRRKREITGLVNERDFPHLVELALPPGGFRSVFLEFDAF |
| Ga0126382_105408603 | 3300010047 | Tropical Forest Soil | MTRRKREIIGLRNEQGFPHLVELALPPEGFRSVLLEIDAFHRER |
| Ga0126382_105454232 | 3300010047 | Tropical Forest Soil | MTRRKSEFVRLTNERDFPYLVELALPPEGFRDVLLQIGAFHRER |
| Ga0126382_107893162 | 3300010047 | Tropical Forest Soil | MTRRKREIVGLRNERDFPNLVELTLPLGPFRNVFLEIDAFHRE |
| Ga0126382_112208091 | 3300010047 | Tropical Forest Soil | MTRRKREIVGLTNERDFPHLVERALTPGGFRSVFLEIDAFHRERRIPVR |
| Ga0126382_116781881 | 3300010047 | Tropical Forest Soil | MTRRKREIVGLRNERDFPYLVELAVPPEGFRSVFLEIDAFHRERRIPVRR |
| Ga0126373_104258721 | 3300010048 | Tropical Forest Soil | MTRGRKRENIRLTTERDFPHLVELVLPPEGFRGVLLEIDVFHREHRIPVRR |
| Ga0126373_104847183 | 3300010048 | Tropical Forest Soil | MIRRIRRKRGLVRLTNERDYPYLVELILPLEGFRSVLLEIDAFHPERH |
| Ga0126373_129236682 | 3300010048 | Tropical Forest Soil | MARRKREIVGLTNEQDFPHLVELAVPPGGFRSVFLEIDTFHRDRR |
| Ga0126370_102347374 | 3300010358 | Tropical Forest Soil | MTRGPKREIIRLTNERDFPHLVELALPPEGFRSVLL |
| Ga0126370_117528132 | 3300010358 | Tropical Forest Soil | MTRRKREITGLANEQDFPHLVELALPPVGFRSVLLEID |
| Ga0126370_125238721 | 3300010358 | Tropical Forest Soil | MTRRKREIIGLRNERDFPHLVELALPPEGFRSVLLEIDAFHR |
| Ga0126372_118332521 | 3300010360 | Tropical Forest Soil | MTRRKREITGLANEQDFPHLVELALPSGGFRGVFLEID |
| Ga0126372_132977011 | 3300010360 | Tropical Forest Soil | MTRRKREITGLANEQDFPHLVELALPPVGFRSVLLEIDAFHREQRIP |
| Ga0126378_105582761 | 3300010361 | Tropical Forest Soil | MTRGPKRKILRLTNERDFPNLVELALPPEGFRSVLLEIDAFHRE |
| Ga0126378_105972572 | 3300010361 | Tropical Forest Soil | MSRRKREITGLANEQDFPHLVELALPPGGFRSVFLEIDTFHR |
| Ga0126378_119116231 | 3300010361 | Tropical Forest Soil | MTRRKLEITGLANERDFPHLVELALPPEGFRGVLLE |
| Ga0126378_120037262 | 3300010361 | Tropical Forest Soil | MTRRKREITGLMNERDFPHLVELALPPGGFRSVFLEFDAFHRQ |
| Ga0126378_131824182 | 3300010361 | Tropical Forest Soil | MTRRKREINGLANEQDFPHLVELALPPGGFRSVFLEIDTFHRE |
| Ga0126379_137677991 | 3300010366 | Tropical Forest Soil | MTRRKREIVGLRNERDFPYLVELALPPGGFRSVFQEIDAFH |
| Ga0126379_137787721 | 3300010366 | Tropical Forest Soil | MTRHIRRKSEFVRLTNERDFPHLVQLALPPEGFRDVLLQIGAFHRERRIPV |
| Ga0126381_1003774385 | 3300010376 | Tropical Forest Soil | MTRRKREITGLTNERDFPHLVELALPPGGFRSVFLEFDAFHRERRIPVR |
| Ga0126381_1026047124 | 3300010376 | Tropical Forest Soil | MTRGPKREIIRHTNERDFPHLVELALPPEGFRSVLLE |
| Ga0126381_1030122572 | 3300010376 | Tropical Forest Soil | MTRRKSHFVRLTNERDFPHLVELALPPEGFRDVLLQIGAFHRERRIP |
| Ga0126381_1030770151 | 3300010376 | Tropical Forest Soil | MTRRKREIAGLANEQDFPHLVELALPPGGFRSVFLEIDAFHRDRR |
| Ga0126381_1045861912 | 3300010376 | Tropical Forest Soil | MTRRKREITGLANEQDFPHLVELALPLGPFRRVFLEM |
| Ga0126383_103654613 | 3300010398 | Tropical Forest Soil | MTRHIRRKSEFVRLTNERDFPHLVELALPPEGFRDVLLQIGA |
| Ga0126383_107188033 | 3300010398 | Tropical Forest Soil | MTRRKREITGLANEQDFPHLVELALPPGGFRSVFP |
| Ga0126383_116337642 | 3300010398 | Tropical Forest Soil | MTRRKREIVGLRNERDFPHVVELALPLGPFRSVFLE |
| Ga0126383_132679671 | 3300010398 | Tropical Forest Soil | MTRRKREIIGLANERDFPHLVELAVPPGGFRSTFLEFDA |
| Ga0137388_109181633 | 3300012189 | Vadose Zone Soil | MSRRKREITGLTNERDFPHLVELALPLGPFRSVFLEIDAFHRERRIPVRRG |
| Ga0137388_117181001 | 3300012189 | Vadose Zone Soil | MTRRKREIIGLTNERDFPHLVELTFPPGGFRSVFLEIDAFHRERRI |
| Ga0137383_111573801 | 3300012199 | Vadose Zone Soil | MTRRKREIVGLTNEQDFPHLVELAVPPGGFRGAFLEFDAFHQE |
| Ga0137382_101658183 | 3300012200 | Vadose Zone Soil | MTHRKREIIGLRNERDFPHLVELALPPGPFRSVFLEIDA |
| Ga0137382_102376033 | 3300012200 | Vadose Zone Soil | MTRRKREIIGLTNERDFPHLVELTFPPGGFRSVFPEIDAFHRERRI |
| Ga0137365_104670344 | 3300012201 | Vadose Zone Soil | MTRRKREIVGLMNERDFPYLVELALPPGGFRSVFLEIDAFHRDRRI |
| Ga0137363_115755181 | 3300012202 | Vadose Zone Soil | MTRRKREIVGLRNERDFPHVVELALPPGGFRSVFLEIDAFHRE |
| Ga0137374_100677671 | 3300012204 | Vadose Zone Soil | MTRRKREIIGLRNERDFPYLVELALPTGGSIFLEIDA |
| Ga0137362_116492062 | 3300012205 | Vadose Zone Soil | MTRRKREIVGLTNERDFRHLVELAPPPGGFRSTFL |
| Ga0137380_103829551 | 3300012206 | Vadose Zone Soil | MTRRKREIVGLTNEQDFPHLVELAVRREAFEVPS* |
| Ga0137380_114005242 | 3300012206 | Vadose Zone Soil | MTRRKREITGLANEQDFPHLVELAVPPEGFGRSFLDFDAF |
| Ga0137377_102419151 | 3300012211 | Vadose Zone Soil | MTRRKREIVGLTNEQDFPHLVELAVPPGGFRGAFLEFD |
| Ga0137377_105600624 | 3300012211 | Vadose Zone Soil | MSRRKREITGLTNERDFPYLVELALPPGGFRSVFLEIDAFHRER |
| Ga0137384_114780292 | 3300012357 | Vadose Zone Soil | MTHRKREIIGLRNERDFPHVVELALPLGPFRSVFLVIDAFHRVRRI |
| Ga0137359_107599993 | 3300012923 | Vadose Zone Soil | MTRRKREIMGLRNERDFPHLVELTFPPGGFRSVFLEIDAFH |
| Ga0126375_117590162 | 3300012948 | Tropical Forest Soil | MTRRKREIVGLRNERDFPYLVELAVPPEGFRSVFLEIDAFHRERR |
| Ga0164301_104606221 | 3300012960 | Soil | MSRRKREINGLTNERDFPHLVELALPPGGFRSVFLEIDA |
| Ga0164302_105612513 | 3300012961 | Soil | MTRRKREIVGLTNERDFPHLVELALPPGGFRSVFLEIDAFHRDRRIPV |
| Ga0126369_118691991 | 3300012971 | Tropical Forest Soil | MTRRKREITGLANERDFPYLVELALPPGGFRSVFQEIDAFHRERRIP |
| Ga0126369_119579221 | 3300012971 | Tropical Forest Soil | MTRRKREIVGLANEQDFPHLVELALPPGGFRSVFL |
| Ga0126369_132511442 | 3300012971 | Tropical Forest Soil | MTRRKREIVGLRNERDFPYLVELALPPGGFRSVFQEIDAFHRERRI |
| Ga0134078_101185463 | 3300014157 | Grasslands Soil | MTRRKREIVRLTNERDFPHLVELALPLGPFRSVFLEID |
| Ga0132256_1037295523 | 3300015372 | Arabidopsis Rhizosphere | MTRRKLEITGLANEQDFPHLVELALPPEGFRGAFLEFDAFHRE |
| Ga0132257_1043936062 | 3300015373 | Arabidopsis Rhizosphere | MSHRKREIVGLTNERDFPHLVELALPPAGFRSIFLEVDAFHRERRI |
| Ga0182036_100563206 | 3300016270 | Soil | MPRRKREIVGLANEQDFPHLVELAFPPGGFRSVFLEIDMFHRDRR |
| Ga0182036_105506732 | 3300016270 | Soil | MTRRKLEIIGLGNEQDFPHLVELALPPEGFRSVLLEIDARD |
| Ga0182036_105699041 | 3300016270 | Soil | MTRRKREITGLMNERDFPHLVELALPPRGFRSVFLEFDAFHRE |
| Ga0182036_115111001 | 3300016270 | Soil | MTRRIRRKSEFVRRTNERDFPHLVELALPPGGFRS |
| Ga0182041_103299601 | 3300016294 | Soil | MTRRKSEFVRLTNERDFPHLVELALPPEGFRDVLLQIGAF |
| Ga0182041_104273373 | 3300016294 | Soil | MTRRKREIVGLTNERDFPHLVELAVPPGGFRSAFLEFDSFHRELRIPVRR |
| Ga0182041_106783872 | 3300016294 | Soil | MTRRKREIVGLTNERDFPHLVELALPPGGFRSVFLEIDT |
| Ga0182041_115384103 | 3300016294 | Soil | MTRRKRKIISLRNERYFPHLVELALPLGPFRSVIL |
| Ga0182041_116947271 | 3300016294 | Soil | MTRRKREIVGLTNERDFPYLVELALPPGGFRSVFQEIDAFH |
| Ga0182033_107584361 | 3300016319 | Soil | LGKMTRGPKREIIRLTNERDFQHLVELALPPDGFR |
| Ga0182033_117864381 | 3300016319 | Soil | MTRRRREIVGLRNERDFPHLVELVLPLGPFRSVFLEIDAFHRERRIPVRRG |
| Ga0182035_105657131 | 3300016341 | Soil | MTRRKREIVGLTNERDFPHLVELALPPGGFRSVVLEI |
| Ga0182035_106445651 | 3300016341 | Soil | MTRRKREINGLANEQDFPHLVELVLPPGGFRSVFLEIDAFHRDRRIPV |
| Ga0182035_119334101 | 3300016341 | Soil | MTRRKSEIVRFTNERDFPHLVELALPPEGFRDILL |
| Ga0182032_113044841 | 3300016357 | Soil | MTRRKREIVGLRNERDFPYLVELAVPPEGFRSVFLEIDAFHRERRI |
| Ga0182032_115862901 | 3300016357 | Soil | MTRRKREITGLANERDFPHLVELALPPEGFRDVLL |
| Ga0182034_110006901 | 3300016371 | Soil | LVEMTRRKREIAGLANEQDFPHLVELALPPGGFRSVFPEIDR |
| Ga0182034_115034661 | 3300016371 | Soil | MTRRKREIVGLRNERDFPYLVELAVPPEGFRSVFLEIDAFHRERRIPV |
| Ga0182034_117659671 | 3300016371 | Soil | MTRRKREIIGLRNERDFPYLVELPLPPEGFRSIFLEIDSFHRERRIPV |
| Ga0182034_119460722 | 3300016371 | Soil | MTRRKSEIVRFTNERDFPHLVELALPPEGFRDVLL |
| Ga0182040_108433781 | 3300016387 | Soil | MTRRRREIVGLRNERDFPHLVELVLPLGPFRSVFLEIDAFHRERRIP |
| Ga0182040_108469852 | 3300016387 | Soil | MTRHIRRKSEFVSLTNERDFPHLVELALPPEGFRSVLLEIDAFHRKRRIPVRRG |
| Ga0182040_108752541 | 3300016387 | Soil | MTRRKREIIGLRNERDFPYLVELTLPPGGFGSIFLEMDAFHRERRI |
| Ga0182040_115078112 | 3300016387 | Soil | MTRRKREIVGLTNERDFPYLVELALPPGGFRSVFQEIDAFHRERRIPV |
| Ga0182040_115867771 | 3300016387 | Soil | MTRRKREITGLANEQDFPHLVELALPLGPFRRVFLEMDAFHRERRIPVR |
| Ga0182040_118479912 | 3300016387 | Soil | MTRRKREIIGLRNERDFPHLVELALPLGPFRRVFLEMDAFHRERRIPVR |
| Ga0182037_108112903 | 3300016404 | Soil | MTRRKREIIGLRNERDFPYLVELALPPEGFRSVFLE |
| Ga0182037_118058672 | 3300016404 | Soil | MTRRKREITGLANEQDFPHLVELALPLGPFRRVFLEMD |
| Ga0182037_120677461 | 3300016404 | Soil | MTRRKREIVALRNERDFPHLVELALQLGPFRSVFLEIDAFHRERRIPVRR |
| Ga0182039_107072951 | 3300016422 | Soil | MTRRKREITDLANEQDFPHLVELALPPGGFRSVFLEID |
| Ga0182039_115784382 | 3300016422 | Soil | MTRRKREIVGLTNEQDFPHLVELAVPPGGFRGAFLEFDAFH |
| Ga0182038_103563654 | 3300016445 | Soil | MTRRKREIVGLANEHDFPHLVELALPPGPFRGVILEIDAFHRERRIPV |
| Ga0182038_103594453 | 3300016445 | Soil | MTRHIRRKSEFVSLTNERDFPHLVELALPPEGFRSVL |
| Ga0182038_108757901 | 3300016445 | Soil | MTRGPKREIIRHTNERDFPHLVELALPPEGFRSVLLEID |
| Ga0182038_114078811 | 3300016445 | Soil | MTRRKREITGLANERDFPHLVELALPPEGFRDVLLEIHAFHRNQR |
| Ga0210381_102846231 | 3300021078 | Groundwater Sediment | MTRRKREKVGLTNERDFPHLVELALPPGGFLRSPRRHGRAAAV |
| Ga0210384_116481231 | 3300021432 | Soil | MSRRKREINGLTNERDFPHLVELAVPPGGFRSAFLEFDAFHC |
| Ga0126371_100433731 | 3300021560 | Tropical Forest Soil | MTRRKREINGLANEQDFPHLVELALPPGGFRSVFL |
| Ga0126371_101647672 | 3300021560 | Tropical Forest Soil | MTRGPKRKILRLTNERDFPNLVELALPPEGFRSVLLEIDAFHRD |
| Ga0126371_111107931 | 3300021560 | Tropical Forest Soil | MTRRKREIVGFRNERYFPHLVELALPLGPFRRVFLEMDAFHRE |
| Ga0126371_122215871 | 3300021560 | Tropical Forest Soil | MTRRKSHFVRLTNERDFPHLVELALPPEGFRDVLLQIGAFHR |
| Ga0207684_104949573 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRRVRRKSEFVRLTNERDFPHLVELALPPEGFRD |
| Ga0207665_104231651 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRRKREIVGLMNERDFPHLVELALPPGGFRSVFLEIDAF |
| Ga0209350_10865222 | 3300026277 | Grasslands Soil | MTRRKREITGLANEQDFPHLVELAVPPEGFRGVFLEFDAFH |
| Ga0209235_12877232 | 3300026296 | Grasslands Soil | MTRRKREIVGLRNERDFPYLVELALPPGGFRSVFLEIDAFHRERRIPVRR |
| Ga0209055_12449931 | 3300026309 | Soil | MTRRKREIVGLTNERDFPHLVELALPPGGFRSVFLEIDAFHRERRIPVRR |
| Ga0209803_13237063 | 3300026332 | Soil | MTRRKREIVGLTNERDFPHLVELALPPGGFRSVFLEI |
| Ga0257178_10282452 | 3300026446 | Soil | MTRRKREIVGLTNERDFPHLVELALPPGGFRGVFLEIDAF |
| Ga0209684_10392801 | 3300027527 | Tropical Forest Soil | MTKTIRRKSETVRLTNERDFPHLVELALPPEGFRSVLLEIDAFHRE |
| Ga0209465_104392102 | 3300027874 | Tropical Forest Soil | MTRRKREITGLANEQDFPHLVELALPPGGFRSVFPEIDTFH |
| Ga0209590_106840401 | 3300027882 | Vadose Zone Soil | MSRRKREITGLTNERDFPHLVELAVPPGGFRSAFLEFDADAAGR |
| Ga0307297_101858592 | 3300028754 | Soil | MTRRKREKVGLTNERDFPHLVELALPPGGFLRSPRR |
| Ga0307316_100549952 | 3300028755 | Soil | MTRRKREIVGLTNERDFPHLVELALPPGGFRSVFLEIDAFHR |
| Ga0318516_100380594 | 3300031543 | Soil | MTRRKREIVGLRNERDFPHLVELPLPPEGFRSIFLEIDSFHRERRIPVRR |
| Ga0318516_101149781 | 3300031543 | Soil | MTRRKREIIGLRNERDFPYLVELTLPPGGFGSIFLEMDAF |
| Ga0318516_101902921 | 3300031543 | Soil | MTRRKREIIGLRNERDFPHLVELPLPPEGFRSIFLEIDSFHRERR |
| Ga0318516_101907961 | 3300031543 | Soil | MTRREREIIGLRNERDFPYLVELALPPAGFRGVFLEIDAFHRQRRIPVR |
| Ga0318516_102439304 | 3300031543 | Soil | MTRRRREIVGLRNERDFPHLVELVLPLGPFRSVFL |
| Ga0318516_104965312 | 3300031543 | Soil | MTRRKREIVGLRNERDFPYLVELAVPPEGFRSVFLEIDAFHR |
| Ga0318516_107515462 | 3300031543 | Soil | MTRGPKREIIRLTNERDFPHLVELALPPEGFRSILLEIDAFH |
| Ga0318534_102221011 | 3300031544 | Soil | MTRRKREIIGLRNERDFPHLVELALPLGPFRRVFLEMDAFH |
| Ga0318534_103139441 | 3300031544 | Soil | MTRRKREITGLMNERDFPHLVELALPPRGFRSVFLEFDAFHRERRIPV |
| Ga0318534_105255481 | 3300031544 | Soil | MTRRKREIVGLTNERDFPHLVELAVPPEGFRSAFLEFD |
| Ga0318541_100278501 | 3300031545 | Soil | MTRRKLEIAGLANEQDFPYLVELTFPPGGFRSVFLEIDAFH |
| Ga0318541_104473951 | 3300031545 | Soil | MTRRKRKIISLRNERYFPHLVELALPLGPFRSVILEIDAFHRE |
| Ga0318541_106789422 | 3300031545 | Soil | MTRRKSEIVRFTNERDFPHLVELALPPEGFRDVLLE |
| Ga0318541_108593141 | 3300031545 | Soil | MTKTIRRKSETVRLTNERDFPHLVELALPPEGFRSVF |
| Ga0318538_103857571 | 3300031546 | Soil | MTRRKREIIGLRNERDFPHLVELPLPPEGFRSIFLEIDSFHRERRIP |
| Ga0318538_104381751 | 3300031546 | Soil | MTRRKREITGLANEQDFPHLVELAVPPEGFRGTFLEFDAFHRE |
| Ga0318528_100108481 | 3300031561 | Soil | MTRRKREIVGRRNERYFPHLVELALPLGPFRSRVGS |
| Ga0318528_102542951 | 3300031561 | Soil | MTRRKREIVGLTNERDFPHLVELAVPPGGFRSVFLEID |
| Ga0318528_104512343 | 3300031561 | Soil | MTRRKREIVGLTNERDFPYLVELALPPGGFRIVFQEIEAFHRERRIPV |
| Ga0318573_106040722 | 3300031564 | Soil | MTHRKREIIGLRNERDFPHLVELPLPPEGFRSIFL |
| Ga0318515_102850582 | 3300031572 | Soil | MTRRKREIVGLTNERDFPHLVELALPPGGFRSVFLEIDTFH |
| Ga0318515_103620181 | 3300031572 | Soil | MTRRKREITGLANERDFPHVVELAVPPEGFHGAFLEFDAFHREHRIPVRRGR |
| Ga0318515_107858641 | 3300031572 | Soil | MTRRKLEIAGLANEQDFPYLVELTFPPGGFRSVFL |
| Ga0310915_105932812 | 3300031573 | Soil | MTRRIRRKSEFVRRTNERDFPHLVELVLPLEGFRSV |
| Ga0310915_106678051 | 3300031573 | Soil | MTRGRKRENIRLTTERDFPHLVELVLPPEGFRGVLLEIDAFHRDRRIPVR |
| Ga0310915_108231972 | 3300031573 | Soil | MTRRKREITGLANEQDFPHLVELAVPPEGFRGTFLEF |
| Ga0310915_108603601 | 3300031573 | Soil | MTRRKREIVGLSNERDFPHLVELALPPGGFRSVFLEFDAFHRERRIPVR |
| Ga0310915_108991072 | 3300031573 | Soil | LTRRKREIVGLRNERDFPYLVELAVPPEGFRSVFLEIDA |
| Ga0310915_111703842 | 3300031573 | Soil | MTRRKREIIGLRNERDFPHLVELALPLGPFRRVFLEMDAFHRERRIPVRRGRN |
| Ga0318555_101020891 | 3300031640 | Soil | MTRRKREIVGLTNERDFPHLVELAVPPEGFRSAFLEFDAFHR |
| Ga0318561_103098091 | 3300031679 | Soil | MTRRKLEIAGLANEQDFPYLVELTFPPGGFRSVFLEID |
| Ga0318574_103208281 | 3300031680 | Soil | MTRRKREIAGLANEQDFPHLVELTFPPGGFRSVFLEID |
| Ga0318572_107815221 | 3300031681 | Soil | MTRRIRRKSEFVRRTNERDFPHLVELVLPLEGFRSILLE |
| Ga0318560_102399781 | 3300031682 | Soil | MTRRKREIIGLRNERDFPHLVELPLPPEGFRSIFLEIDSFHRER |
| Ga0318496_102251401 | 3300031713 | Soil | MTRRKSEFVRLTNERDFPHLVELALAPGGFRSVFLEIDTFHRD |
| Ga0318496_104163782 | 3300031713 | Soil | MTRRKREIVGLTNERDFPHLVELALPPGGFRSVFLEIDAFHRER |
| Ga0318496_106999792 | 3300031713 | Soil | MTRHIRRKSEFVSLTNERDFPHLVELALPPEGFRSVLL |
| Ga0318496_107769171 | 3300031713 | Soil | MTRRKREITGLANEQDFPHLVELAVPPEGFRGTFLE |
| Ga0306917_100323711 | 3300031719 | Soil | MTRRKREIIGLRNERDFPYLVELTLPPGGFGSIFLEMDAFHR |
| Ga0306917_103101591 | 3300031719 | Soil | MTRHIRRKSEFVSLTNERDFPHLVELALPPEGFRSVLLEIDAFH |
| Ga0306917_110014471 | 3300031719 | Soil | MTRRKREITGLANEQDFPHLVELALPLGPFRRVFLEMDAFHRERRIP |
| Ga0306917_113593311 | 3300031719 | Soil | MTRRKREIIGLRNERDFPHLVELPLPPEGFRSVFQEIDAFHRE |
| Ga0306917_114272462 | 3300031719 | Soil | MTRRKREIVGLRNERYFPHLVELALPLGPFRRVFLE |
| Ga0306917_114330592 | 3300031719 | Soil | MTRRKREITGLANERDFPHLVELALPPGGFRSVFLEFDA |
| Ga0307469_105126323 | 3300031720 | Hardwood Forest Soil | MKNRRRKSEVVRLRNERDFPHQVEVALPAKGFRDV |
| Ga0318493_101453041 | 3300031723 | Soil | MTRRKREIVGLRNERDFPHLVELPLPPEGFRSIFLEIDSFHRERRIPV |
| Ga0318493_105978441 | 3300031723 | Soil | MTRRKREIVGLMNERDFPHIVELALPPGPFGSVVLEIDAFHREQR |
| Ga0318500_101911142 | 3300031724 | Soil | LGKITRRKHQIAGLANEQDFPHLVELALPPEGFRSVLLEIDALH |
| Ga0318501_101551624 | 3300031736 | Soil | MTRRKREITGLANEQDFPHLVELAVPPEGFRGTFLEFD |
| Ga0318501_101759401 | 3300031736 | Soil | MTRRKREIAGLANEQDFPHLVELTFPPGGFRSVFLEIDA |
| Ga0318501_102519691 | 3300031736 | Soil | MTRRKLEIAGLANEQDFPYLVELTFPPGGFRSVFLE |
| Ga0306918_100671541 | 3300031744 | Soil | MTHRKRETIGLRNERDFPHVVELALPPEGFRSVLLEIDAF |
| Ga0306918_111836921 | 3300031744 | Soil | LGKMTHRKREIIGLRNERDFPHVVELALPPEGFRSVLLEIDAFHSDRRIPV |
| Ga0318492_100856973 | 3300031748 | Soil | MTRRKREIVGLTNERDFPHLVELALPPGGFRSVLLEID |
| Ga0318492_104425111 | 3300031748 | Soil | MTRRKREITGLMNERDFPHLVELALPPRGFRSVFLEFD |
| Ga0318492_105810372 | 3300031748 | Soil | MTRRKREIVGLRNERDFPYLVELAVPPEGFRSVFLEI |
| Ga0318494_103064382 | 3300031751 | Soil | MTRRKREITGLMNERDFPHLVELALPPRGFRSVFLEFDAFHRERRIPVR |
| Ga0318537_103302762 | 3300031763 | Soil | MTRRKREIVGLTNERDFPYLVELALPPGGFRSVFQEIDAFHRERRI |
| Ga0318537_103723191 | 3300031763 | Soil | MTPHIRRKSEFVRLTNERDFPHLVELALPPEGFRDVLLQVDAFHRER |
| Ga0318554_100452934 | 3300031765 | Soil | MTRRKREIVGLRNERDFPHLVELPLPPEGFRSIFLEIDSF |
| Ga0318554_104484051 | 3300031765 | Soil | MTRRKREIVGLTNERDFPHLVELALPPGGFRSVFLEIDTFHRDRRI |
| Ga0318509_104612791 | 3300031768 | Soil | LDEMNRRKRKIISLRNERYFPHLVELALPLGPFRSVILEIDAFHRERRIPVR |
| Ga0318509_104631543 | 3300031768 | Soil | MTRRKREIVGLRNERDFPYLVELALPPGGFRSVFLEIDAFHRERRIP |
| Ga0318526_104571971 | 3300031769 | Soil | MTRRKREIVGLTNERDFPYLVELTLPPEGFRSVFLEI |
| Ga0318521_102225781 | 3300031770 | Soil | MTRRKREIIGLRNERDFPHLVELPLPPEGFRSIFLEIDSFHRERRI |
| Ga0318521_108865191 | 3300031770 | Soil | MTRRKREIVGLTNERDFPHLVELALPPGGFRSVVLEIDAFHRE |
| Ga0318546_102897931 | 3300031771 | Soil | MTRRKREIIGLRNERDFPHLVELALPLGPFRRVFLEMDAFHRERRI |
| Ga0318546_108471341 | 3300031771 | Soil | MTRRNRGIVGVMNERDFPHLVELALPPGGFRSVVL |
| Ga0318546_109572772 | 3300031771 | Soil | LTRRKREIVGLRNERDFPYLVELAVPPEGFRSVFLEIAAF |
| Ga0318543_103902231 | 3300031777 | Soil | MPRRKREIVGLANEQDFPHLVELALPPGGFRSVFLEIDTFHRDRRIPV |
| Ga0318543_104782311 | 3300031777 | Soil | MSRRKREMVGLTNERDFPHLVELTFPPGGFRSVFLEIDAFHRDR |
| Ga0318508_10315881 | 3300031780 | Soil | MTRRKREITGLMNERDFPHLVELALPPRGFRSVFLE |
| Ga0318508_11379272 | 3300031780 | Soil | MTRRKREIVGLTNERDFPHLVELAVPPGGFRSVFLEIDTFHRDRRIPV |
| Ga0318508_11847801 | 3300031780 | Soil | MTRRKREITGLANEQDFPHLVELALPPGGFRSVFLEIDTFH |
| Ga0318508_12111701 | 3300031780 | Soil | MTRRKLEIAGLANEQDFPYLVELTFPPGGFRSVFLEIDAFHRDRRIPVR |
| Ga0318547_102423601 | 3300031781 | Soil | MTYRKREIVGLRNERDFPNLVELTLPLRPFRNVFLEIDAFHR |
| Ga0318552_104320762 | 3300031782 | Soil | MTRRKREIAGLANEQDFPYLVELALPPGGFRSVFQ |
| Ga0318552_104797932 | 3300031782 | Soil | MTRRKREIHGLTNERDFPHLVELTFPPGGFRSVFLEIDAFHRDR |
| Ga0318529_104523671 | 3300031792 | Soil | MTKTIRRKSETVRLTNERDFPHLVELALPPKGFHSVFLEI |
| Ga0318548_102943513 | 3300031793 | Soil | MTRRKREIVGLRNERDFPYLVELAVPPEGFRSVFLEIDAFHRERRIPVRHG |
| Ga0318503_100606742 | 3300031794 | Soil | MTRRKREITGLMNERDFPHLVELALPPRGFRSVFLEFDAFH |
| Ga0318503_102291451 | 3300031794 | Soil | MTRRKREITGLANERDFPHVVELAVPPEGFHGAFLEFDAFHRE |
| Ga0318557_102982611 | 3300031795 | Soil | MTRRKREIVGLTNERDFPHLVELALPPGGFRSVFLEIDTFHRDRRIPV |
| Ga0318576_100642631 | 3300031796 | Soil | MTRRKSEFVRLTNERDFPHLVELALPPEGFRDVLLQIGAFHRE |
| Ga0318576_100845695 | 3300031796 | Soil | MTRRKREIIGLRNERDFPYLVELALPPEGFRSVFL |
| Ga0318550_100018771 | 3300031797 | Soil | MTRRKREIVGLTNERDFPHLVELALPPGGFRSVFLEIDTFHRDRRIP |
| Ga0318550_104930831 | 3300031797 | Soil | MTRRKREITGLANEQDFPHLVELALPPGGFRSVFLEIDAF |
| Ga0318550_105766712 | 3300031797 | Soil | MTRRKSEFVRLTNERDFPHLVELALPPEGFRDVLLQI |
| Ga0318523_100759132 | 3300031798 | Soil | MTHRKREIIGLRNERDFPHLVELPLPPEGFRSIFLEID |
| Ga0318523_100794264 | 3300031798 | Soil | MTRRKREIVGLTNERDFPHLVELAVPPEGFRSTFL |
| Ga0318523_101337951 | 3300031798 | Soil | MTRRKREITGLMNERDFPHLVELALPPRGFRSVFLEFDAFHRERRIPVRRS |
| Ga0318567_101022211 | 3300031821 | Soil | MTRRKREITGLMNERDFPHLVELALPPRGFRSVFLEF |
| Ga0318567_106825551 | 3300031821 | Soil | MTRGRKRENIRLTTERDFPHLVELVLPPEGFRGVLLEIDAFHRDR |
| Ga0318567_108314412 | 3300031821 | Soil | MTRRKREIIGLRNERDFPHLVELPLPPEGFRSVFQEIDAFH |
| Ga0318567_108811421 | 3300031821 | Soil | MTRRKREIVGLTNERDFPHLVELAVPPGGFRSAFL |
| Ga0318499_103844811 | 3300031832 | Soil | MTRRKREIVGLTNERDFPHLVELALPPGGFRSVFL |
| Ga0310917_106120961 | 3300031833 | Soil | MTRRKREIVGLRNERDFPHVVELALPLGPFRSVFLEI |
| Ga0318517_104123381 | 3300031835 | Soil | MPRRKREIVGLANEQDFPHLVELALPPGGFRSVFLEIDMF |
| Ga0318495_103819322 | 3300031860 | Soil | MTRRKREIVGLMNERDFPHLVELALPPGPFRGVILE |
| Ga0306919_105400571 | 3300031879 | Soil | MTRRKREIVGLRNERDFPYVVELALPLGPFRRVFLEITS |
| Ga0318544_104391321 | 3300031880 | Soil | MTRRKREIVGLTNERDFPHLVELALPPGGFRSVVLE |
| Ga0306925_102446132 | 3300031890 | Soil | MTRRKREIIGLGNEQDFPHLVELALPPEGFRSVLLEIDARD |
| Ga0306925_105261582 | 3300031890 | Soil | MNRRKRKIISLRNERYFPHLVELALPLGPFRSVILEIDA |
| Ga0306925_118289841 | 3300031890 | Soil | MTRRKREIVGLRNERDFPYLVELAVPPEGFRSVFL |
| Ga0306925_121179521 | 3300031890 | Soil | MTRRKREITGLANEQDFPHLVELTFPPGGFRSVFLEIDAFHRERRIP |
| Ga0318536_101030241 | 3300031893 | Soil | MTRRKREITGLANEQDFPHLVELALPPGGFRSVFLEIDA |
| Ga0318536_104303742 | 3300031893 | Soil | MTHRKREIIGLRNERDFPHLVELPLPPEGFRSIFLEIDSFHRERR |
| Ga0318551_104329601 | 3300031896 | Soil | MTRRKREITGLANERDFPHVVELAVPPEGFHGAFLE |
| Ga0318520_110807532 | 3300031897 | Soil | MTRRKREITGLANEQDFPHLVELALPTGGFSSVFLEIDT |
| Ga0306923_105727072 | 3300031910 | Soil | MNRRKRKIISLRNERYFPHLVELALPLGPFRSVILEID |
| Ga0306923_114640111 | 3300031910 | Soil | MTRRKREIAGLANERGFPYLVELALPPGGFRSVFQEMDA |
| Ga0306923_115808062 | 3300031910 | Soil | MTRRKREITGLANERDFPHVVELAVPPEGFHGAFLEFDAFHREHRI |
| Ga0306921_119323711 | 3300031912 | Soil | LDEMNRRKRKIISLRNERYFPHLVELALPLGPFRSVIL |
| Ga0306921_125115541 | 3300031912 | Soil | MTRRKREIIGLRNERDFPHLVELVLPPEGFRSVFLEIDAFHRERRIPV |
| Ga0306921_127158161 | 3300031912 | Soil | MTRRKREITGLANERDFPHLVELALPPGGFRSVFLEIDAF |
| Ga0310912_105240333 | 3300031941 | Soil | MTRRKREIVGLRNERDFPHLVELALPLGPFRSVFLEIDAFHREWRI |
| Ga0310912_108126151 | 3300031941 | Soil | MTRHIRRKSEFVRLTNERDFPHLVELALPPEGFRDVLLQIDAFHRER |
| Ga0310912_112699721 | 3300031941 | Soil | MTRRKREIVGLMNERDFPHLVELAVPPGGFRSAFLEFN |
| Ga0310916_102155482 | 3300031942 | Soil | MTRHIRRKSEFVRFTNERDFPHLVELALPREGFRD |
| Ga0310916_104489962 | 3300031942 | Soil | MTRRKREIVGLRNERDFPYLVELALPPGGFRSVFLEIDA |
| Ga0310916_114656041 | 3300031942 | Soil | MTRRKREIIGLRNERDFPHLVELALPLGPFRRVFLEMDAFHRERRIPV |
| Ga0310916_117181362 | 3300031942 | Soil | MTRRKREITGLANEQDFPYLVELALPPGGFRTVFLEIDTFHRERRREFMSYR |
| Ga0310913_1000183613 | 3300031945 | Soil | MTRRKLEIAGLANEQDFPYLVELTFPPGGFRSVFLEIDAF |
| Ga0310913_106314123 | 3300031945 | Soil | MTRRKREIVGLMNERDFPHLVELAVPPGGFRSAFL |
| Ga0310913_110261392 | 3300031945 | Soil | MTRRKREITGLANEQDFPHLVELALPLGPFRRVFLEMDAFHREPP |
| Ga0310910_103077353 | 3300031946 | Soil | MTRHIRRKSEFVRLTNERDFPHLVELALPPEGFRDVLLQIGAFHRERRIPVR |
| Ga0310910_115497371 | 3300031946 | Soil | MTRRKREFVRLTNERDFPHLVELALPPEGFRDVLLQI |
| Ga0310909_101593791 | 3300031947 | Soil | MTRRKREIVGLTNERDFPHLVELALPPGGFRSVFLEIDTFHR |
| Ga0310909_104337304 | 3300031947 | Soil | MTHRKRETIGLRNERDFPHVVELALPPEGFRSVLLEIDAFHSDQRIPV |
| Ga0310909_115386651 | 3300031947 | Soil | MTRRKREIVGLMNERDFPHLVELALPPGGFRSVVL |
| Ga0306926_110273671 | 3300031954 | Soil | MTRRKREIVGLRNERYLPHLVELALPLGPFRSVILEIDAFHRERTHPSPPRPES |
| Ga0306926_120933161 | 3300031954 | Soil | MTRRKRKIVSLRNERYFPHLVELALPLGPFRSVILEIDAFHCER |
| Ga0306922_101050742 | 3300032001 | Soil | MTRRKREIVGLRNERDFPYVVELALPLGPFRRVFLEITSTSAPSRSSRI |
| Ga0318569_101209393 | 3300032010 | Soil | MTRHIRRKSEFVRFTNERDFPHLVELALPREGFRDVLPQID |
| Ga0318569_103124611 | 3300032010 | Soil | MTRRKREIVGLRNERYFPHLVELALPLGPFRSVFLEMD |
| Ga0318507_101253091 | 3300032025 | Soil | MTRRKREIVGLTNERDFPHLVELALPPGGFRSVFLEIDTFHRERRI |
| Ga0310911_101315921 | 3300032035 | Soil | MTRRKREIIGLRNERDFPHLVELALPLGPFRRVFLEMDAFHRERRIP |
| Ga0310911_101525064 | 3300032035 | Soil | MTRGPKREIIRLTNERDFPHLVELALPPEGFRSILL |
| Ga0310911_101932172 | 3300032035 | Soil | MTRRKSEIVRFTNERDFPHLVELALPPEGFRDVLLEIH |
| Ga0318559_102494813 | 3300032039 | Soil | MTRGPKREIIRHTNERDFPHLVELALPPEGFRSVLLEIDAFHR |
| Ga0318545_103031831 | 3300032042 | Soil | MTRRKREIVGLTNERDFPYLVELTLPPEGFRSVFLEIDTF |
| Ga0318545_103251941 | 3300032042 | Soil | MTKTIRRKSETVRLTNERDFPHLVELALPPEGFRSVFLEITGGF |
| Ga0318545_103432521 | 3300032042 | Soil | MTRRKSEFVRLTNERDFPHLVELALPPEGFRDVLLQFGA |
| Ga0318556_100570591 | 3300032043 | Soil | MTYRKREIVGLRNERDFPNLVELTLPLRPFRNVFLE |
| Ga0318556_103486171 | 3300032043 | Soil | MTRRKREIVGLRNERDFPYLVELAAPPEGFRSVFLEID |
| Ga0318558_101639294 | 3300032044 | Soil | MTRHIRRKSEFVRLTNERDFPHLVELALPPEGFRDVLL |
| Ga0318558_105014301 | 3300032044 | Soil | MTKTIRRKSETVRLTNERDFPHLVELALPPEGFRSVFLEIDAFHREQR |
| Ga0318558_107107351 | 3300032044 | Soil | MTHRKREIIGLRNERDFPHLVELPLPPEGFRSIFLEIDSFHRE |
| Ga0318532_100223465 | 3300032051 | Soil | MTRRKREIAGLANEQDFPYLVELALPPGGFRSVFQE |
| Ga0318532_102273102 | 3300032051 | Soil | MTRGPKREIIRLTNEQDFPHLVELALPPEGFRSILQEIDAFHRDRRIPV |
| Ga0318506_104523281 | 3300032052 | Soil | MTRRKREFVRLTNERDFPHLVELALPPEGFRDVLLQIGAFHRERRIPVRRG |
| Ga0318570_100196634 | 3300032054 | Soil | MTRRKREIAGLANEQDFPYLVELALPPGGFRSVFQEIDAFHRERH |
| Ga0318575_107259131 | 3300032055 | Soil | LGEMTRGPKRELLRLTNERDFPHLVELALPPEGFRSVL |
| Ga0318533_106740831 | 3300032059 | Soil | MTRRKREITGLANERDFPHLVELALPPGGFRSVFLEFDAFHRQR |
| Ga0318533_109381551 | 3300032059 | Soil | MTRRKREITGLANEQDFPHLVELTFPPGGFRSVFLEIDAFH |
| Ga0318505_100527111 | 3300032060 | Soil | MTRRKREIVGLTNERDFPHLVELAVPPEGFRSTFLEFDAFH |
| Ga0318505_105721651 | 3300032060 | Soil | MTRRKSEFVRLTNERDFPHLVELALPPEGFRDVLLQIGAFHRERRI |
| Ga0318504_101316991 | 3300032063 | Soil | MTRRKREIIGLRNERDFPHLVELPLPPEGFRSIFL |
| Ga0318504_101677461 | 3300032063 | Soil | MTRRNRGIVGVMNERDFPHLVELALPPGGFRSVVLEI |
| Ga0318504_102395712 | 3300032063 | Soil | MTRRKREIVGLTNEQDFSHLVELAVPPGGFRGAFLEFDAFHQE |
| Ga0318524_102405693 | 3300032067 | Soil | MTRRNRGIVGVMNERDFPHLVELALPPGGFRSVVLE |
| Ga0318518_105789951 | 3300032090 | Soil | MTRRKREITGLANEQDFPHLVELALPLGPFRRVFLEMDAFHRERRI |
| Ga0318577_101913052 | 3300032091 | Soil | MTRRKREIVGLRNERDFPYVVELALPLGPFRRVFLE |
| Ga0318577_106091371 | 3300032091 | Soil | MTRRKRKIISLRNERYFPHLVELALPLGPFRSVILEIDAFHCERRIPVR |
| Ga0318540_103062841 | 3300032094 | Soil | MTRRKREIVGLMNERDFPYLVEFALPPGGLRSVFQEI |
| Ga0307472_1018002793 | 3300032205 | Hardwood Forest Soil | MTRRKREIVGLTNERDFPHLVELALPPGGFRSVFLEIDA |
| Ga0306920_1003406104 | 3300032261 | Soil | MTRRKREIVGLTNEQDFPHLVELAVPPGGFRGAFLE |
| Ga0306920_1005556872 | 3300032261 | Soil | MTRRKSQFVRLTNERDFPHLVELALPPEGFRDVLLQIGAFH |
| Ga0306920_1012915161 | 3300032261 | Soil | MTRRKREIIGLRNERDFPYLVELALPPEGFRSVFLEIDAFHRERRI |
| Ga0310914_116358172 | 3300033289 | Soil | MTRRKREIVGLMNERDFPHLVELAVPPGGFRSAFLEFNAFHRERRI |
| Ga0318519_104781601 | 3300033290 | Soil | MTRRKSEIVRFTNERDFPHLVELALPPEGFRDILLE |
| Ga0318519_105415342 | 3300033290 | Soil | MTRRKREIVGLTNERDFPYLVELTLPPEGFRSVFLEIDTFHRERRI |
| Ga0318519_105569722 | 3300033290 | Soil | MTRRKREAVGLTNERDFPHLVELVVPPEGLRDVFLEIDAFH |
| ⦗Top⦘ |