| Basic Information | |
|---|---|
| Family ID | F007964 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 341 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MANAYTTTGSSSLGGTAGGAGLVQKAYDRLLEFALRSEPLIRSVAD |
| Number of Associated Samples | 240 |
| Number of Associated Scaffolds | 341 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 99.41 % |
| % of genes near scaffold ends (potentially truncated) | 99.12 % |
| % of genes from short scaffolds (< 2000 bps) | 88.27 % |
| Associated GOLD sequencing projects | 219 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (51.320 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (19.648 % of family members) |
| Environment Ontology (ENVO) | Unclassified (59.824 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (70.968 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.84% β-sheet: 0.00% Coil/Unstructured: 62.16% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 341 Family Scaffolds |
|---|---|---|
| PF01476 | LysM | 0.59 |
| PF12705 | PDDEXK_1 | 0.59 |
| PF02467 | Whib | 0.29 |
| PF10686 | YAcAr | 0.29 |
| PF14265 | DUF4355 | 0.29 |
| PF13230 | GATase_4 | 0.29 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 66.28 % |
| Unclassified | root | N/A | 33.72 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002092|JGI24218J26658_1037465 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 569 | Open in IMG/M |
| 3300002145|S2t7BSb_11475131 | Not Available | 750 | Open in IMG/M |
| 3300002199|metazooDRAFT_1244808 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
| 3300002202|metazooDRAFT_1240356 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 545 | Open in IMG/M |
| 3300002206|metazooDRAFT_1301207 | Not Available | 563 | Open in IMG/M |
| 3300002298|B570J29599_1002424 | All Organisms → Viruses → Predicted Viral | 1285 | Open in IMG/M |
| 3300002307|JGI24890J29729_1040192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium SCGC AAA024-D14 | 922 | Open in IMG/M |
| 3300002307|JGI24890J29729_1048733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium SCGC AAA024-D14 | 784 | Open in IMG/M |
| 3300002307|JGI24890J29729_1050112 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 766 | Open in IMG/M |
| 3300002408|B570J29032_109206323 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 635 | Open in IMG/M |
| 3300002408|B570J29032_109371537 | Not Available | 719 | Open in IMG/M |
| 3300002835|B570J40625_100311547 | All Organisms → Viruses → Predicted Viral | 1587 | Open in IMG/M |
| 3300002835|B570J40625_100871958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium SCGC AAA024-D14 | 782 | Open in IMG/M |
| 3300003277|JGI25908J49247_10018524 | Not Available | 2093 | Open in IMG/M |
| 3300003277|JGI25908J49247_10057721 | Not Available | 997 | Open in IMG/M |
| 3300003393|JGI25909J50240_1043720 | Not Available | 946 | Open in IMG/M |
| 3300003393|JGI25909J50240_1090404 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 610 | Open in IMG/M |
| 3300003394|JGI25907J50239_1036661 | All Organisms → Viruses → Predicted Viral | 1032 | Open in IMG/M |
| 3300003395|JGI25917J50250_1105135 | Not Available | 580 | Open in IMG/M |
| 3300004788|Ga0007742_10085145 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 753 | Open in IMG/M |
| 3300004792|Ga0007761_10023598 | Not Available | 524 | Open in IMG/M |
| 3300004796|Ga0007763_10072786 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 679 | Open in IMG/M |
| 3300004797|Ga0007764_11598676 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 698 | Open in IMG/M |
| 3300004807|Ga0007809_10031295 | All Organisms → Viruses → Predicted Viral | 1808 | Open in IMG/M |
| 3300004810|Ga0007757_11399051 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 776 | Open in IMG/M |
| 3300004836|Ga0007759_10046612 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 553 | Open in IMG/M |
| 3300005417|Ga0068884_1063841 | Not Available | 775 | Open in IMG/M |
| 3300005421|Ga0068882_1002371 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 646 | Open in IMG/M |
| 3300005525|Ga0068877_10523814 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 653 | Open in IMG/M |
| 3300005527|Ga0068876_10133181 | All Organisms → Viruses → Predicted Viral | 1468 | Open in IMG/M |
| 3300005527|Ga0068876_10479130 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 685 | Open in IMG/M |
| 3300005528|Ga0068872_10013991 | Not Available | 5567 | Open in IMG/M |
| 3300005580|Ga0049083_10191777 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 695 | Open in IMG/M |
| 3300005581|Ga0049081_10093307 | All Organisms → Viruses → Predicted Viral | 1125 | Open in IMG/M |
| 3300005582|Ga0049080_10051999 | All Organisms → Viruses → Predicted Viral | 1415 | Open in IMG/M |
| 3300005582|Ga0049080_10128860 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 853 | Open in IMG/M |
| 3300005582|Ga0049080_10171686 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 722 | Open in IMG/M |
| 3300005582|Ga0049080_10231928 | Not Available | 605 | Open in IMG/M |
| 3300005584|Ga0049082_10080898 | All Organisms → Viruses → Predicted Viral | 1140 | Open in IMG/M |
| 3300005584|Ga0049082_10280702 | Not Available | 558 | Open in IMG/M |
| 3300005662|Ga0078894_11066030 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 692 | Open in IMG/M |
| 3300005805|Ga0079957_1097120 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1617 | Open in IMG/M |
| 3300005805|Ga0079957_1298066 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 727 | Open in IMG/M |
| 3300005805|Ga0079957_1301226 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 721 | Open in IMG/M |
| 3300006802|Ga0070749_10476960 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 681 | Open in IMG/M |
| 3300006805|Ga0075464_10699334 | Not Available | 627 | Open in IMG/M |
| 3300006805|Ga0075464_11067012 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
| 3300006875|Ga0075473_10051413 | All Organisms → Viruses → Predicted Viral | 1595 | Open in IMG/M |
| 3300007177|Ga0102978_1007517 | Not Available | 1994 | Open in IMG/M |
| 3300007321|Ga0102692_1002235 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 738 | Open in IMG/M |
| 3300007321|Ga0102692_1166518 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 652 | Open in IMG/M |
| 3300007321|Ga0102692_1574070 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 675 | Open in IMG/M |
| 3300007363|Ga0075458_10096161 | Not Available | 923 | Open in IMG/M |
| 3300007534|Ga0102690_1723165 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 719 | Open in IMG/M |
| 3300007538|Ga0099851_1124741 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 970 | Open in IMG/M |
| 3300007541|Ga0099848_1015179 | All Organisms → Viruses → Predicted Viral | 3339 | Open in IMG/M |
| 3300007560|Ga0102913_1168160 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 706 | Open in IMG/M |
| 3300007670|Ga0102862_1043599 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1081 | Open in IMG/M |
| 3300007864|Ga0105749_1074378 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 719 | Open in IMG/M |
| 3300007972|Ga0105745_1137191 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 742 | Open in IMG/M |
| 3300007973|Ga0105746_1135698 | Not Available | 824 | Open in IMG/M |
| 3300008055|Ga0108970_11600318 | Not Available | 891 | Open in IMG/M |
| 3300008107|Ga0114340_1141693 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 899 | Open in IMG/M |
| 3300008107|Ga0114340_1268219 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 509 | Open in IMG/M |
| 3300008111|Ga0114344_1153298 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 784 | Open in IMG/M |
| 3300008114|Ga0114347_1085356 | All Organisms → Viruses → Predicted Viral | 2061 | Open in IMG/M |
| 3300008116|Ga0114350_1183860 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
| 3300008117|Ga0114351_1301130 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 758 | Open in IMG/M |
| 3300008120|Ga0114355_1060397 | All Organisms → Viruses → Predicted Viral | 1666 | Open in IMG/M |
| 3300008263|Ga0114349_1110263 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1180 | Open in IMG/M |
| 3300008264|Ga0114353_1271533 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 731 | Open in IMG/M |
| 3300008266|Ga0114363_1177776 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 678 | Open in IMG/M |
| 3300008266|Ga0114363_1244229 | Not Available | 510 | Open in IMG/M |
| 3300008339|Ga0114878_1041520 | All Organisms → Viruses → Predicted Viral | 2000 | Open in IMG/M |
| 3300008450|Ga0114880_1219605 | Not Available | 620 | Open in IMG/M |
| 3300009068|Ga0114973_10000513 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 29321 | Open in IMG/M |
| 3300009068|Ga0114973_10000913 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 22153 | Open in IMG/M |
| 3300009086|Ga0102812_10357365 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 795 | Open in IMG/M |
| 3300009154|Ga0114963_10272045 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 953 | Open in IMG/M |
| 3300009155|Ga0114968_10406837 | Not Available | 742 | Open in IMG/M |
| 3300009155|Ga0114968_10763590 | Not Available | 504 | Open in IMG/M |
| 3300009160|Ga0114981_10089511 | Not Available | 1709 | Open in IMG/M |
| 3300009160|Ga0114981_10572498 | Not Available | 601 | Open in IMG/M |
| 3300009163|Ga0114970_10711431 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 533 | Open in IMG/M |
| 3300009164|Ga0114975_10432336 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 715 | Open in IMG/M |
| 3300009164|Ga0114975_10606684 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 583 | Open in IMG/M |
| 3300009165|Ga0105102_10109319 | All Organisms → Viruses → Predicted Viral | 1306 | Open in IMG/M |
| 3300009165|Ga0105102_10249707 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 903 | Open in IMG/M |
| 3300009169|Ga0105097_10198944 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1103 | Open in IMG/M |
| 3300009180|Ga0114979_10499370 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 703 | Open in IMG/M |
| 3300009181|Ga0114969_10132596 | All Organisms → Viruses → Predicted Viral | 1579 | Open in IMG/M |
| 3300009181|Ga0114969_10478936 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 700 | Open in IMG/M |
| 3300009181|Ga0114969_10520692 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 662 | Open in IMG/M |
| 3300009182|Ga0114959_10362145 | Not Available | 714 | Open in IMG/M |
| 3300009183|Ga0114974_10051498 | All Organisms → Viruses → Predicted Viral | 2760 | Open in IMG/M |
| 3300009183|Ga0114974_10624702 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 592 | Open in IMG/M |
| 3300009559|Ga0130029_1013168 | Not Available | 758 | Open in IMG/M |
| 3300009684|Ga0114958_10355497 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 712 | Open in IMG/M |
| 3300009861|Ga0132184_100724 | Not Available | 625 | Open in IMG/M |
| 3300010157|Ga0114964_10102781 | All Organisms → Viruses → Predicted Viral | 1417 | Open in IMG/M |
| 3300010157|Ga0114964_10150951 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1130 | Open in IMG/M |
| 3300010158|Ga0114960_10190007 | All Organisms → Viruses → Predicted Viral | 1078 | Open in IMG/M |
| 3300010158|Ga0114960_10209968 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1012 | Open in IMG/M |
| 3300010158|Ga0114960_10322170 | Not Available | 770 | Open in IMG/M |
| 3300010158|Ga0114960_10423593 | Not Available | 648 | Open in IMG/M |
| 3300010158|Ga0114960_10468876 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
| 3300010160|Ga0114967_10443658 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 641 | Open in IMG/M |
| 3300010297|Ga0129345_1066888 | All Organisms → Viruses → Predicted Viral | 1357 | Open in IMG/M |
| 3300010334|Ga0136644_10097885 | All Organisms → Viruses → Predicted Viral | 1827 | Open in IMG/M |
| 3300010334|Ga0136644_10423886 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 752 | Open in IMG/M |
| 3300010354|Ga0129333_10025380 | Not Available | 5615 | Open in IMG/M |
| 3300010354|Ga0129333_10742045 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 841 | Open in IMG/M |
| 3300010354|Ga0129333_11205405 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 628 | Open in IMG/M |
| 3300010885|Ga0133913_10018854 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 18386 | Open in IMG/M |
| 3300010885|Ga0133913_10046163 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11713 | Open in IMG/M |
| 3300010885|Ga0133913_10056162 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10570 | Open in IMG/M |
| 3300010885|Ga0133913_10238758 | All Organisms → Viruses → Predicted Viral | 4829 | Open in IMG/M |
| 3300010885|Ga0133913_10762988 | All Organisms → Viruses → Predicted Viral | 2524 | Open in IMG/M |
| 3300010885|Ga0133913_11033372 | All Organisms → Viruses → Predicted Viral | 2122 | Open in IMG/M |
| 3300011012|Ga0150979_1589174 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
| 3300011268|Ga0151620_1132761 | Not Available | 772 | Open in IMG/M |
| 3300011381|Ga0102688_1667733 | Not Available | 607 | Open in IMG/M |
| 3300012012|Ga0153799_1000667 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10766 | Open in IMG/M |
| 3300012013|Ga0153805_1005013 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2349 | Open in IMG/M |
| 3300012706|Ga0157627_1038179 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 706 | Open in IMG/M |
| 3300012706|Ga0157627_1219737 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
| 3300012711|Ga0157607_1240676 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 513 | Open in IMG/M |
| 3300012716|Ga0157605_1023208 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 784 | Open in IMG/M |
| 3300012721|Ga0157612_1029136 | Not Available | 697 | Open in IMG/M |
| 3300012723|Ga0157604_1109335 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 752 | Open in IMG/M |
| 3300012723|Ga0157604_1243738 | Not Available | 618 | Open in IMG/M |
| 3300012724|Ga0157611_1068996 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 513 | Open in IMG/M |
| 3300012725|Ga0157610_1144845 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 701 | Open in IMG/M |
| 3300012730|Ga0157602_1148692 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 628 | Open in IMG/M |
| 3300012733|Ga0157606_1068276 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 541 | Open in IMG/M |
| 3300012734|Ga0157615_1382080 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 625 | Open in IMG/M |
| 3300012745|Ga0157532_136221 | Not Available | 672 | Open in IMG/M |
| 3300012757|Ga0157628_1169303 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 671 | Open in IMG/M |
| 3300012758|Ga0138285_1063869 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 758 | Open in IMG/M |
| 3300012759|Ga0157626_1131279 | Not Available | 707 | Open in IMG/M |
| 3300012759|Ga0157626_1158981 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 774 | Open in IMG/M |
| 3300012763|Ga0138289_1164328 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 664 | Open in IMG/M |
| 3300012773|Ga0138290_1247221 | Not Available | 606 | Open in IMG/M |
| 3300012778|Ga0138269_1248349 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 687 | Open in IMG/M |
| 3300012968|Ga0129337_1003807 | All Organisms → Viruses → Predicted Viral | 1143 | Open in IMG/M |
| 3300012970|Ga0129338_1210365 | Not Available | 731 | Open in IMG/M |
| 3300012970|Ga0129338_1270006 | Not Available | 753 | Open in IMG/M |
| 3300013004|Ga0164293_10024164 | Not Available | 5071 | Open in IMG/M |
| 3300013004|Ga0164293_10289768 | All Organisms → Viruses → Predicted Viral | 1139 | Open in IMG/M |
| 3300013004|Ga0164293_10891819 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 560 | Open in IMG/M |
| 3300013005|Ga0164292_10301490 | All Organisms → Viruses → Predicted Viral | 1096 | Open in IMG/M |
| 3300013074|Ga0157618_1057949 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 535 | Open in IMG/M |
| 3300013074|Ga0157618_1078745 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 849 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10030312 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5233 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10493938 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 812 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10609066 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 703 | Open in IMG/M |
| (restricted) 3300013138|Ga0172371_10574510 | Not Available | 794 | Open in IMG/M |
| 3300013295|Ga0170791_11725323 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 652 | Open in IMG/M |
| 3300013295|Ga0170791_13744249 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 656 | Open in IMG/M |
| 3300013310|Ga0157622_1055870 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 745 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10005208 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14602 | Open in IMG/M |
| 3300016686|Ga0180056_1103412 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 690 | Open in IMG/M |
| 3300016692|Ga0180040_1014292 | Not Available | 761 | Open in IMG/M |
| 3300016695|Ga0180059_1109496 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 716 | Open in IMG/M |
| 3300017701|Ga0181364_1019821 | All Organisms → Viruses → Predicted Viral | 1109 | Open in IMG/M |
| 3300017701|Ga0181364_1042025 | Not Available | 727 | Open in IMG/M |
| 3300017701|Ga0181364_1075657 | Not Available | 514 | Open in IMG/M |
| 3300017716|Ga0181350_1052181 | All Organisms → Viruses → Predicted Viral | 1084 | Open in IMG/M |
| 3300017722|Ga0181347_1170551 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 585 | Open in IMG/M |
| 3300017722|Ga0181347_1208456 | Not Available | 511 | Open in IMG/M |
| 3300017736|Ga0181365_1090028 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 747 | Open in IMG/M |
| 3300017761|Ga0181356_1149462 | Not Available | 725 | Open in IMG/M |
| 3300017774|Ga0181358_1246991 | Not Available | 563 | Open in IMG/M |
| 3300017777|Ga0181357_1166680 | Not Available | 804 | Open in IMG/M |
| 3300017777|Ga0181357_1168576 | Not Available | 798 | Open in IMG/M |
| 3300017778|Ga0181349_1175806 | Not Available | 754 | Open in IMG/M |
| 3300017780|Ga0181346_1193383 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 738 | Open in IMG/M |
| 3300017780|Ga0181346_1275543 | Not Available | 579 | Open in IMG/M |
| 3300017784|Ga0181348_1039996 | Not Available | 1947 | Open in IMG/M |
| 3300017784|Ga0181348_1330444 | Not Available | 502 | Open in IMG/M |
| 3300017785|Ga0181355_1234582 | Not Available | 708 | Open in IMG/M |
| 3300017785|Ga0181355_1262298 | Not Available | 659 | Open in IMG/M |
| 3300017785|Ga0181355_1348990 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 544 | Open in IMG/M |
| 3300018665|Ga0188882_1012622 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 743 | Open in IMG/M |
| 3300019784|Ga0181359_1011056 | All Organisms → Viruses → Predicted Viral | 3230 | Open in IMG/M |
| 3300019784|Ga0181359_1029228 | All Organisms → Viruses → Predicted Viral | 2123 | Open in IMG/M |
| 3300019784|Ga0181359_1052881 | Not Available | 1564 | Open in IMG/M |
| 3300019784|Ga0181359_1209475 | Not Available | 621 | Open in IMG/M |
| 3300020109|Ga0194112_10040285 | All Organisms → Viruses → Predicted Viral | 4830 | Open in IMG/M |
| 3300020157|Ga0194049_1114148 | Not Available | 725 | Open in IMG/M |
| 3300020190|Ga0194118_10066252 | All Organisms → Viruses → Predicted Viral | 2307 | Open in IMG/M |
| 3300020221|Ga0194127_10550970 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 740 | Open in IMG/M |
| 3300020570|Ga0208465_1005787 | All Organisms → Viruses → Predicted Viral | 1914 | Open in IMG/M |
| 3300021438|Ga0213920_1091827 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
| 3300021962|Ga0222713_10098415 | All Organisms → Viruses → Predicted Viral | 2101 | Open in IMG/M |
| 3300021962|Ga0222713_10205460 | All Organisms → Viruses → Predicted Viral | 1314 | Open in IMG/M |
| 3300021962|Ga0222713_10211493 | All Organisms → Viruses → Predicted Viral | 1290 | Open in IMG/M |
| 3300021962|Ga0222713_10580383 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 657 | Open in IMG/M |
| 3300021962|Ga0222713_10639533 | Not Available | 615 | Open in IMG/M |
| 3300022179|Ga0181353_1108733 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 674 | Open in IMG/M |
| 3300022190|Ga0181354_1198013 | Not Available | 600 | Open in IMG/M |
| 3300022190|Ga0181354_1202317 | Not Available | 591 | Open in IMG/M |
| 3300022190|Ga0181354_1209768 | Not Available | 575 | Open in IMG/M |
| 3300022190|Ga0181354_1246309 | Not Available | 511 | Open in IMG/M |
| 3300022200|Ga0196901_1131856 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 846 | Open in IMG/M |
| 3300022200|Ga0196901_1239737 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 566 | Open in IMG/M |
| 3300022752|Ga0214917_10008216 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10312 | Open in IMG/M |
| 3300022752|Ga0214917_10011872 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7980 | Open in IMG/M |
| 3300023174|Ga0214921_10561078 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
| 3300023179|Ga0214923_10064280 | Not Available | 2681 | Open in IMG/M |
| 3300023179|Ga0214923_10379920 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 733 | Open in IMG/M |
| 3300024346|Ga0244775_11163100 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
| 3300024352|Ga0255142_1062245 | Not Available | 568 | Open in IMG/M |
| 3300024481|Ga0256330_1068133 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 755 | Open in IMG/M |
| 3300024483|Ga0255224_1131977 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 526 | Open in IMG/M |
| 3300024504|Ga0255179_1038518 | Not Available | 674 | Open in IMG/M |
| 3300024531|Ga0255228_1056827 | Not Available | 787 | Open in IMG/M |
| 3300024531|Ga0255228_1066428 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 727 | Open in IMG/M |
| 3300024533|Ga0256299_1059901 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 753 | Open in IMG/M |
| 3300024533|Ga0256299_1089158 | Not Available | 613 | Open in IMG/M |
| 3300024537|Ga0255225_1043208 | Not Available | 759 | Open in IMG/M |
| 3300024539|Ga0255231_1058899 | Not Available | 616 | Open in IMG/M |
| 3300024552|Ga0256345_1115520 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 510 | Open in IMG/M |
| 3300024554|Ga0255242_1042891 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1013 | Open in IMG/M |
| 3300024555|Ga0255280_1084371 | Not Available | 635 | Open in IMG/M |
| 3300024557|Ga0255283_1125639 | Not Available | 547 | Open in IMG/M |
| 3300024562|Ga0256336_1068513 | Not Available | 763 | Open in IMG/M |
| 3300024563|Ga0255236_1078486 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 761 | Open in IMG/M |
| 3300024565|Ga0255273_1146197 | Not Available | 539 | Open in IMG/M |
| 3300024566|Ga0256309_1100759 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 727 | Open in IMG/M |
| 3300024567|Ga0256307_1089780 | Not Available | 717 | Open in IMG/M |
| 3300024860|Ga0256344_1080024 | Not Available | 710 | Open in IMG/M |
| 3300024862|Ga0256317_1071633 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 762 | Open in IMG/M |
| 3300024862|Ga0256317_1082417 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 707 | Open in IMG/M |
| 3300025635|Ga0208147_1063114 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 934 | Open in IMG/M |
| 3300025646|Ga0208161_1140756 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 614 | Open in IMG/M |
| 3300025655|Ga0208795_1076524 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 933 | Open in IMG/M |
| 3300025744|Ga0255245_1027527 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 717 | Open in IMG/M |
| 3300025760|Ga0255249_1053071 | Not Available | 694 | Open in IMG/M |
| 3300025818|Ga0208542_1087754 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 910 | Open in IMG/M |
| 3300025896|Ga0208916_10130810 | All Organisms → Viruses → Predicted Viral | 1073 | Open in IMG/M |
| 3300026405|Ga0256296_1023027 | Not Available | 745 | Open in IMG/M |
| 3300026410|Ga0256325_1051819 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 570 | Open in IMG/M |
| 3300026562|Ga0255285_1078943 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 640 | Open in IMG/M |
| 3300026567|Ga0256303_1066812 | Not Available | 771 | Open in IMG/M |
| 3300026569|Ga0255277_1118900 | Not Available | 656 | Open in IMG/M |
| 3300027131|Ga0255066_1057427 | Not Available | 545 | Open in IMG/M |
| 3300027142|Ga0255065_1000546 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9000 | Open in IMG/M |
| 3300027151|Ga0255063_1081509 | Not Available | 594 | Open in IMG/M |
| 3300027337|Ga0255087_1003921 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4412 | Open in IMG/M |
| 3300027608|Ga0208974_1175255 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
| 3300027627|Ga0208942_1093965 | Not Available | 860 | Open in IMG/M |
| 3300027659|Ga0208975_1175427 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 585 | Open in IMG/M |
| 3300027693|Ga0209704_1228272 | Not Available | 544 | Open in IMG/M |
| 3300027712|Ga0209499_1310001 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
| 3300027741|Ga0209085_1057356 | All Organisms → Viruses → Predicted Viral | 1790 | Open in IMG/M |
| 3300027744|Ga0209355_1347707 | Not Available | 545 | Open in IMG/M |
| 3300027749|Ga0209084_1068529 | All Organisms → Viruses → Predicted Viral | 1642 | Open in IMG/M |
| 3300027749|Ga0209084_1295102 | Not Available | 613 | Open in IMG/M |
| 3300027756|Ga0209444_10312090 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
| 3300027759|Ga0209296_1000641 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 29805 | Open in IMG/M |
| 3300027759|Ga0209296_1315043 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 616 | Open in IMG/M |
| 3300027759|Ga0209296_1363719 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 553 | Open in IMG/M |
| 3300027770|Ga0209086_10394067 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 558 | Open in IMG/M |
| 3300027772|Ga0209768_10092745 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1499 | Open in IMG/M |
| 3300027772|Ga0209768_10410568 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 535 | Open in IMG/M |
| 3300027782|Ga0209500_10001489 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 17528 | Open in IMG/M |
| 3300027785|Ga0209246_10379695 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 533 | Open in IMG/M |
| 3300027797|Ga0209107_10042073 | All Organisms → Viruses → Predicted Viral | 2600 | Open in IMG/M |
| 3300027797|Ga0209107_10513146 | Not Available | 530 | Open in IMG/M |
| 3300027798|Ga0209353_10115261 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1209 | Open in IMG/M |
| 3300027798|Ga0209353_10300593 | Not Available | 680 | Open in IMG/M |
| 3300027808|Ga0209354_10226011 | Not Available | 755 | Open in IMG/M |
| 3300027808|Ga0209354_10256355 | Not Available | 702 | Open in IMG/M |
| 3300027808|Ga0209354_10256653 | Not Available | 701 | Open in IMG/M |
| 3300027816|Ga0209990_10067214 | All Organisms → Viruses → Predicted Viral | 1789 | Open in IMG/M |
| 3300027816|Ga0209990_10511900 | Not Available | 506 | Open in IMG/M |
| 3300027832|Ga0209491_10302552 | Not Available | 1236 | Open in IMG/M |
| 3300027892|Ga0209550_10614075 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 636 | Open in IMG/M |
| 3300027892|Ga0209550_10664957 | Not Available | 604 | Open in IMG/M |
| 3300027963|Ga0209400_1010564 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5862 | Open in IMG/M |
| 3300027969|Ga0209191_1152623 | Not Available | 941 | Open in IMG/M |
| 3300028112|Ga0256335_1099222 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 766 | Open in IMG/M |
| 3300028394|Ga0304730_1210870 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 727 | Open in IMG/M |
| (restricted) 3300028557|Ga0247832_1258638 | Not Available | 583 | Open in IMG/M |
| 3300029930|Ga0119944_1031217 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 685 | Open in IMG/M |
| 3300031707|Ga0315291_11223042 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 612 | Open in IMG/M |
| 3300031787|Ga0315900_10860648 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 615 | Open in IMG/M |
| 3300031857|Ga0315909_10071664 | All Organisms → Viruses → Predicted Viral | 3095 | Open in IMG/M |
| 3300031857|Ga0315909_10720086 | Not Available | 644 | Open in IMG/M |
| 3300031873|Ga0315297_10768059 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 805 | Open in IMG/M |
| 3300031951|Ga0315904_10171354 | All Organisms → Viruses → Predicted Viral | 2169 | Open in IMG/M |
| 3300031951|Ga0315904_10264711 | All Organisms → Viruses → Predicted Viral | 1636 | Open in IMG/M |
| 3300031951|Ga0315904_10904917 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 712 | Open in IMG/M |
| 3300031951|Ga0315904_11451380 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
| 3300031963|Ga0315901_10353742 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1195 | Open in IMG/M |
| 3300031963|Ga0315901_10503034 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 944 | Open in IMG/M |
| 3300031963|Ga0315901_11114125 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 541 | Open in IMG/M |
| 3300031999|Ga0315274_11020022 | Not Available | 843 | Open in IMG/M |
| 3300031999|Ga0315274_11546103 | Not Available | 627 | Open in IMG/M |
| 3300031999|Ga0315274_11608736 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 610 | Open in IMG/M |
| 3300031999|Ga0315274_11970436 | Not Available | 526 | Open in IMG/M |
| 3300032046|Ga0315289_10658242 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 960 | Open in IMG/M |
| 3300032050|Ga0315906_10806168 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 735 | Open in IMG/M |
| 3300032092|Ga0315905_11191256 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 623 | Open in IMG/M |
| 3300032092|Ga0315905_11313092 | Not Available | 581 | Open in IMG/M |
| 3300032092|Ga0315905_11350050 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 570 | Open in IMG/M |
| 3300032092|Ga0315905_11450768 | Not Available | 542 | Open in IMG/M |
| 3300032093|Ga0315902_10013724 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 10462 | Open in IMG/M |
| 3300032116|Ga0315903_10213389 | All Organisms → Viruses → Predicted Viral | 1702 | Open in IMG/M |
| 3300032116|Ga0315903_10237466 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1586 | Open in IMG/M |
| 3300032116|Ga0315903_10706956 | Not Available | 752 | Open in IMG/M |
| 3300032118|Ga0315277_11055868 | Not Available | 736 | Open in IMG/M |
| 3300032275|Ga0315270_10390104 | Not Available | 887 | Open in IMG/M |
| 3300032516|Ga0315273_11976223 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 694 | Open in IMG/M |
| 3300033521|Ga0316616_102351824 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 712 | Open in IMG/M |
| 3300033557|Ga0316617_101428704 | Not Available | 695 | Open in IMG/M |
| 3300033993|Ga0334994_0021035 | All Organisms → Viruses → Predicted Viral | 4332 | Open in IMG/M |
| 3300033993|Ga0334994_0346168 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 737 | Open in IMG/M |
| 3300034020|Ga0335002_0531268 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 623 | Open in IMG/M |
| 3300034022|Ga0335005_0439654 | Not Available | 739 | Open in IMG/M |
| 3300034062|Ga0334995_0158027 | All Organisms → Viruses → Predicted Viral | 1627 | Open in IMG/M |
| 3300034066|Ga0335019_0574290 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 663 | Open in IMG/M |
| 3300034066|Ga0335019_0714158 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 574 | Open in IMG/M |
| 3300034071|Ga0335028_0718044 | Not Available | 521 | Open in IMG/M |
| 3300034072|Ga0310127_167620 | Not Available | 849 | Open in IMG/M |
| 3300034081|Ga0373911_099433 | Not Available | 533 | Open in IMG/M |
| 3300034101|Ga0335027_0116885 | All Organisms → Viruses → Predicted Viral | 2007 | Open in IMG/M |
| 3300034101|Ga0335027_0542836 | Not Available | 719 | Open in IMG/M |
| 3300034102|Ga0335029_0784984 | Not Available | 504 | Open in IMG/M |
| 3300034106|Ga0335036_0780177 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
| 3300034116|Ga0335068_0018820 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4273 | Open in IMG/M |
| 3300034118|Ga0335053_0366227 | Not Available | 884 | Open in IMG/M |
| 3300034119|Ga0335054_0423644 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 757 | Open in IMG/M |
| 3300034119|Ga0335054_0775113 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
| 3300034166|Ga0335016_0564214 | Not Available | 628 | Open in IMG/M |
| 3300034272|Ga0335049_0708672 | Not Available | 608 | Open in IMG/M |
| 3300034279|Ga0335052_0457445 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 668 | Open in IMG/M |
| 3300034283|Ga0335007_0818274 | Not Available | 503 | Open in IMG/M |
| 3300034356|Ga0335048_0223478 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1022 | Open in IMG/M |
| 3300034356|Ga0335048_0611088 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 19.65% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 17.30% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 14.66% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 9.97% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 5.57% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.99% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 3.23% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 3.23% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.93% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.76% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.47% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.17% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.17% |
| Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 1.17% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.17% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.88% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.88% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.88% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.88% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.88% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.88% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.59% |
| Meromictic Pond | Environmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond | 0.59% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.59% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.29% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.29% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 0.29% |
| Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.29% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.29% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.29% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.29% |
| Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Marine | 0.29% |
| Marine | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine | 0.29% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.29% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.29% |
| Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 0.29% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002092 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenome | Environmental | Open in IMG/M |
| 3300002145 | S2t7BSb (114f) | Environmental | Open in IMG/M |
| 3300002199 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - JUN 2013 | Environmental | Open in IMG/M |
| 3300002202 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - SEP 2012 | Environmental | Open in IMG/M |
| 3300002206 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - OCT 2012 | Environmental | Open in IMG/M |
| 3300002298 | Freshwater microbial communities from Lake Mendota, WI - 08JUN2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002307 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-C2 co-culture F-D7 | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003395 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300004788 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004792 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004796 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004797 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004807 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 | Environmental | Open in IMG/M |
| 3300004810 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004836 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005417 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005421 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel4S_1600h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007177 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projects | Environmental | Open in IMG/M |
| 3300007321 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007534 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel4S_1600h metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007560 | Estuarine microbial communities from the Columbia River estuary - metaG 1560A-02 | Environmental | Open in IMG/M |
| 3300007670 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3 | Environmental | Open in IMG/M |
| 3300007864 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461B_3.0um | Environmental | Open in IMG/M |
| 3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008263 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-53-LTR | Environmental | Open in IMG/M |
| 3300008264 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-53-LTR | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008339 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Sept 29, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009086 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009559 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 5, Depth 3m; RNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
| 3300009861 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 3, 6m depth; RNA IDBA-UD | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011012 | Marine surface microbial communities from Baltic Sea. Combined Assembly of 24 SPs | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300011381 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel7S_1600h metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
| 3300012706 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES159 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012711 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES133 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012716 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES130 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012721 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES139 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012723 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES129 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012724 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES138 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012725 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES137 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012730 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES126 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012733 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES131 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012734 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES144 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012745 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES017 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012757 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES161 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012758 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130626_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012759 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES158 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012763 | Freshwater microbial communities from Lake Simoncouche, Canada - S_140108_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012773 | Freshwater microbial communities from Lake Simoncouche, Canada - S_140212_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012778 | Freshwater microbial communities from Lake Croche, Canada - C_130208_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012968 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012970 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013074 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES147 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
| 3300013138 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_12m | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300013310 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES153 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300016686 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES143 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016692 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES100 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016695 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES164 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300018665 | Metatranscriptome of marine microbial communities from Baltic Sea - LD30M_ls2 | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020109 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m | Environmental | Open in IMG/M |
| 3300020157 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L224-25m | Environmental | Open in IMG/M |
| 3300020190 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surface | Environmental | Open in IMG/M |
| 3300020221 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100m | Environmental | Open in IMG/M |
| 3300020570 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024352 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_0h | Environmental | Open in IMG/M |
| 3300024481 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024483 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024504 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepA_8d | Environmental | Open in IMG/M |
| 3300024531 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024533 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024537 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024539 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024552 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024554 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024555 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024557 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024562 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024563 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024565 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024566 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024567 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024860 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024862 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025744 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepB_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025760 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026405 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026410 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026562 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026567 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026569 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027131 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8h | Environmental | Open in IMG/M |
| 3300027142 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h | Environmental | Open in IMG/M |
| 3300027151 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_0h | Environmental | Open in IMG/M |
| 3300027337 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8d | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027627 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027712 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027744 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027832 | Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028112 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300028557 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_4m | Environmental | Open in IMG/M |
| 3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
| 3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300034020 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055 | Environmental | Open in IMG/M |
| 3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
| 3300034072 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-A | Environmental | Open in IMG/M |
| 3300034081 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B4A4.3 | Engineered | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| 3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
| 3300034166 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079 | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| 3300034279 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24218J26658_10374651 | 3300002092 | Lentic | MANNAYTTTGSASLGGTVGGAGLVQKAYDRLIEFALRAQPLIRNVADKTPARQSIPGS |
| S2t7BSb_114751312 | 3300002145 | Marine | MANAFTSTGSATLGGTVGAAGLVQKAYDRLLEFALRSEP |
| metazooDRAFT_12448081 | 3300002199 | Lake | MPNAYISTSSSSLGGTAGGAGLVQKAYDRLLEFALRSEPL |
| metazooDRAFT_12403562 | 3300002202 | Lake | MAYVSTDSASLGGTAGGAGLVQKAYDRLLEFALRS |
| metazooDRAFT_13012071 | 3300002206 | Lake | MANDAYVSTSSSSLGGTAGGAGLVQKAYDRLLEFAL |
| B570J29599_10024243 | 3300002298 | Freshwater | MANAYVSTGSSSLGGTAGSAGLVQKAYDRLLEFALRSEPLIRSVA |
| JGI24890J29729_10401921 | 3300002307 | Lentic | MANAYTTTGSSSLGGTVGSAGLVQKAYDRLIEFALRAQPLIRQVADKTPARQSIPGSSVV |
| JGI24890J29729_10487331 | 3300002307 | Lentic | MANAYTTTGSTTLGGTVGGAGLVQKAYDRLIEFALRAQPLIRQVADKTPARQSIPGSSVV |
| JGI24890J29729_10501121 | 3300002307 | Lentic | MANAYTTTGSSTLGGTVGGAGLVQKAYDRLIEFALRAQPLIRQVADKTPARQSIPG |
| B570J29032_1092063231 | 3300002408 | Freshwater | MAYVSTASDSLGGTAGAAGLVQKAYDRLLEFALRS |
| B570J29032_1093715371 | 3300002408 | Freshwater | MPNAYTGVGSSTLGGTAGGAGLVQQAYDRLLEFALRSEPLIRSVADKT |
| B570J40625_1003115473 | 3300002835 | Freshwater | MPNAFISTDSASLGGTAGAAGLVQKAYDRLLEFALRSEPLIRSV |
| B570J40625_1008719582 | 3300002835 | Freshwater | MANAYVSTGSSSLGGTAGGAGLVQKAYDRLLEFALRSEPLIRSVADKRP |
| JGI25908J49247_100185243 | 3300003277 | Freshwater Lake | MANAFTSTGSAXLGGTVGAAGLVQKAYDRLLEFALRSEPLIRSVADKR |
| JGI25908J49247_100577213 | 3300003277 | Freshwater Lake | MANAFTSTGAATLGGTSGSAGLVQQAYDRLLEFALRSEPLIRSVAD |
| JGI25909J50240_10437203 | 3300003393 | Freshwater Lake | MANAFTSTGAATLGGTSGSAGLVQQAYDRLLEFALRSEPLIRSV |
| JGI25909J50240_10904042 | 3300003393 | Freshwater Lake | MANAFTGTGSATLGGTSGSAGLVQQAYDRLLEFALRSEPLIRSVAD |
| JGI25907J50239_10366613 | 3300003394 | Freshwater Lake | MANAFTSTGAATLGGTSGSAGLVQQAYDRLLEFALRSEPLIRSVADKTPARQ |
| JGI25917J50250_11051352 | 3300003395 | Freshwater Lake | MANAYTSSTGNLAGTAGAAGLVQKAYDRLLDFALRSEPLIRSVADKKPTKL |
| Ga0007742_100851452 | 3300004788 | Freshwater Lake | MANAFVSTGASSLGGTSGSAGLVQAAYDRLLEFALRSEPLIRSVADK |
| Ga0007761_100235981 | 3300004792 | Freshwater Lake | MANAFTSTGSATLGGTSGSAGLVQQAYDRLLEFALRSEPLIRSV |
| Ga0007763_100727862 | 3300004796 | Freshwater Lake | MANSYVSTGSSSLGGTAGAAGLVQKAYDRLLEFALRSEPLIRSVADKRPA |
| Ga0007764_115986761 | 3300004797 | Freshwater Lake | MANSYVSTGSSSLGGTAGAAGLVQKAYDRLLEFALRSEPLIRSVADKR |
| Ga0007809_100312953 | 3300004807 | Freshwater | MANAYTNTGSTSLGGTVGAAGLVQKAYDRLIEFALRAQPLVRAVADKT |
| Ga0007757_113990512 | 3300004810 | Freshwater Lake | MANAFTSTGSATLGGTSGSAGLVQQAYDRLLEFALRSEPLIRSVADKT |
| Ga0007759_100466121 | 3300004836 | Freshwater Lake | MANAFTSTGAATLGGTSGSAGLVQQAYDRLLEFALRSEPLIRSVADKT |
| Ga0068884_10638411 | 3300005417 | Freshwater Lake | MPNAYTDTGASSLGGSVGGAGLVQKAYDRLLEFALRSEPLLRSVAD |
| Ga0068882_10023712 | 3300005421 | Freshwater Lake | MSQYTSTASTSLGGTVGGAGLVQKAYDRLLEFALRSEPLLRSVA |
| Ga0068877_105238141 | 3300005525 | Freshwater Lake | MSNQYTSTASTSLGGTVGGAGLVQKAYDRLLEFAL |
| Ga0068876_101331813 | 3300005527 | Freshwater Lake | MANAYTDTSSTSFGGTVGGAGLVQKAYDRLLEFALRSEPLIRSVADKR |
| Ga0068876_104791301 | 3300005527 | Freshwater Lake | MTATTGSSNLGGTAGSAGLVQKAYDRLLEFALRSEPLIRSVADKRPA |
| Ga0068872_100139911 | 3300005528 | Freshwater Lake | MATVNYTTTGSSSLGGTAGAAGLVQKAYDRLLEFALR |
| Ga0049083_101917772 | 3300005580 | Freshwater Lentic | MANAFVSTGASSLGGTSGSAGLVQAAYDRLLEFALRS |
| Ga0049081_100933071 | 3300005581 | Freshwater Lentic | MANAYTGIGSATLGGTSGSAGLVQQAYDRLLEFALRSEP |
| Ga0049080_100519991 | 3300005582 | Freshwater Lentic | MANAYTSSTGNLAGTAGAAGLVQKAYDRLLDFALRSEPLIRSVADKKPTKLANPGST |
| Ga0049080_101288601 | 3300005582 | Freshwater Lentic | MSQFTSTASTSLGGTVGGAGLVQKAYDRLLEFALRSEPLLRSVA |
| Ga0049080_101716861 | 3300005582 | Freshwater Lentic | MSQFISTASTSLGGTVGGAGLVQKAYDRLLEFALRSEPLLRSVA |
| Ga0049080_102319281 | 3300005582 | Freshwater Lentic | MANAYTSSTGNLAGTAGSAGLVQKAYDRLLDFALRSEPLIRSVADKKPTKLAN |
| Ga0049082_100808981 | 3300005584 | Freshwater Lentic | MANAFVSTGASSLGGTSGSAGLVQAAYDRLLEFALRSEPLIRSVADKTP |
| Ga0049082_102807022 | 3300005584 | Freshwater Lentic | MANAFTSTGSATLGGTSGSAGLVQQAYDRLLEFALRSEPLIRSVADKTPARQSIP |
| Ga0078894_110660301 | 3300005662 | Freshwater Lake | MSNQYTDTSSTSLGGNVGGAGLVQKAYDRLLEFALRAEPLIRSVADKRPA |
| Ga0079957_10971201 | 3300005805 | Lake | MSQYTSTASTSLGGTAGGAGLVQKAYDRLLEFALRSEPLLRSVADKRP |
| Ga0079957_12980662 | 3300005805 | Lake | MSQYTSTASTSLGGTVGGAGLVQKAYDRLLEFALRSEPLLRSVADKR |
| Ga0079957_13012262 | 3300005805 | Lake | MSQYTSTASTSLGGTAGGAGLVQKAYDRLLEFALRSEPLLRSVADK |
| Ga0070749_104769601 | 3300006802 | Aqueous | MSNQYTSTASTSLGGTVGGAGLVQKAYDRLLEFALR |
| Ga0075464_106993343 | 3300006805 | Aqueous | MANAYTSSTGNLAGTAGGAGLVQKAYDRLLDFALRSEPLIRSVADKKPAKLANPGS |
| Ga0075464_110670122 | 3300006805 | Aqueous | MANAYTTTGSASLGGTVGGAGLVQKAYDRLIEFALRAQPLIRSVADKT |
| Ga0075473_100514133 | 3300006875 | Aqueous | MANAYTTTGSSSLGGTAGGAGLVQKAYDRLLEFALRSEPLIRSVADKRPA |
| Ga0102978_10075173 | 3300007177 | Freshwater Lake | VAKLANEYISTASTSLGGTVGGAGLVQKAYDRLLEFALRDTPLIRAVADKRPARQSIP |
| Ga0102692_10022352 | 3300007321 | Freshwater Lake | MSNAYTDTGASSLGGTVSGADLVQKAYDRLLEFALRSEPL |
| Ga0102692_11665181 | 3300007321 | Freshwater Lake | MPTVNYTTTGSSSLGGTAGSAGLVQKAYDRLLEFALRSEPLIRSVADKRP |
| Ga0102692_15740701 | 3300007321 | Freshwater Lake | MANAYTDTSSTSFGGTVGGAGLVQKAYDRLLEFALRSEPLIRSVADK |
| Ga0075458_100961611 | 3300007363 | Aqueous | MANTYVSTGSSSLGGTAGAAGLVQKAYDRLLEFALRSEPLIRSVADKRPA |
| Ga0102690_17231651 | 3300007534 | Freshwater Lake | MSNQYTSTASTSLGGPVGGERIVQKAYDRLLEFALRS |
| Ga0099851_11247413 | 3300007538 | Aqueous | MAYTDTSSTSLGGTVGGAGLVQKAYDRLLEFALRAEPLIRSVADKTPARQSIPGS |
| Ga0099848_10151795 | 3300007541 | Aqueous | MANAFTDTSSNSLGGTVGAAGLVQKAYDRLLEFALRS |
| Ga0102913_11681601 | 3300007560 | Estuarine | MANAYTSSTGNLAGTAGGAGLVQKAYDRLLDFALRSEPLIRSVADKKPTKL |
| Ga0102862_10435993 | 3300007670 | Estuarine | MANAYESTASDSLGGTMGSAGLVQKAYDRLLEFALRSEPLIRSVADK |
| Ga0105749_10743782 | 3300007864 | Estuary Water | MANAFTSTGSATLGGSSGGAGLVQQAYDRLLEFALRSE |
| Ga0105745_11371911 | 3300007972 | Estuary Water | MSNAYTDTGASSLGGSVGGAGLVQKAYDRLLEFALRS |
| Ga0105746_11356982 | 3300007973 | Estuary Water | MANAYTSSTGNLAGTAGGAGLVQKAYDRLLDFALRSEPLIRSVADKKPAKLANPGSTVVL |
| Ga0108970_116003181 | 3300008055 | Estuary | MANAYTSSTGNLAGTAGAAGLVQKAYDRLLDFALRSEPLIRSVADK |
| Ga0114340_11416931 | 3300008107 | Freshwater, Plankton | MAYVSTASDNLGGTAGGAGLVQKAYDRLLEFALRSEPLIRSVADKRPARQ |
| Ga0114340_12682191 | 3300008107 | Freshwater, Plankton | MPTVNYTTTGSSSLGGTAGSAGLVQKAYDRLLEFALRSEPLIRS |
| Ga0114344_11532982 | 3300008111 | Freshwater, Plankton | MANSYVSTGSSSLGGTAGAAGLVQKAYDRLLEFALRSEPLIRS |
| Ga0114347_10853563 | 3300008114 | Freshwater, Plankton | MANAYTSTGSSTLGGTVGAAGLVQKAYDRLLEFAQIQ* |
| Ga0114350_11838602 | 3300008116 | Freshwater, Plankton | MAYVSTDSASLGGTAGGAGLVQKAYDRLLEFALRSEPLIRSVADK |
| Ga0114351_13011302 | 3300008117 | Freshwater, Plankton | LPNAYTDTGASSLGGSVGGAGLVQKAYDRLLEFALRSEPLIRSVAD |
| Ga0114355_10603973 | 3300008120 | Freshwater, Plankton | MPNAYTDTGSTSLGGTTGGAGLVQKAYDRLLEFALRSE |
| Ga0114349_11102633 | 3300008263 | Freshwater, Plankton | MSNQYTSTASTSLGGTVGGAGLVQKAYDRLLEFALRSEPLLRSV |
| Ga0114353_12715332 | 3300008264 | Freshwater, Plankton | MSNQYTSTASTSLGGTVGGAGLVQKAYDRLLEFALRSEPLIRSV |
| Ga0114363_11777762 | 3300008266 | Freshwater, Plankton | MAYVSTASDNLGGTAGGAGLVQKAYDRLLEFALRSEPLIRSVADKRP |
| Ga0114363_12442292 | 3300008266 | Freshwater, Plankton | MPNAYTDTSSTSLGGTVGAAGLVQKAYDRLLEFALRSEPLLR |
| Ga0114878_10415203 | 3300008339 | Freshwater Lake | MAYTDTSSGSLGGTVGGAGLVQKAYDRLLEFALRSEPLIRSVADKRPARQA |
| Ga0114880_12196052 | 3300008450 | Freshwater Lake | MANAYTGIGSSTLGGTAGGAGLVQQAYDRLLEFALRSEPLIRSVADKTPARQS |
| Ga0114973_1000051342 | 3300009068 | Freshwater Lake | MANAYTASNGNLAGTAGGAGLVQKAYDRLLDFALRSEPLIRSVADKRPAKLA |
| Ga0114973_100009131 | 3300009068 | Freshwater Lake | MANAYTSSTGNLAGTAGGAGLVQKAYDRLLDFALR |
| Ga0102812_103573652 | 3300009086 | Estuarine | MANAYVSTASDSLGGTMGSAGLVQKAYDRLLEFALRSEPLIRSVADKRPA |
| Ga0114963_102720453 | 3300009154 | Freshwater Lake | MANAYTTTGSSTLGGTVGSAGLVQKAYDRLIEFALRAQPLIRQVADKTPARQ |
| Ga0114968_104068371 | 3300009155 | Freshwater Lake | MANAYSSTGSSTLGGTAGGAGLVQTAYDRLLEFALRSEPLIRSVADKRPAK |
| Ga0114968_107635902 | 3300009155 | Freshwater Lake | MANAYVSSDSASLGGTVGSAGLVQKAYDRLLEFALRSEPLIRSVADK |
| Ga0114981_100895111 | 3300009160 | Freshwater Lake | MANAYVSTDTASLGGTAGSAGLVQKAYDRLVEFALR |
| Ga0114981_105724981 | 3300009160 | Freshwater Lake | MANAYTTTGSASLGGTIGGAGLVQKAYDRLIEFALRAQPLIRSV |
| Ga0114970_107114311 | 3300009163 | Freshwater Lake | MANAYVNAGSSSLGGTAGGAGLVQKAYDRLLEFALRSEPLIR |
| Ga0114975_104323362 | 3300009164 | Freshwater Lake | MANAYTDTSSTSFGGTVGGAGLVQKAYDRLLEFALRS |
| Ga0114975_106066842 | 3300009164 | Freshwater Lake | MANSYVSTDSASLGGTAGGAGLVQKAYDRLLEFALRSEPLIRSVADKR |
| Ga0105102_101093191 | 3300009165 | Freshwater Sediment | MSNAYTSTGSTTLGGTVGVASLVQKAYDRLLEFALRAEPLSRS |
| Ga0105102_102497071 | 3300009165 | Freshwater Sediment | MSNAYTSTGSATLGGTVGGAGLVQKAYDRLLEFAL |
| Ga0105097_101989443 | 3300009169 | Freshwater Sediment | MAFTDTSSNSLGGTVGGAGLVQKAYDRLLEFALRSEPLI |
| Ga0114979_104993701 | 3300009180 | Freshwater Lake | MAYVSTASDNLGGTAGGAGLVQKAYDRLLEFALRSEPLIRSVADKRPAKQA |
| Ga0114969_101325963 | 3300009181 | Freshwater Lake | MANAYSSTGSATLGGTAGAAGLVQTAYDRLLEFALRSEPLIRSVADKRP |
| Ga0114969_104789362 | 3300009181 | Freshwater Lake | MANAYVTAGSSSLGGTAGSAGLVQKAYDRLLEFALRSEPLIRSVADKR |
| Ga0114969_105206922 | 3300009181 | Freshwater Lake | MANAYTSSSGNLAGTAGGAGLVQKAYDRLLDFALRSEPL |
| Ga0114959_103621452 | 3300009182 | Freshwater Lake | MANAYSSTGSSTLGGTAGAAGLVQTAYDRLLEFALRSEPLIRSVADKRPAKQA |
| Ga0114974_100514984 | 3300009183 | Freshwater Lake | MANAYTSSSGNLAGTAGAAGLVQKAYDRLLDFALRS |
| Ga0114974_106247022 | 3300009183 | Freshwater Lake | MANAYVTTGSSSLGGTAGSAGLVQKAYDRLLEFALRSEPLIRSVADK |
| Ga0130029_10131682 | 3300009559 | Meromictic Pond | MANAYTDTSSGSFGGTVGGAGLVQKAYDRLLEFALRSEPLIRSVA |
| Ga0114958_103554972 | 3300009684 | Freshwater Lake | MANAYTTTGSASLGGTVGGAGLVQKAYDRLIEFALRAQPLIRSVSDKTPAKQSIPGSS |
| Ga0132184_1007242 | 3300009861 | Meromictic Pond | MANAYTDTSSGSFGGTVGGAGLVQKAYDRLLEFALRSEPLIRSVADK |
| Ga0114964_101027813 | 3300010157 | Freshwater Lake | MANAYSSTGSSPLGGTAGAAGLVQTAYDRLLEFAL |
| Ga0114964_101509513 | 3300010157 | Freshwater Lake | MANSYVSTDSASLGGTAGGAGLVQKAYDRLLEFALRS |
| Ga0114960_101900073 | 3300010158 | Freshwater Lake | MANAYVSTDSASLGGTAGGAGLVQKAYDRLLEFALRSEPL |
| Ga0114960_102099683 | 3300010158 | Freshwater Lake | MANAYTTTGSASLGGTVGSAGLVQKAYDRLIEFALRAQPLIRQVADKT |
| Ga0114960_103221702 | 3300010158 | Freshwater Lake | MANAYTTTGSSSLGGTVGGAGLVQKAYDRLIEFALRAQPLIRSVADKTPARQSIPGS |
| Ga0114960_104235931 | 3300010158 | Freshwater Lake | MANAYSSTGSSTLGGTAGAAGLVQTAYDRLLEFALRSEPL |
| Ga0114960_104688762 | 3300010158 | Freshwater Lake | MANAYTTTGSSTLGGTVGGAGLVQKAYDRLIEFALRTQPLIRQVADKTPARQS |
| Ga0114967_104436582 | 3300010160 | Freshwater Lake | MANAYTSSTGNLAGTAGGAGLVQKAYDRLLDFALRSEPLIRSV |
| Ga0129345_10668883 | 3300010297 | Freshwater To Marine Saline Gradient | MANAFTDTSSNSLGGTVGAAGLVQKAYDRLLEFALRSEPLLRS |
| Ga0136644_100978851 | 3300010334 | Freshwater Lake | MANAYTTTGSSTLGGTAGGAGLVQKAYDRLLEFALRSEPLIRSVADKR |
| Ga0136644_104238862 | 3300010334 | Freshwater Lake | MANAYVSTDSASLGGTAGGAGLVQKAYDRLLEFALRSEPLIRSV |
| Ga0129333_100253805 | 3300010354 | Freshwater To Marine Saline Gradient | MANVFTSTTAPGGTAGGAGLVQKAYDRLLEFALRSEPLIRSV |
| Ga0129333_107420451 | 3300010354 | Freshwater To Marine Saline Gradient | MSNQYTSTASTSLGGSVGGAGLVQKAYDRLLEFALRSEPLLR |
| Ga0129333_112054051 | 3300010354 | Freshwater To Marine Saline Gradient | MSNQYTSTASTSLGGSVGGAGLVQKAYDRLLEFALRSEPLLRS |
| Ga0133913_1001885419 | 3300010885 | Freshwater Lake | MANAYTTTGSASLGGTVGGAGLVQKAYDRLIEFALRAQPLIRSVADKTPARQSIPGS |
| Ga0133913_100461631 | 3300010885 | Freshwater Lake | MANAYTTTGSTSLGGTVGGAGLVQKAYDRLIEFALRAQPLIR |
| Ga0133913_100561621 | 3300010885 | Freshwater Lake | MANAYTTTGSASLGGTVGSAGLVQKAYDRLIEFALRAQPLIRQVADKTPARQSIPGSSV |
| Ga0133913_102387581 | 3300010885 | Freshwater Lake | MANAYVSSDSASLGGTVGSAGLVQKAYDRLLEFALRSEP |
| Ga0133913_107629884 | 3300010885 | Freshwater Lake | MANAYTTTGTASLGGTVGGAGLVQKAYDRLIEFALRAQPLIRSVADKTPARQSIPG |
| Ga0133913_110333721 | 3300010885 | Freshwater Lake | MANAYTTTGSASLGGTVGGAGLVQKAYDRLIEFALRAQPLIRSVS |
| Ga0150979_15891742 | 3300011012 | Marine | MANAFTSTGSASLGGTVGAAGLVQKAYDRLLEFALRSEPLIRSVADKRPARQ |
| Ga0151620_11327611 | 3300011268 | Freshwater | MANAYTSSTGNLAGTAGGAGLVQKAYDRLLDFALRSEPLIRSVADKKPAKLA |
| Ga0102688_16677331 | 3300011381 | Freshwater Lake | MANAYTSTASTSLGGSVGGAGLVQKAYDRLLEFALRSEPLIRSVADK |
| Ga0153799_10006679 | 3300012012 | Freshwater | MANAFISTDSASLGGTVGAAGLVQKAYDRLLEFALRSEPLLRSVADKRPA |
| Ga0153805_10050133 | 3300012013 | Surface Ice | MSQFTSTASTSLGGTVGGAGLVQKAYDRLLEFALRSEPLLRSVADKRPA |
| Ga0157627_10381792 | 3300012706 | Freshwater | MANAYVSTGSSSLGGTAGSAGLVQKAYDRLLEFALRLEPLIRSVADKRPARQAIP |
| Ga0157627_12197371 | 3300012706 | Freshwater | MPNAYTGTGSSTLGGTAGGAGLVQQAYDRLLEFALRS |
| Ga0157607_12406762 | 3300012711 | Freshwater | MPNAYTSTGSTSLGGTVGGAGLVQKAYDRLLEFALRAEPLIRSVADKTPAQQSIPGST |
| Ga0157605_10232082 | 3300012716 | Freshwater | MANAYTTTGSNSLGGTVGGAGLVQKAYDRLVEFALRAQPLIRSAADKTPARQ |
| Ga0157612_10291361 | 3300012721 | Freshwater | MPNAYTGEGSTTLGGTAGGADLVQQAYDRLLEFALRSEPLIRSVADKTPARQS |
| Ga0157604_11093352 | 3300012723 | Freshwater | MPNAYTSTGSTTLGGTVGGAGLVQKAYDRLLEFALRAEPLIRSV |
| Ga0157604_12437381 | 3300012723 | Freshwater | TGSTSLGGTVGGAGLVQKAYDRLLEFALRAEPLIRSVAD* |
| Ga0157611_10689961 | 3300012724 | Freshwater | MPNAYTGTGSSTLGGTAGGAGLVQQAYDRLLEFALRSEPLIRSVADKTP |
| Ga0157610_11448451 | 3300012725 | Freshwater | MANAYVSTGSSSLGGTAGGAGLVQKAYDRLLEFALRSEPLI |
| Ga0157602_11486922 | 3300012730 | Freshwater | MANAYTDTSSTSLGGTVGGAGLVQKAYDRLLEFALRSE |
| Ga0157606_10682762 | 3300012733 | Freshwater | MPNAYTGTGSSTLGGTAGGAGLVQQAYDRLLEFALRSEPLIRSVADKTPARQS |
| Ga0157615_13820801 | 3300012734 | Freshwater | MPNAYTSTGSTSLGGTVGGAGLVQKAYDRLLEFALRAEPLIRSVADKTPAQQSIP |
| Ga0157532_1362212 | 3300012745 | Freshwater | MANAYTGTGSSTLGGTSGSAGLVQQAYDRLLEFALRSEPLIRSVA |
| Ga0157628_11693031 | 3300012757 | Freshwater | MSNQYTDTSSNSLGGTVGGAGLVQKAYDRLLEFALRAEPLIRSVADKTPAQQSIPGSTV |
| Ga0138285_10638692 | 3300012758 | Freshwater Lake | LATQYTSTDSASLGGTAGSAGLVQKAYDKFIEFALRDEPLIRAVADKRPVNQ |
| Ga0157626_11312792 | 3300012759 | Freshwater | MANAYTSTGSSTLGGTSGGAGLVQQAYDRLLEFALRAEPLIRSVADKTPARQSIP |
| Ga0157626_11589812 | 3300012759 | Freshwater | MANAYTTTGSNSLGGTVGGAGLVQKAYDRLVEFALRAQPLIRSVADKTPARQ |
| Ga0138289_11643281 | 3300012763 | Freshwater Lake | MANAYVSSDSASLGGTVGSAGLVQKAYDRLLEFAL |
| Ga0138290_12472212 | 3300012773 | Freshwater Lake | MANAYTSSTGNLAGTAGAAGLVQKAYDRLLDFALRSEPLIRAVSDKKPAKLA |
| Ga0138269_12483491 | 3300012778 | Freshwater Lake | MANAYSSTGSSTLGGTAGGAGLVQTAYDRLLEFALRS |
| Ga0129337_10038073 | 3300012968 | Aqueous | MANAYVSTDSASLGGTAGAAGLVQKAYDRLLEFALRSEPLIRSVADKRPARQTQ |
| Ga0129338_12103651 | 3300012970 | Aqueous | MANVFTSTTAPGGTAGGAGLVQKAYDRLLEFALRSEPL |
| Ga0129338_12700062 | 3300012970 | Aqueous | MPNAYTDTGSSSLGGTTGGAGLVQKAYDRLLEFALRSEPLLRSVADKRP |
| Ga0164293_100241645 | 3300013004 | Freshwater | MANAYVSTASNSLGGTVGAAGLVQKAYDRLIEFALRAQ |
| Ga0164293_102897683 | 3300013004 | Freshwater | MPNAYTGVGSATLGGTAGGAGLVQQAYDRLLEFALRSEPLIRSVADKTPARQS |
| Ga0164293_108918191 | 3300013004 | Freshwater | MANAYVSTGSSSLGGTAGSAGLVQKAYDRLLEFALRSEPLIRS |
| Ga0164292_103014903 | 3300013005 | Freshwater | MANAYTSTGSTSLGGTVGGAGLVQKAYDRLLEFALRAEPLIRSVADKTPAQQSIPGSTVV |
| Ga0157618_10579491 | 3300013074 | Freshwater | MSNQYTDTSSTSLGGTVGGAGLVQKAYDRLLEFALRSEPLIRSVADKRP |
| Ga0157618_10787452 | 3300013074 | Freshwater | MANAYTDTASTSLGGTVGGAGLVQKAYDRLLEFALRSEPLIRSVADKRPAKQ |
| (restricted) Ga0172373_100303121 | 3300013131 | Freshwater | MSNQYTSTASTSLGGTVGGAGLVQKAYDRLLEFALRSEPLL |
| (restricted) Ga0172372_104939381 | 3300013132 | Freshwater | MANLYTSTASTSLGGTVGGAGLVQKAYDRLLEFALRSEPLLR |
| (restricted) Ga0172372_106090662 | 3300013132 | Freshwater | MANAYVSTGSASLGGTAGSAGLVQKAYDRLLEFALRSEPLIRAVADKRP |
| (restricted) Ga0172371_105745102 | 3300013138 | Freshwater | MANAFTDTSSNSLGGTVGAAGLVQKAYDRLLEFALRSEPLLRSVADKRPA |
| Ga0170791_117253231 | 3300013295 | Freshwater | MTQSYVSTDSASLGGTAGGAGLVQKAYDRLLEFALRSEPLIRSVADKRPA |
| Ga0170791_137442492 | 3300013295 | Freshwater | MANAYTGTGSSTLGGTAGSAGLVQQAYDRLLEFALRSEPL |
| Ga0157622_10558702 | 3300013310 | Freshwater | MANAYTTTGSNSLGGTVGGAGLVQKAYDRLVEFALRAQPLI |
| (restricted) Ga0172376_1000520813 | 3300014720 | Freshwater | MSQYTSTASTSLGGTVGGAGLVQKAYDRLLEFALRSEPLLRSVADKRP |
| Ga0180056_11034122 | 3300016686 | Freshwater | MATVNYTTTGSSSLGGTAGAAGLVQKAYDRLLEFALRSE |
| Ga0180040_10142922 | 3300016692 | Freshwater | MSNNAYTSTGSSSLGGTVGSAGLVQKAYDRLIEFQLRATPLIR |
| Ga0180059_11094962 | 3300016695 | Freshwater | MANAYTDTASTSLGGTVGGAGLVQKAYDRLLEFALRS |
| Ga0181364_10198211 | 3300017701 | Freshwater Lake | MANAFVSTGSSSLGGTSGSAGLVQAAYDRLLEFALRSEPLIRSVADKTPARQ |
| Ga0181364_10420251 | 3300017701 | Freshwater Lake | MANAFTSTGSATLGGTSGSAGLVQQAYDRLLEFALRSEPLIRSVADKTPAR |
| Ga0181364_10756572 | 3300017701 | Freshwater Lake | MANAFTSTGSATLGGTSGSAGLVQQAYDRLLEFALRS |
| Ga0181350_10521811 | 3300017716 | Freshwater Lake | MANAFTSTGSATLGGTSGSAGLVQQAYDRLLEFAL |
| Ga0181347_11705512 | 3300017722 | Freshwater Lake | MAFVSTASDNLGGTAGSAGLVQKAYDRLLEFALRSEPLIRSVADK |
| Ga0181347_12084562 | 3300017722 | Freshwater Lake | MANAYTSSTGNLAGTAGAAGLVQKAYDRLLDFALRSEPLIRSVADKKP |
| Ga0181365_10900282 | 3300017736 | Freshwater Lake | MANAFTSTGSATLGGTSGSAGLVQQAYDRLLEFALRSEPLIRSVADKTPARQS |
| Ga0181356_11494621 | 3300017761 | Freshwater Lake | MANAFTSTGSATLGGTSGSAGLVQQAYDRLLEFALRSEPLIRSVADKTPA |
| Ga0181358_12469912 | 3300017774 | Freshwater Lake | MANAFVSTGASSLGGTSGSAGLVQAAYDRLLEFALRSEPLIRSVADKTPAR |
| Ga0181357_11666801 | 3300017777 | Freshwater Lake | MANAFTSTGAATLGGTSGSAGLVQQAYDRLLEFALRSEPLIRSVADK |
| Ga0181357_11685762 | 3300017777 | Freshwater Lake | MANAFTDATSASLGGTVGSAGLVQKAYDRLLEFALRSEPLIRSVADK |
| Ga0181349_11758061 | 3300017778 | Freshwater Lake | MANAFTSTGAATLGGTSGSAGLVQQAYDRLLEFALRSEPLIRSVADKTPARQS |
| Ga0181346_11933831 | 3300017780 | Freshwater Lake | MSQFTSTASTSLGGTVGGAGLVQKAYDRLLEFALRSEPLLRSVADKRPAR |
| Ga0181346_12755432 | 3300017780 | Freshwater Lake | MANAFTSTGSATLGGTSGGAGLVQQAYDRLLEFALRSEPLIRSVADKTPAHQSITR |
| Ga0181348_10399961 | 3300017784 | Freshwater Lake | MANAFTSTGSASLGGTVGAAGLVQKAYDRLLELALRPEPLIR |
| Ga0181348_13304442 | 3300017784 | Freshwater Lake | MANAFTSTGAATLGGTSGSAGLVQQAYDRLLEFALRSEP |
| Ga0181355_12345822 | 3300017785 | Freshwater Lake | MSNQYTSTASTSLGGSVGGAGLVQKAYDRLLEFALRSEPLI |
| Ga0181355_12622982 | 3300017785 | Freshwater Lake | MANAFVSTGASSLGGTSGSAGLVQAAYDRLLEFALRSEP |
| Ga0181355_13489901 | 3300017785 | Freshwater Lake | MANAYVSTASDSLGGTMGSAGLVQKAYDRLLEFALRSEPLIRSV |
| Ga0188882_10126221 | 3300018665 | Freshwater Lake | MAYVSTDSGSLGGTAGGAGLIQKAYDRLLEFALRSEPLIRSV |
| Ga0181359_10110561 | 3300019784 | Freshwater Lake | MANAFTSTGSATLGGTSGSAGLVQQAYDRLLEFALRSEPLIRSVA |
| Ga0181359_10292283 | 3300019784 | Freshwater Lake | MANAFTSTGSATLGGTSGGAGLVQQAYDRLLEFALRSEPLIRSVAD |
| Ga0181359_10528811 | 3300019784 | Freshwater Lake | MANLYTSSTGNLAGTAGAAGVVQKAYDRLLDFALRSEPLIRSVADKRPAKLANPG |
| Ga0181359_12094751 | 3300019784 | Freshwater Lake | MANAFVSTGASSLGGTSGSAGLVQAAYDRLLEFALRSEPLIRSVAD |
| Ga0194112_100402851 | 3300020109 | Freshwater Lake | MANAYVSTNSASLGGTAGAAGLVQKAYDRLLEFALRSEPLIRSV |
| Ga0194049_11141481 | 3300020157 | Anoxic Zone Freshwater | MANAYTSSTGNLAGTAGGAGLVQKAYDRLLDFALRSEP |
| Ga0194118_100662521 | 3300020190 | Freshwater Lake | MANAYVSTNSASLGGTAGAAGLVQKAYDRLLEFALRSEPLIRSVAD |
| Ga0194127_105509701 | 3300020221 | Freshwater Lake | MANAYVSTNSASLGGTAGAAGLVQKAYDRLLEFALRSEPLI |
| Ga0208465_10057871 | 3300020570 | Freshwater | MPNAFISTDSASLGGTAGAAGLVQKAYDRLLEFALR |
| Ga0213920_10918271 | 3300021438 | Freshwater | MANAYTTTGSTSLGGTVGGAGLVQKAYDRLIEFALRAQPLI |
| Ga0222713_100984154 | 3300021962 | Estuarine Water | MAYTDTSSGSLGGTVGGAGLVQKAYDRLLEFALRSEPLIRSVADK |
| Ga0222713_102054601 | 3300021962 | Estuarine Water | MANAYTSSSGNLAGTAGGAGLVQKAYDRLLDFALRSEPLIRSVADKKPAKLANPGSTV |
| Ga0222713_102114933 | 3300021962 | Estuarine Water | MANAYTSSTGNLAGTAGGAGLVQKAYDRLLDFALRSEPLIRSVADKKPAK |
| Ga0222713_105803832 | 3300021962 | Estuarine Water | MANAFTSTGSSTLGGTAGAAGLVQKAYDRLLEFALRSEPLIRSVA |
| Ga0222713_106395332 | 3300021962 | Estuarine Water | MANAYTSSTGNLAGTAGGAGLVQKAYDRLLDFALRSEPLIRSVADKRPTKLANP |
| Ga0181353_11087331 | 3300022179 | Freshwater Lake | MANSYVSTGSSSLGGTAGAAGLVQKAYDRLLEFALRSEPLIRSVADKRPAR |
| Ga0181354_11980131 | 3300022190 | Freshwater Lake | MANAYTSSTGNLAGTAGAAGLVQKAYDRLLDFALRSEPLIRSVADKRPTK |
| Ga0181354_12023172 | 3300022190 | Freshwater Lake | MPNAYTDTGASSLGGSVGGAGLVQKAYDRLLEFALRSEPLLRSVA |
| Ga0181354_12097681 | 3300022190 | Freshwater Lake | MANAYTSSTGNLAGTAGAAGLVQKAYDRLLDFALR |
| Ga0181354_12463092 | 3300022190 | Freshwater Lake | MANAYTSSTGNLAGTAGAAGLVQKAYDRLLDFALRS |
| Ga0196901_11318561 | 3300022200 | Aqueous | MAYVSTDSGSLGGTAGGAGLVQKAYDRLLEFALRSEPLIR |
| Ga0196901_12397372 | 3300022200 | Aqueous | MANAFTDTSSGSFGGTVGGAGLVQKAYDRLLEFALRSEPLLR |
| Ga0214917_100082161 | 3300022752 | Freshwater | MANAYVSTGSSSLGGTAGAAGLVQKAYDRLLEFALRSEPLIRSVADK |
| Ga0214917_100118725 | 3300022752 | Freshwater | MANAYSSTGSSTLGGTAGGAGLVQTAYDRLLEFALRSE |
| Ga0214921_105610782 | 3300023174 | Freshwater | MANAYTASNGNLAGTAGGAGLVQKAYDRLLDFALRSEPLIRSVA |
| Ga0214923_100642804 | 3300023179 | Freshwater | MATYTGTNAYTGTGSGTLGGTTGSAGLVQQAYDRLLEFALRAQPLIRDVADKKPV |
| Ga0214923_103799202 | 3300023179 | Freshwater | MPNAYTSTGSTSLGGTVGGAGLVQKAYDRLLEFALRSEPLIRS |
| Ga0244775_111631002 | 3300024346 | Estuarine | MANAYTSSTGNLAGTAGAAGLVQKAYDRLLDFALRSEPLIRSVADKKPTKLANPGSTVV |
| Ga0255142_10622451 | 3300024352 | Freshwater | MANAYVSTGSSSLGGTAGAAGLVQKAYDRLLEFALRSEPLIRSVADKRP |
| Ga0256330_10681332 | 3300024481 | Freshwater | MANAYTTTGSSSLGGTAGGAGLVQKAYDRLLEFALRSEPLIRSVAD |
| Ga0255224_11319771 | 3300024483 | Freshwater | MANSYVSTGSSSLGGTAGAAGLVQKAYDRLLEFALRSEPLIRSVADKRPAKQA |
| Ga0255179_10385182 | 3300024504 | Freshwater | LATNYTSTDSASLGGTAGSAGLVQKAYDKMIEFALRD |
| Ga0255228_10568272 | 3300024531 | Freshwater | MPNAYTDTSSGSFGGTVGGAGLVQKAYDRLLEFALRSEPLIRSVADKRPARQ |
| Ga0255228_10664282 | 3300024531 | Freshwater | MANAYTSSTGNLAGTAGGAGLVQKAYDRLLDFALRS |
| Ga0256299_10599012 | 3300024533 | Freshwater | MANAYTGIGSTTLGGTTGGAGLVQQAYDRLLEFALRSEPLIRSVAD |
| Ga0256299_10891581 | 3300024533 | Freshwater | MANAYTSSTGNLAGTAGAAGLVQKAYDRLLDFALRSEPLIRSVADKKPTKLANP |
| Ga0255225_10432081 | 3300024537 | Freshwater | MPNAYTDTSSGSFGGTVGGAGLVQKAYDRLLEFALRSEPLIRS |
| Ga0255231_10588991 | 3300024539 | Freshwater | MANAFTSTGSATLGGTVGGAGLVQKAYHRLLEFALRSEPLLRS |
| Ga0256345_11155202 | 3300024552 | Freshwater | MANAYVTTGSSSLGGTAGGAGLVQKAYDRLLEFAL |
| Ga0255242_10428913 | 3300024554 | Freshwater | MANAFTSTGSATLGGTVGGAGLVQKAYDRLLEFALRSEP |
| Ga0255280_10843711 | 3300024555 | Freshwater | MANAYVSTGSSSLGGTAGAAGLVQKAYDRLLEFAL |
| Ga0255283_11256392 | 3300024557 | Freshwater | MPNAYTDTSSTSLGGSVGGAGLVQKAYDRLLEFALRSEPLIRSVADKRP |
| Ga0256336_10685131 | 3300024562 | Freshwater | MANAYVSTGSSSLGGTAGAAGLVQKAYDRLLEFALRSEPLIRSVADKRPARQTQ |
| Ga0255236_10784862 | 3300024563 | Freshwater | MANAYTDTSSTSFGGTVGGAGLVQKAYDRLLEFALRSEPLIRSVADKRPAK |
| Ga0255273_11461972 | 3300024565 | Freshwater | MANAYVSTGSSSLGGTAGAAGLVQKAYDRLLEFALRSEPLIRSVADKRPARQSI |
| Ga0256309_11007592 | 3300024566 | Freshwater | MAYVSTDSASLGGTAGGAGLVQKAYDRLLEFALRSEPLIRSVADKRPA |
| Ga0256307_10897802 | 3300024567 | Freshwater | MANAYTDTSSGSFGGTVGGAGLVQKAYDRLLEFALRSE |
| Ga0256344_10800242 | 3300024860 | Freshwater | MANAYVSTGSSSLGGTAGAAGLVQKAYDRLLEFALR |
| Ga0256317_10716332 | 3300024862 | Freshwater | MANAYTGIGSATLGGTSGSAGLVQQAYDRLLEFALRSEPLIRSVADKTP |
| Ga0256317_10824172 | 3300024862 | Freshwater | MANAYTSSTGNLAGTAGAAGLVQKAYDRLLDFALRSEPLIRSVADKRPAKLANP |
| Ga0208147_10631143 | 3300025635 | Aqueous | MANAYTSTGSSTLGGTANAAGLVQKAYDRLLEFALRSEPLIRSVADKRP |
| Ga0208161_11407561 | 3300025646 | Aqueous | MANAFTDTSSGSFGGTVGGAGLVQKAYDRLLEFAL |
| Ga0208795_10765243 | 3300025655 | Aqueous | MAYTDTSSTSLGGTVGGAGLVQKAYDRLLEFALRAEPLIRSVADKT |
| Ga0255245_10275272 | 3300025744 | Freshwater | MANAFVSTGASSLGGTSGSAGLVQAAYDRLLEFAL |
| Ga0255249_10530712 | 3300025760 | Freshwater | MANAFVSTSSSSLGGTSGSAGLVQAAYDRLLEFALRSEPLIRSVADKTPAR |
| Ga0208542_10877543 | 3300025818 | Aqueous | MANVFTSTTTPGGTAGGAGLVQKAYDRLLEFALRSEPLIRSVADKR |
| Ga0208916_101308103 | 3300025896 | Aqueous | MANAYTSSTGNLAGTAGGAGLVQKAYDRLLDFALRSEPLIRS |
| Ga0256296_10230272 | 3300026405 | Freshwater | MANAYTDTSSGSFGGTVGGAGLVQKAYDRLLEFALLSEPLIRSVADK |
| Ga0256325_10518191 | 3300026410 | Freshwater | MANAFVSTASDNLGGTAGSAGLVQKAYDRLLEFALRSEPLIRS |
| Ga0255285_10789432 | 3300026562 | Freshwater | MPNSYVSTDSASLGGTAGAAGLVQKAYDRLLEFALRSEPL |
| Ga0256303_10668122 | 3300026567 | Freshwater | MANAFTSTGSATLGGTVGGAGLVQKAYDRLLEFALRSEPLLRSVADKRPAR |
| Ga0255277_11189002 | 3300026569 | Freshwater | MPNAYTSTASTSLGGSVGGAGLVQKAYDRLLEFALRS |
| Ga0255066_10574271 | 3300027131 | Freshwater | MANAYTSSGSSTLGGTAGGAGLIQTAYDRLLEFAL |
| Ga0255065_10005468 | 3300027142 | Freshwater | MANAFTSTGSATLGGTVGGAGLVQKAYDRLLEFALRSEPLIR |
| Ga0255063_10815092 | 3300027151 | Freshwater | MANAYTSSGSSTLGGTAGGAGLIQTAYDRLLEFALRSEPLI |
| Ga0255087_10039211 | 3300027337 | Freshwater | MANAFTSTGSATLGGTVGGAGLVQKAYDRLLEFALRSEPLIRSVADKRPA |
| Ga0208974_11752552 | 3300027608 | Freshwater Lentic | MAYVSTDSASLGGTAGGAGLVQKAYDRLLEFALRSEPLIRSV |
| Ga0208942_10939651 | 3300027627 | Freshwater Lentic | MANAFTSTGSATLGGTSGSAGLVQQAYDRLLEFALRSEPLI |
| Ga0208975_11754272 | 3300027659 | Freshwater Lentic | MANAYTSSTGNLAGTAGAAGLVQKAYDRLLDFALRSEPLIRSVA |
| Ga0209704_12282722 | 3300027693 | Freshwater Sediment | MSNAYTSTGSTTLGGTVGGAGLVQKAYDRLLEFALRAEPLIRSVADKTP |
| Ga0209499_13100012 | 3300027712 | Freshwater Lake | MANAYSSTGSSTLGGTAGAAGLVQTAYDRLLEFALRSEPLI |
| Ga0209085_10573561 | 3300027741 | Freshwater Lake | MANAYVSTDSASLGGTAGGAGLVQKAYDRLLEFALRSEPLI |
| Ga0209355_13477072 | 3300027744 | Freshwater Lake | MANAFTSTGSASLGGTVGAAGLVQKAYDRLLEFALRSEPLIRSV |
| Ga0209084_10685293 | 3300027749 | Freshwater Lake | MANAYSSTGSSTLGGTAGAAGLVQTAYDRLLEFALRSEP |
| Ga0209084_12951021 | 3300027749 | Freshwater Lake | MANAYTTTGSASLGGTVGGAGLVQKAYDRLIEFALRAQPLIRSVADKTPARQSIPGSS |
| Ga0209444_103120902 | 3300027756 | Freshwater Lake | MANAFVSTGASSLGGTSGSAGLVQAAYDRLLEFALRSE |
| Ga0209296_100064147 | 3300027759 | Freshwater Lake | MANAYTSSTGNLAGTAGGAGLVQKAYDRLLDFALRSE |
| Ga0209296_13150432 | 3300027759 | Freshwater Lake | MANSYTSTGSATLGGTSGSAGLVQQAYDRLLEFALRAEPLIRSV |
| Ga0209296_13637191 | 3300027759 | Freshwater Lake | MANAYVSTGSSSLGGTAGSAGLVQKAYDRLLEFALRSEP |
| Ga0209086_103940671 | 3300027770 | Freshwater Lake | MANAYVTTGSSSLGGTAGSAGLVQKAYDRLLEFALRSEPLIRSVADKRP |
| Ga0209768_100927451 | 3300027772 | Freshwater Lake | MANAFVSTGASSLGGTSGSAGLVQAAYDRLLEFALRSEPL |
| Ga0209768_104105681 | 3300027772 | Freshwater Lake | MANAFVSTGASSLGGTSGSAGLVQAAYDRLLEFALRSEPLIRS |
| Ga0209500_100014891 | 3300027782 | Freshwater Lake | MANAYTSSTGNLAGTAGGAGLVQKAYDRLLDFALRSEPLIRSVADKRPTKLAN |
| Ga0209246_103796951 | 3300027785 | Freshwater Lake | MANSYVSTDSASLGGTVGSAGLVQKAYDRLLEFALRSEPLIRS |
| Ga0209107_100420731 | 3300027797 | Freshwater And Sediment | MANAYVSTASDNLGGTAGSAGLVQKAYDRLLEFALR |
| Ga0209107_105131461 | 3300027797 | Freshwater And Sediment | MANAYTSSTGNLAGTAGAAGLVQKAYDRLLDFALRSEPLIRSVADKKPAKLA |
| Ga0209353_101152611 | 3300027798 | Freshwater Lake | MANAFVSTGASSLGGTSGSAGLVQAAYDRLLEFALRSEPLI |
| Ga0209353_103005931 | 3300027798 | Freshwater Lake | MANAFVSTGASSLGGTSGSAGLVQAAYDRLLEFALRSEPLIRSVADKTPARQ |
| Ga0209354_102260112 | 3300027808 | Freshwater Lake | MANAFTSTGAATLGGTSGSAGLVQQAYDRLLEFALRSEPLIRSVADKTPAR |
| Ga0209354_102563552 | 3300027808 | Freshwater Lake | LATNYTSTDSASFGGVAGSAGLVQKAYDKFIEFALRDEPLIRAVSDKRPTNQTN |
| Ga0209354_102566531 | 3300027808 | Freshwater Lake | MANAFTGTGSATLGGTSGSAGLVQQAYDRLLEFALRSEPLIRSVA |
| Ga0209990_100672143 | 3300027816 | Freshwater Lake | MANAYVSTGSSSLGGTAGAAGLVQKAYDRLLEFALRSE |
| Ga0209990_105119002 | 3300027816 | Freshwater Lake | MPNAFTDTSSTSLGGTVGAAGLVQKAYDRLLEFALRSE |
| Ga0209491_103025521 | 3300027832 | Freshwater | MADAYTSTASGSLGGTAGAAGLVQKAYDRLVEFELRATPLLRSVADKKPARQAMP |
| Ga0209550_106140751 | 3300027892 | Freshwater Lake | MANAYTSSTGNLAGTAGAAGLVQKAYDRLLDFALRSEPLIRSVADKR |
| Ga0209550_106649572 | 3300027892 | Freshwater Lake | MANAFTSTGAATLGGTSGSAGLVQQAYDRLLEFAL |
| Ga0209400_10105645 | 3300027963 | Freshwater Lake | MANAYVSTGSSSLGGTAGSAGLVQKAYDRLLEFALRSEPLIRSVADKRPARQ |
| Ga0209191_11526231 | 3300027969 | Freshwater Lake | MANAYTTTGSSSLGGTVGGAGLVQKAYDRLIEFALRAQPLIRS |
| Ga0256335_10992222 | 3300028112 | Freshwater | MPNSYVSTDSASLGGTAGAAGLVQKAYDRLLEFALRSEPLIRSVADKRPARQ |
| Ga0304730_12108702 | 3300028394 | Freshwater Lake | MANAYTSSTGNLAGTAGGAGLVQKAYDRLLDFALRSEPLIRSVADKRPTK |
| (restricted) Ga0247832_12586381 | 3300028557 | Freshwater | MANAFTDTSSNSLGGTVGAAGLVQKAYDRLLEFALRSEPLLRSVADKRPARQA |
| Ga0119944_10312172 | 3300029930 | Aquatic | MAYVSTASDNLGGTAGGAGLVQKAYDRLLEFALRSEPLIRSVADKRPARQA |
| Ga0315291_112230422 | 3300031707 | Sediment | MANLYTSSTGSLAGTAGAAGLVQKAYDRLLDFALRS |
| Ga0315900_108606481 | 3300031787 | Freshwater | MPTVNYTTTGSSSLGGTAGSAGLVQKAYDRLLEFALRSEPLIRSVADK |
| Ga0315909_100716641 | 3300031857 | Freshwater | MPNAYTSTGSSTLGGTAGGAGLVQQAYDRLLEFALRSEPLIRSVAD |
| Ga0315909_107200861 | 3300031857 | Freshwater | MSNAYTSTGSTTLGGTVGGAGLVQKAYDRLLEFALRAEPLIRSVADKTPAQQSIPG |
| Ga0315297_107680591 | 3300031873 | Sediment | MANAYTSSTGNLAGTAGAAGLVQKAYDRLLDFALRSEPLIRSVADKKPTKLA |
| Ga0315904_101713543 | 3300031951 | Freshwater | MSNQYTSTASTSLGGSVGGAGLVQKAYDRLLEFALRSEPLLRSV |
| Ga0315904_102647111 | 3300031951 | Freshwater | LATNYTSTDSASLGGTAGSAGLVQKAYDKFIEFALRDEPLIRAVADKRPVSTTNNGNV |
| Ga0315904_109049172 | 3300031951 | Freshwater | MAYVSTDSGSLGGTAGGAGLVQKAYDRLLEFALRSEPLIRSVAD |
| Ga0315904_114513801 | 3300031951 | Freshwater | MPTVNYTTTGSSSLGGTAGSAGLVQKAYDRLLEFALRSEPL |
| Ga0315901_103537421 | 3300031963 | Freshwater | MAYVSTASDNLGGTAGGAGLVQKAYDRLLEFALRSEPLI |
| Ga0315901_105030343 | 3300031963 | Freshwater | MSNQYTDTSSTSLGGTVGGAGLVQKAYDRLLEFALRSEPLIRSVADK |
| Ga0315901_111141251 | 3300031963 | Freshwater | MAYVSTDSASLGGTAGGAGLVQKAYDRLLEFALRSEPLIRSVAD |
| Ga0315274_110200222 | 3300031999 | Sediment | MANAYTSSTGNLAGTAGAAGLVQKAYDRLLDFALRSEPLIRSVADKRPAKL |
| Ga0315274_115461031 | 3300031999 | Sediment | MANAYTSSTGNLAGTAGAAGLVQKAYDRLLDFALRSEPLIRSVADKKPTKLANPGS |
| Ga0315274_116087361 | 3300031999 | Sediment | MPTSYTGTTNTGASSFGGTAGGAGLVQKAYDRLVE |
| Ga0315274_119704361 | 3300031999 | Sediment | MANAYTSSTGNLAGTAGAAGLVQKAYDRLLDFALRSEPLIRSVADKRPTKLANP |
| Ga0315289_106582423 | 3300032046 | Sediment | MANAYTSSTGNLAGTAGAAGLVQKAYDRLLDFALRSEPLIR |
| Ga0315906_108061681 | 3300032050 | Freshwater | MATVNYTTTGSSSLGGTAGAAGLVQKAYDRLLEFALRSEPLIRSVADKRPA |
| Ga0315905_111912561 | 3300032092 | Freshwater | MSNQYTSTASTSLGGSVGGAGLVQKAYDRLLEFALRSEPLIRSV |
| Ga0315905_113130921 | 3300032092 | Freshwater | MANAFVSTGASSLGGTSGSAGLVQAAYDRLLEFALRSEPLIRSVADKT |
| Ga0315905_113500501 | 3300032092 | Freshwater | MSNQYTSTASTSLGGTVGGAGLVQKAYDRLLEFALRSEPLIRSVADKRPAR |
| Ga0315905_114507681 | 3300032092 | Freshwater | MPNAYTDTSSTSLGGTVGAAGLVQKAYDRLLEFALRSEPLLRSV |
| Ga0315902_100137241 | 3300032093 | Freshwater | MATVNYTTTGSSSLGGTAGAAGLVQKAYDRLLEFALRSEPLIRSVADKRPARQA |
| Ga0315903_102133891 | 3300032116 | Freshwater | MANSYVSTGSSSLGGTAGAAGLVQKAYDRLLEFALRSEPLIRSVADKRPAKQ |
| Ga0315903_102374663 | 3300032116 | Freshwater | MAYTDTSSGSLGGSVGGAGLVQKAYDRLLEFALRSEPLIRSVADKR |
| Ga0315903_107069561 | 3300032116 | Freshwater | MPNAYTDTSSTSFGGTVGGAGLVQKAYDRLLEFALRSEPLIRSVADK |
| Ga0315277_110558681 | 3300032118 | Sediment | MANAYTSSTGNLAGTAGAAGLVQKAYDRLLDFALRSEPLIRSVADKRPTKL |
| Ga0315270_103901043 | 3300032275 | Sediment | MANLYTSSTGNLAGTAGAAGVVQKAYDRLLDFALR |
| Ga0315273_119762232 | 3300032516 | Sediment | MANAFVSTGASSLGGTSGSAGLVQAAYDRLLEFALRSEPLIRSV |
| Ga0316616_1023518242 | 3300033521 | Soil | MSNQYTDTSSTSLGGTVGGAGLVQKAYDRLLEFALRAEPLIRSVADKRPARQAMP |
| Ga0316617_1014287042 | 3300033557 | Soil | MSNAYTDTSSTSLGGTVGGAGLVQKAYDRLLEFALRAEPLIRSV |
| Ga0334994_0021035_4150_4332 | 3300033993 | Freshwater | MSNAYTSTGSTTLGGTVGGAGLVQKAYDRLLEFALRAEPLIRSVADKTPAQQSIPGSTVV |
| Ga0334994_0346168_1_150 | 3300033993 | Freshwater | MPNAYTSTGSTSLGGTVGGAGLVQKAYDRLLEFALRAEPLIRSVADKTPA |
| Ga0335002_0531268_1_123 | 3300034020 | Freshwater | MANAYVSTGSSSLGGTAGAAGLVQKAYDRLLEFALRSEPLI |
| Ga0335005_0439654_601_738 | 3300034022 | Freshwater | MANAYTSSTGNLAGTAGGAGLVQKAYDRLLDFALRSEPLIRSVADK |
| Ga0334995_0158027_1469_1627 | 3300034062 | Freshwater | MSNQYTDTSSGSLGGTVGGAGLVQKAYDRLLEFALRAEPLIRSVADKRPARQA |
| Ga0335019_0574290_3_122 | 3300034066 | Freshwater | MPNAYTSTGSTTLGGTVGGAGLVQKAYDRLLEFALRAEPL |
| Ga0335019_0714158_1_141 | 3300034066 | Freshwater | MANAYTDTASTSLGGTVGGAGLVQKAYDRLLEFALRSEPLIRSVADK |
| Ga0335028_0718044_371_520 | 3300034071 | Freshwater | MATNFTSTDSASLGGTANSAGLVQKAYDKFIEFALRDEPLIRSVADKRPV |
| Ga0310127_167620_744_848 | 3300034072 | Fracking Water | MANAYTDTGASSLGGTTGAAGLVQKAYDRLLEFAL |
| Ga0373911_099433_424_531 | 3300034081 | Sediment Slurry | MANAYTSTASTSLGGTKGGAGLLQHAYDKVIEFELR |
| Ga0335027_0116885_1858_2007 | 3300034101 | Freshwater | MAYVSTDSASLGGTAGGAGLVQKAYDRLLEFALRSEPLIRSVADKRPARQ |
| Ga0335027_0542836_3_128 | 3300034101 | Freshwater | MPNAYTGTGSSTLGGTAGSAGLVQQAYDRLLEFALRSEPLIR |
| Ga0335029_0784984_379_504 | 3300034102 | Freshwater | MANAYTGTGSATLGGTSGGAGLVQQAYDRLLEFALRSEPLIR |
| Ga0335036_0780177_2_124 | 3300034106 | Freshwater | MATNFTSTDSASLGGTAGSAGLVQKAYDKFIEFALRDEPLI |
| Ga0335068_0018820_4125_4271 | 3300034116 | Freshwater | MSQYTSTASTSLGGTVGGAGLVQKAYDRLLEFALRSEPLLRSVADKRPA |
| Ga0335053_0366227_2_166 | 3300034118 | Freshwater | MANAYTGTGSATLGGTAGGAGLVQQAYDRLLEFALRSEPLIRSVADKTPARQSIP |
| Ga0335054_0423644_3_113 | 3300034119 | Freshwater | MAYVSTASDNLGGTAGGAGLVQKAYDRLLEFALRSEP |
| Ga0335054_0775113_1_141 | 3300034119 | Freshwater | MANAYVSTGSSSLGGTAGSAGLVQKAYDRLLEFALRSEPLIRSVADK |
| Ga0335016_0564214_466_627 | 3300034166 | Freshwater | MPNAYTGVGSSTLGGTAGGAGLVQQAYDRLLEFALRSEPLIRSVADKTPARQSI |
| Ga0335049_0708672_443_607 | 3300034272 | Freshwater | MANAYTSTGSTTLGGTVGGAGLVQKAYDRLLEFALRAEPLSRSVADKTPAQQSIP |
| Ga0335052_0457445_523_666 | 3300034279 | Freshwater | MAYVSTDSGSLGGTAGGAGLVQKAYDRLLEFALRSEPLIRSVADKRPA |
| Ga0335007_0818274_1_138 | 3300034283 | Freshwater | MANAFISTDSASLGGTVGAAGLVQKAYDRLLEFALRSEPLLRSVAD |
| Ga0335048_0223478_1_114 | 3300034356 | Freshwater | MAYVSTASDNLGGTAGGAGLVQKAYDRLLEFALRSEPL |
| Ga0335048_0611088_1_105 | 3300034356 | Freshwater | MSNQYTDTSSGSLGGTVGGAGLVQKAYDRLLEFAL |
| ⦗Top⦘ |