| Basic Information | |
|---|---|
| Family ID | F007938 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 342 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MGRRSEIEAEARKSGGVVTSVSVGGATAYIASGEIEVPPSALVS |
| Number of Associated Samples | 280 |
| Number of Associated Scaffolds | 342 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 6.45 % |
| % of genes near scaffold ends (potentially truncated) | 94.15 % |
| % of genes from short scaffolds (< 2000 bps) | 90.64 % |
| Associated GOLD sequencing projects | 258 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.906 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (17.544 % of family members) |
| Environment Ontology (ENVO) | Unclassified (16.667 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.433 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 4.17% β-sheet: 20.83% Coil/Unstructured: 75.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 342 Family Scaffolds |
|---|---|---|
| PF02558 | ApbA | 7.60 |
| PF03466 | LysR_substrate | 2.92 |
| PF02567 | PhzC-PhzF | 2.05 |
| PF00266 | Aminotran_5 | 2.05 |
| PF12704 | MacB_PCD | 2.05 |
| PF12802 | MarR_2 | 1.75 |
| PF03446 | NAD_binding_2 | 1.46 |
| PF00126 | HTH_1 | 1.17 |
| PF01042 | Ribonuc_L-PSP | 1.17 |
| PF14552 | Tautomerase_2 | 0.88 |
| PF07676 | PD40 | 0.88 |
| PF12867 | DinB_2 | 0.88 |
| PF14588 | YjgF_endoribonc | 0.88 |
| PF13417 | GST_N_3 | 0.58 |
| PF08240 | ADH_N | 0.58 |
| PF00313 | CSD | 0.58 |
| PF02129 | Peptidase_S15 | 0.58 |
| PF03781 | FGE-sulfatase | 0.58 |
| PF13493 | DUF4118 | 0.58 |
| PF08546 | ApbA_C | 0.58 |
| PF05368 | NmrA | 0.58 |
| PF03737 | RraA-like | 0.58 |
| PF13577 | SnoaL_4 | 0.29 |
| PF06779 | MFS_4 | 0.29 |
| PF07883 | Cupin_2 | 0.29 |
| PF01548 | DEDD_Tnp_IS110 | 0.29 |
| PF12762 | DDE_Tnp_IS1595 | 0.29 |
| PF13560 | HTH_31 | 0.29 |
| PF13673 | Acetyltransf_10 | 0.29 |
| PF13414 | TPR_11 | 0.29 |
| PF00589 | Phage_integrase | 0.29 |
| PF01694 | Rhomboid | 0.29 |
| PF01361 | Tautomerase | 0.29 |
| PF04972 | BON | 0.29 |
| PF13396 | PLDc_N | 0.29 |
| PF02633 | Creatininase | 0.29 |
| PF00282 | Pyridoxal_deC | 0.29 |
| PF13376 | OmdA | 0.29 |
| PF04199 | Cyclase | 0.29 |
| PF00106 | adh_short | 0.29 |
| COG ID | Name | Functional Category | % Frequency in 342 Family Scaffolds |
|---|---|---|---|
| COG0384 | Predicted epimerase YddE/YHI9, PhzF superfamily | General function prediction only [R] | 2.05 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 1.17 |
| COG0684 | RNA degradosome component RraA (regulator of RNase E activity) | Translation, ribosomal structure and biogenesis [J] | 0.58 |
| COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 0.58 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 0.58 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.29 |
| COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 0.29 |
| COG1402 | Creatinine amidohydrolase/Fe(II)-dependent FAPy formamide hydrolase (riboflavin and F420 biosynthesis) | Coenzyme transport and metabolism [H] | 0.29 |
| COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 0.29 |
| COG1942 | Phenylpyruvate tautomerase PptA, 4-oxalocrotonate tautomerase family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.29 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.29 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.91 % |
| Unclassified | root | N/A | 4.09 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908016|OU_2_1_1_newblercontig16247 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 2199352024|deeps_contig18051.11840 | Not Available | 1718 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100819550 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 526 | Open in IMG/M |
| 3300001849|RCM26_1144909 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100181216 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1993 | Open in IMG/M |
| 3300003224|JGI26344J46810_1006459 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 888 | Open in IMG/M |
| 3300004114|Ga0062593_102278189 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 609 | Open in IMG/M |
| 3300005171|Ga0066677_10255970 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 995 | Open in IMG/M |
| 3300005174|Ga0066680_10027356 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3190 | Open in IMG/M |
| 3300005175|Ga0066673_10477227 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300005176|Ga0066679_11054957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 503 | Open in IMG/M |
| 3300005179|Ga0066684_11036947 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300005180|Ga0066685_10353002 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
| 3300005186|Ga0066676_10646387 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 718 | Open in IMG/M |
| 3300005294|Ga0065705_10753482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 629 | Open in IMG/M |
| 3300005332|Ga0066388_107421931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 550 | Open in IMG/M |
| 3300005336|Ga0070680_100123215 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2165 | Open in IMG/M |
| 3300005355|Ga0070671_101252033 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300005436|Ga0070713_100932730 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300005436|Ga0070713_101560794 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300005439|Ga0070711_100113767 | All Organisms → cellular organisms → Bacteria | 1990 | Open in IMG/M |
| 3300005447|Ga0066689_10125935 | All Organisms → cellular organisms → Bacteria | 1500 | Open in IMG/M |
| 3300005526|Ga0073909_10429192 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 628 | Open in IMG/M |
| 3300005538|Ga0070731_10283313 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1101 | Open in IMG/M |
| 3300005541|Ga0070733_10794176 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 636 | Open in IMG/M |
| 3300005542|Ga0070732_10906741 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. L60 | 538 | Open in IMG/M |
| 3300005547|Ga0070693_101431533 | Not Available | 538 | Open in IMG/M |
| 3300005553|Ga0066695_10386938 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 870 | Open in IMG/M |
| 3300005554|Ga0066661_10041656 | All Organisms → cellular organisms → Bacteria | 2594 | Open in IMG/M |
| 3300005559|Ga0066700_10468385 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 882 | Open in IMG/M |
| 3300005566|Ga0066693_10034134 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1626 | Open in IMG/M |
| 3300005575|Ga0066702_10095119 | All Organisms → cellular organisms → Bacteria | 1691 | Open in IMG/M |
| 3300005575|Ga0066702_10821135 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300005575|Ga0066702_10897981 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300005586|Ga0066691_10671987 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300005591|Ga0070761_10210687 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
| 3300005598|Ga0066706_11168489 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 586 | Open in IMG/M |
| 3300005610|Ga0070763_10806981 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300005764|Ga0066903_104579224 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300005836|Ga0074470_10063467 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300005841|Ga0068863_101337979 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300006162|Ga0075030_100832631 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300006172|Ga0075018_10707264 | Not Available | 545 | Open in IMG/M |
| 3300006174|Ga0075014_100138689 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
| 3300006175|Ga0070712_100383380 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1158 | Open in IMG/M |
| 3300006176|Ga0070765_101461943 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 643 | Open in IMG/M |
| 3300006358|Ga0068871_100684571 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 938 | Open in IMG/M |
| 3300006577|Ga0074050_11685727 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300006755|Ga0079222_12259317 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300006797|Ga0066659_11014752 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300006800|Ga0066660_10305307 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1272 | Open in IMG/M |
| 3300006854|Ga0075425_100506157 | All Organisms → cellular organisms → Bacteria | 1390 | Open in IMG/M |
| 3300006914|Ga0075436_100942829 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300006914|Ga0075436_101264722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 558 | Open in IMG/M |
| 3300006914|Ga0075436_101536934 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300006954|Ga0079219_12231922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae | 528 | Open in IMG/M |
| 3300009090|Ga0099827_11298053 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 633 | Open in IMG/M |
| 3300009093|Ga0105240_11720076 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300009137|Ga0066709_102157762 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 769 | Open in IMG/M |
| 3300009137|Ga0066709_103321199 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300009143|Ga0099792_10641091 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 681 | Open in IMG/M |
| 3300009143|Ga0099792_10735278 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 641 | Open in IMG/M |
| 3300009143|Ga0099792_10777887 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 625 | Open in IMG/M |
| 3300009156|Ga0111538_13626610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300009177|Ga0105248_12151453 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300009632|Ga0116102_1193005 | Not Available | 549 | Open in IMG/M |
| 3300009665|Ga0116135_1418690 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300009698|Ga0116216_10760613 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 581 | Open in IMG/M |
| 3300010043|Ga0126380_11812606 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300010047|Ga0126382_11105725 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300010047|Ga0126382_12154509 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300010303|Ga0134082_10548101 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300010325|Ga0134064_10471798 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300010333|Ga0134080_10337604 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 684 | Open in IMG/M |
| 3300010335|Ga0134063_10165422 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1031 | Open in IMG/M |
| 3300010335|Ga0134063_10563633 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300010336|Ga0134071_10502315 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300010341|Ga0074045_10369113 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 934 | Open in IMG/M |
| 3300010358|Ga0126370_11317050 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 678 | Open in IMG/M |
| 3300010359|Ga0126376_10059898 | All Organisms → cellular organisms → Bacteria | 2736 | Open in IMG/M |
| 3300010359|Ga0126376_13086191 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300010360|Ga0126372_10064657 | All Organisms → cellular organisms → Bacteria | 2565 | Open in IMG/M |
| 3300010366|Ga0126379_10993732 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 944 | Open in IMG/M |
| 3300010366|Ga0126379_11454989 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300010373|Ga0134128_10255592 | All Organisms → cellular organisms → Bacteria | 1966 | Open in IMG/M |
| 3300010379|Ga0136449_103282758 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300010396|Ga0134126_11595109 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300010398|Ga0126383_13256307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300010399|Ga0134127_11975652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 661 | Open in IMG/M |
| 3300010401|Ga0134121_11151564 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 772 | Open in IMG/M |
| 3300010880|Ga0126350_10101979 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300011120|Ga0150983_14816439 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300011269|Ga0137392_10736940 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300011271|Ga0137393_11579152 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 545 | Open in IMG/M |
| 3300012096|Ga0137389_10458871 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1091 | Open in IMG/M |
| 3300012199|Ga0137383_10500016 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300012209|Ga0137379_10345625 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1397 | Open in IMG/M |
| 3300012209|Ga0137379_10954893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 762 | Open in IMG/M |
| 3300012357|Ga0137384_10929772 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 700 | Open in IMG/M |
| 3300012362|Ga0137361_10082511 | All Organisms → cellular organisms → Bacteria | 2751 | Open in IMG/M |
| 3300012683|Ga0137398_10031036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 3024 | Open in IMG/M |
| 3300012917|Ga0137395_10027594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 3389 | Open in IMG/M |
| 3300012924|Ga0137413_11642048 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 526 | Open in IMG/M |
| 3300012929|Ga0137404_10117567 | All Organisms → cellular organisms → Bacteria | 2169 | Open in IMG/M |
| 3300012929|Ga0137404_10577039 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
| 3300012944|Ga0137410_11878244 | Not Available | 530 | Open in IMG/M |
| 3300012971|Ga0126369_12239124 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 633 | Open in IMG/M |
| 3300012975|Ga0134110_10050399 | All Organisms → cellular organisms → Bacteria | 1641 | Open in IMG/M |
| 3300012975|Ga0134110_10377463 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300012975|Ga0134110_10521505 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300012977|Ga0134087_10231396 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 839 | Open in IMG/M |
| 3300012985|Ga0164308_11613611 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300012985|Ga0164308_11631899 | Not Available | 596 | Open in IMG/M |
| 3300012989|Ga0164305_10748569 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300013104|Ga0157370_10545844 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1063 | Open in IMG/M |
| 3300013104|Ga0157370_10886679 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300014157|Ga0134078_10005936 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3394 | Open in IMG/M |
| 3300014161|Ga0181529_10608905 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300014164|Ga0181532_10610671 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
| 3300014169|Ga0181531_10821653 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
| 3300014655|Ga0181516_10265106 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300015356|Ga0134073_10394428 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300015372|Ga0132256_101157962 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300015373|Ga0132257_103067488 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 608 | Open in IMG/M |
| 3300015373|Ga0132257_104130521 | Not Available | 528 | Open in IMG/M |
| 3300016270|Ga0182036_10354212 | All Organisms → cellular organisms → Bacteria | 1132 | Open in IMG/M |
| 3300016294|Ga0182041_10422979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → unclassified Rhodanobacter → Rhodanobacter sp. OK091 | 1139 | Open in IMG/M |
| 3300016294|Ga0182041_10895600 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300016294|Ga0182041_12314924 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 503 | Open in IMG/M |
| 3300016357|Ga0182032_10515169 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 985 | Open in IMG/M |
| 3300016387|Ga0182040_11511778 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
| 3300016445|Ga0182038_11436614 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 618 | Open in IMG/M |
| 3300016445|Ga0182038_11706482 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 567 | Open in IMG/M |
| 3300017656|Ga0134112_10171525 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300017822|Ga0187802_10076458 | All Organisms → cellular organisms → Bacteria | 1245 | Open in IMG/M |
| 3300017927|Ga0187824_10214317 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 659 | Open in IMG/M |
| 3300017935|Ga0187848_10432353 | Not Available | 541 | Open in IMG/M |
| 3300017936|Ga0187821_10515482 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. L60 | 500 | Open in IMG/M |
| 3300017939|Ga0187775_10092775 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
| 3300017940|Ga0187853_10015122 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4455 | Open in IMG/M |
| 3300017946|Ga0187879_10230856 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1034 | Open in IMG/M |
| 3300017946|Ga0187879_10677223 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300017955|Ga0187817_10414186 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 860 | Open in IMG/M |
| 3300017959|Ga0187779_10604467 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 734 | Open in IMG/M |
| 3300017961|Ga0187778_10354657 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300017966|Ga0187776_10448344 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 873 | Open in IMG/M |
| 3300017972|Ga0187781_10129681 | All Organisms → cellular organisms → Bacteria | 1762 | Open in IMG/M |
| 3300017974|Ga0187777_11399374 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 516 | Open in IMG/M |
| 3300017988|Ga0181520_10443889 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300017988|Ga0181520_10980172 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300017993|Ga0187823_10092127 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 895 | Open in IMG/M |
| 3300018008|Ga0187888_1233157 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300018019|Ga0187874_10013349 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4595 | Open in IMG/M |
| 3300018034|Ga0187863_10386488 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300018034|Ga0187863_10435785 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300018038|Ga0187855_10017435 | All Organisms → cellular organisms → Bacteria | 4730 | Open in IMG/M |
| 3300018040|Ga0187862_10403456 | Not Available | 839 | Open in IMG/M |
| 3300018042|Ga0187871_10343380 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 825 | Open in IMG/M |
| 3300018044|Ga0187890_10044096 | All Organisms → cellular organisms → Bacteria | 2673 | Open in IMG/M |
| 3300018057|Ga0187858_10622576 | Not Available | 649 | Open in IMG/M |
| 3300018058|Ga0187766_10792420 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 661 | Open in IMG/M |
| 3300018085|Ga0187772_11017689 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
| 3300018086|Ga0187769_10100639 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2076 | Open in IMG/M |
| 3300018088|Ga0187771_11657918 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
| 3300018089|Ga0187774_10309569 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 923 | Open in IMG/M |
| 3300018090|Ga0187770_10159442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Tistrella | 1723 | Open in IMG/M |
| 3300018431|Ga0066655_10495503 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 809 | Open in IMG/M |
| 3300018431|Ga0066655_10940983 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 593 | Open in IMG/M |
| 3300018433|Ga0066667_10316278 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1223 | Open in IMG/M |
| 3300018433|Ga0066667_10351236 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1172 | Open in IMG/M |
| 3300018433|Ga0066667_10778636 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300019787|Ga0182031_1258695 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1250 | Open in IMG/M |
| 3300020150|Ga0187768_1044759 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300020199|Ga0179592_10036684 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514 | 2218 | Open in IMG/M |
| 3300020579|Ga0210407_10568725 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300020580|Ga0210403_10642114 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 854 | Open in IMG/M |
| 3300020580|Ga0210403_11533642 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 500 | Open in IMG/M |
| 3300020581|Ga0210399_10993221 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 676 | Open in IMG/M |
| 3300020583|Ga0210401_10962204 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 712 | Open in IMG/M |
| 3300020583|Ga0210401_11193311 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 619 | Open in IMG/M |
| 3300021168|Ga0210406_10960919 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 638 | Open in IMG/M |
| 3300021170|Ga0210400_10382411 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1160 | Open in IMG/M |
| 3300021170|Ga0210400_10504820 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 998 | Open in IMG/M |
| 3300021170|Ga0210400_10927039 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 710 | Open in IMG/M |
| 3300021178|Ga0210408_10073708 | All Organisms → cellular organisms → Bacteria | 2671 | Open in IMG/M |
| 3300021178|Ga0210408_11102882 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 610 | Open in IMG/M |
| 3300021180|Ga0210396_10270959 | All Organisms → cellular organisms → Bacteria | 1507 | Open in IMG/M |
| 3300021180|Ga0210396_11334803 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 595 | Open in IMG/M |
| 3300021180|Ga0210396_11724236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300021384|Ga0213876_10350720 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 785 | Open in IMG/M |
| 3300021401|Ga0210393_11669586 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300021405|Ga0210387_11559140 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 563 | Open in IMG/M |
| 3300021406|Ga0210386_11182779 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 647 | Open in IMG/M |
| 3300021420|Ga0210394_10026054 | All Organisms → cellular organisms → Bacteria | 5314 | Open in IMG/M |
| 3300021432|Ga0210384_10725817 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300021432|Ga0210384_11162830 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 675 | Open in IMG/M |
| 3300021432|Ga0210384_11489122 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300021433|Ga0210391_10515269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Phenylobacterium → Phenylobacterium glaciei | 939 | Open in IMG/M |
| 3300021433|Ga0210391_11059269 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 630 | Open in IMG/M |
| 3300021433|Ga0210391_11123204 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300021439|Ga0213879_10054514 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1063 | Open in IMG/M |
| 3300021439|Ga0213879_10152321 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 671 | Open in IMG/M |
| 3300021439|Ga0213879_10266783 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 520 | Open in IMG/M |
| 3300021474|Ga0210390_10544917 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 975 | Open in IMG/M |
| 3300021474|Ga0210390_11223066 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 605 | Open in IMG/M |
| 3300021478|Ga0210402_10211203 | All Organisms → cellular organisms → Bacteria | 1785 | Open in IMG/M |
| 3300021479|Ga0210410_11362181 | Not Available | 602 | Open in IMG/M |
| 3300021559|Ga0210409_10154012 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2105 | Open in IMG/M |
| 3300021559|Ga0210409_10372379 | All Organisms → cellular organisms → Bacteria | 1281 | Open in IMG/M |
| 3300021559|Ga0210409_11246519 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300021559|Ga0210409_11301977 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 602 | Open in IMG/M |
| 3300021858|Ga0213852_1249833 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 688 | Open in IMG/M |
| 3300022532|Ga0242655_10040782 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1106 | Open in IMG/M |
| 3300022712|Ga0242653_1011923 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1096 | Open in IMG/M |
| 3300022724|Ga0242665_10133596 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 770 | Open in IMG/M |
| 3300023046|Ga0233356_1045241 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300024179|Ga0247695_1043965 | Not Available | 646 | Open in IMG/M |
| 3300024284|Ga0247671_1032178 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300025913|Ga0207695_11541554 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300025921|Ga0207652_10853708 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300025931|Ga0207644_11622995 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
| 3300025938|Ga0207704_10320431 | All Organisms → cellular organisms → Bacteria | 1195 | Open in IMG/M |
| 3300025944|Ga0207661_10550267 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300026088|Ga0207641_11518136 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300026304|Ga0209240_1083811 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1170 | Open in IMG/M |
| 3300026305|Ga0209688_1093943 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300026308|Ga0209265_1083000 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 904 | Open in IMG/M |
| 3300026309|Ga0209055_1228745 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300026312|Ga0209153_1037638 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1678 | Open in IMG/M |
| 3300026318|Ga0209471_1115667 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
| 3300026322|Ga0209687_1008229 | All Organisms → cellular organisms → Bacteria | 3486 | Open in IMG/M |
| 3300026326|Ga0209801_1075349 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1487 | Open in IMG/M |
| 3300026330|Ga0209473_1252471 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 607 | Open in IMG/M |
| 3300026331|Ga0209267_1269529 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 577 | Open in IMG/M |
| 3300026342|Ga0209057_1021400 | All Organisms → cellular organisms → Bacteria | 3639 | Open in IMG/M |
| 3300026374|Ga0257146_1043982 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_6 | 724 | Open in IMG/M |
| 3300026514|Ga0257168_1036381 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1063 | Open in IMG/M |
| 3300026523|Ga0209808_1199610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 668 | Open in IMG/M |
| 3300026524|Ga0209690_1204679 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300026548|Ga0209161_10107613 | All Organisms → cellular organisms → Bacteria | 1670 | Open in IMG/M |
| 3300026555|Ga0179593_1170416 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2273 | Open in IMG/M |
| 3300026557|Ga0179587_10058970 | All Organisms → cellular organisms → Bacteria | 2230 | Open in IMG/M |
| 3300026557|Ga0179587_10272563 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1086 | Open in IMG/M |
| 3300027512|Ga0209179_1120822 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 585 | Open in IMG/M |
| 3300027562|Ga0209735_1021836 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1312 | Open in IMG/M |
| 3300027567|Ga0209115_1123277 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 585 | Open in IMG/M |
| 3300027576|Ga0209003_1050702 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300027591|Ga0209733_1177813 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300027660|Ga0209736_1003837 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4981 | Open in IMG/M |
| 3300027671|Ga0209588_1045826 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1414 | Open in IMG/M |
| 3300027775|Ga0209177_10025573 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1503 | Open in IMG/M |
| 3300027787|Ga0209074_10017681 | All Organisms → cellular organisms → Bacteria | 1882 | Open in IMG/M |
| 3300027842|Ga0209580_10495038 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 609 | Open in IMG/M |
| 3300027853|Ga0209274_10382491 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300027855|Ga0209693_10095025 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1475 | Open in IMG/M |
| 3300027862|Ga0209701_10162536 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1355 | Open in IMG/M |
| 3300027889|Ga0209380_10663298 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 601 | Open in IMG/M |
| 3300027910|Ga0209583_10035220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1687 | Open in IMG/M |
| 3300028381|Ga0268264_11543555 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300028381|Ga0268264_12691860 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300028572|Ga0302152_10138862 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300028742|Ga0302220_10097007 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 1162 | Open in IMG/M |
| 3300028746|Ga0302233_10171187 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 835 | Open in IMG/M |
| 3300028747|Ga0302219_10076280 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1257 | Open in IMG/M |
| 3300028759|Ga0302224_10238104 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300028780|Ga0302225_10275780 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300028780|Ga0302225_10359621 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300028798|Ga0302222_10175953 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 840 | Open in IMG/M |
| 3300028801|Ga0302226_10285118 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 697 | Open in IMG/M |
| 3300028867|Ga0302146_10274059 | Not Available | 655 | Open in IMG/M |
| 3300029636|Ga0222749_10669181 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
| 3300029944|Ga0311352_11221386 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300029945|Ga0311330_11199526 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 549 | Open in IMG/M |
| 3300029955|Ga0311342_10605959 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300029955|Ga0311342_11008974 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 617 | Open in IMG/M |
| 3300029993|Ga0302304_10158081 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 851 | Open in IMG/M |
| 3300029999|Ga0311339_10052009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 5489 | Open in IMG/M |
| 3300029999|Ga0311339_11308904 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300030007|Ga0311338_11973431 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300030043|Ga0302306_10217065 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 735 | Open in IMG/M |
| 3300030054|Ga0302182_10223136 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300030057|Ga0302176_10008166 | All Organisms → cellular organisms → Bacteria | 3987 | Open in IMG/M |
| 3300030399|Ga0311353_11150790 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 642 | Open in IMG/M |
| 3300030509|Ga0302183_10368654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 552 | Open in IMG/M |
| 3300030520|Ga0311372_11045775 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
| 3300030524|Ga0311357_10059007 | All Organisms → cellular organisms → Bacteria | 3906 | Open in IMG/M |
| 3300030524|Ga0311357_11205471 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 654 | Open in IMG/M |
| 3300030617|Ga0311356_11775281 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 550 | Open in IMG/M |
| 3300030618|Ga0311354_10769800 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 912 | Open in IMG/M |
| 3300030738|Ga0265462_11320485 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 656 | Open in IMG/M |
| 3300030991|Ga0073994_12393245 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 625 | Open in IMG/M |
| 3300031057|Ga0170834_102526051 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 719 | Open in IMG/M |
| 3300031057|Ga0170834_111811382 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300031057|Ga0170834_112841816 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300031122|Ga0170822_16883041 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 569 | Open in IMG/M |
| 3300031231|Ga0170824_107179957 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 685 | Open in IMG/M |
| 3300031231|Ga0170824_123875492 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 703 | Open in IMG/M |
| 3300031234|Ga0302325_12860581 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300031236|Ga0302324_100259808 | All Organisms → cellular organisms → Bacteria | 2700 | Open in IMG/M |
| 3300031236|Ga0302324_102501732 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300031258|Ga0302318_10475898 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 633 | Open in IMG/M |
| 3300031546|Ga0318538_10043386 | All Organisms → cellular organisms → Bacteria | 2168 | Open in IMG/M |
| 3300031549|Ga0318571_10321424 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300031572|Ga0318515_10762353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300031708|Ga0310686_101661862 | All Organisms → cellular organisms → Bacteria | 2435 | Open in IMG/M |
| 3300031715|Ga0307476_11127990 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 575 | Open in IMG/M |
| 3300031715|Ga0307476_11261366 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300031718|Ga0307474_10682598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 811 | Open in IMG/M |
| 3300031719|Ga0306917_10221878 | All Organisms → cellular organisms → Bacteria | 1439 | Open in IMG/M |
| 3300031736|Ga0318501_10079754 | All Organisms → cellular organisms → Bacteria | 1598 | Open in IMG/M |
| 3300031740|Ga0307468_100544261 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 933 | Open in IMG/M |
| 3300031747|Ga0318502_10672844 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300031748|Ga0318492_10569813 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 603 | Open in IMG/M |
| 3300031753|Ga0307477_10566009 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300031754|Ga0307475_10916570 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. L60 | 691 | Open in IMG/M |
| 3300031754|Ga0307475_11218813 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300031788|Ga0302319_10233520 | All Organisms → cellular organisms → Bacteria | 2260 | Open in IMG/M |
| 3300031823|Ga0307478_11075195 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300031823|Ga0307478_11076659 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300031837|Ga0302315_10453710 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 704 | Open in IMG/M |
| 3300031910|Ga0306923_10945767 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300031910|Ga0306923_11185680 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 817 | Open in IMG/M |
| 3300031959|Ga0318530_10158828 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 920 | Open in IMG/M |
| 3300031959|Ga0318530_10197172 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 825 | Open in IMG/M |
| 3300031962|Ga0307479_10499896 | All Organisms → cellular organisms → Bacteria | 1199 | Open in IMG/M |
| 3300031962|Ga0307479_10790796 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 924 | Open in IMG/M |
| 3300032001|Ga0306922_11739510 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300032039|Ga0318559_10161389 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1021 | Open in IMG/M |
| 3300032041|Ga0318549_10320166 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 699 | Open in IMG/M |
| 3300032043|Ga0318556_10271195 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 886 | Open in IMG/M |
| 3300032052|Ga0318506_10516003 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 529 | Open in IMG/M |
| 3300032063|Ga0318504_10087670 | All Organisms → cellular organisms → Bacteria | 1377 | Open in IMG/M |
| 3300032064|Ga0318510_10093300 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
| 3300032066|Ga0318514_10088071 | All Organisms → cellular organisms → Bacteria | 1560 | Open in IMG/M |
| 3300032094|Ga0318540_10221238 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 913 | Open in IMG/M |
| 3300032205|Ga0307472_101298282 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. L60 | 700 | Open in IMG/M |
| 3300032205|Ga0307472_102669995 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300032261|Ga0306920_102295805 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 747 | Open in IMG/M |
| 3300032770|Ga0335085_10971424 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300033513|Ga0316628_103742248 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300033828|Ga0334850_030785 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.06% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 7.89% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.60% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.80% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.80% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.80% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.22% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.34% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.05% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.05% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.75% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.75% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.75% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.17% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.17% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.17% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.17% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.46% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.46% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.46% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.46% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.88% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.88% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.58% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.58% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.58% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.58% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.58% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.58% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.58% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.29% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.29% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.29% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.29% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.29% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.29% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.29% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.29% |
| Environmental → Unclassified → Unclassified → Unclassified → Unclassified → | 0.29% | |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.29% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.29% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.29% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.29% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.29% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.29% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908016 | Sample 642 | Environmental | Open in IMG/M |
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001849 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM26, ROCA_DNA190_2.0um_MCP-N_C_2b | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003224 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014161 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020150 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MG | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021858 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022712 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023046 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS | Environmental | Open in IMG/M |
| 3300024179 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36 | Environmental | Open in IMG/M |
| 3300024284 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK12 | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026374 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-A | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027576 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028572 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300028742 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300028746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300028801 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300028867 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_3 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029945 | I_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029955 | II_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029993 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030043 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030738 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assembly | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031258 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031837 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033828 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P1 1-5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| OU_02467600 | 2124908016 | QQGVWMGRRSEIETEARKRDGVVTSVSVGGATTYIASGEIEVPPSALES | |
| deeps_02132390 | 2199352024 | Soil | EIEAEARKSDSVVTSVSVGGTTAYVASGEIEVPPSALES |
| INPhiseqgaiiFebDRAFT_1008195501 | 3300000364 | Soil | ARKSGAVVTSVSVGGATTYIASGEIDVPPSALVS* |
| RCM26_11449091 | 3300001849 | Marine Plankton | ARTRGGVVTAVRVGGATTYIASGELEVPASALEP* |
| JGIcombinedJ26739_1001812161 | 3300002245 | Forest Soil | RRSDIEAEARKRDGVVTSVSVGGATTYIASGEIEVPPFALES* |
| JGI26344J46810_10064591 | 3300003224 | Bog Forest Soil | SNIEAEARKRDGVVMSVSVAGATTYIASGEIEVPPMALES* |
| Ga0062593_1022781892 | 3300004114 | Soil | SEIEAEARKSRGVVNSVSVGGATACIASGEIEVPPFALAS* |
| Ga0066677_102559701 | 3300005171 | Soil | GVSMGRRSEIEAEARKSDDVVTSVSVGGATTYVASGEIDVPPSALVS* |
| Ga0066680_100273564 | 3300005174 | Soil | MGRRSEIEAEARKSGNVVTSVSVGGATAYIASGEIEVPPSALLS* |
| Ga0066673_104772271 | 3300005175 | Soil | SEIEAEARKSGSVVTSVSVGGAAANIASGEIEVPPSALVS* |
| Ga0066679_110549572 | 3300005176 | Soil | MGRPSEIEAEARMRDGVVTSVSVGGATTYIASGEIEVPPFALVS* |
| Ga0066684_110369471 | 3300005179 | Soil | IQQGVLMGRRSDIEAEARKSDGVVTSISVGGAAAYIASGEIEVPQSALVS* |
| Ga0066685_103530022 | 3300005180 | Soil | MGRRSEMEAEARKSGGVVTSVSVGGATAYIASGEIEVPPSALVS* |
| Ga0066676_106463872 | 3300005186 | Soil | MGRRSEIEAEARKSGNVVTSVSVGGATAYIASGEIEVPPFALES* |
| Ga0065705_107534822 | 3300005294 | Switchgrass Rhizosphere | MGRRSQIEAEARKNGGVVTSVSVGGATAYIASGEIEVLPSALVS* |
| Ga0066388_1074219312 | 3300005332 | Tropical Forest Soil | IQQGVSMGRRSEIEAEARKSGSVLTSVSVGGAAANIASGEIEVPPSALVS* |
| Ga0070680_1001232154 | 3300005336 | Corn Rhizosphere | LSIQQGVLMGRRSEIEAEARKSQNVVTSVSVGGATAYIASGEIDVPPFALVS* |
| Ga0070671_1012520332 | 3300005355 | Switchgrass Rhizosphere | IQQGVSMGRRSEIEAEARKSRGVVNSVSVGGATACIASGEIEVPPFALAS* |
| Ga0070713_1009327301 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | SIQQGVSMGRRSELEAEARKSDGVVTSVSVGGAAAYVASGEIEVPPSALVSP* |
| Ga0070713_1015607941 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | SEIEAEARKSGSVVTSVSVGGVAAHIASGEIEVPPSALVSQ* |
| Ga0070711_1001137675 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MGRRSEIEAEARKSRGVVTSVSVGGATAYIASGEIEVPPSALVS* |
| Ga0066689_101259353 | 3300005447 | Soil | RRSEIEAEARKSGNVVTSVSVGGATAYIASGEIEVPPSALLS* |
| Ga0073909_104291922 | 3300005526 | Surface Soil | ARKSGGVVTSVSVGGATAYIASGEIEVPPFALVS* |
| Ga0070731_102833131 | 3300005538 | Surface Soil | QGVSMGRRSEIEAEARKSGAVVTSVSVGGATAYIASGEIEVPSSALLVS* |
| Ga0070733_107941762 | 3300005541 | Surface Soil | RRSEIEAEARKSGSVVTSVSVGGATAYIASGDIEVPPSALVSQTVEI* |
| Ga0070732_109067411 | 3300005542 | Surface Soil | SEIEAEARKSGSVVTSVSVGGAAAHIASGEIEVPQSALVS* |
| Ga0070693_1014315332 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | EIEAEARKSDSVVTSVSVGGTTAYVASGEIEVPPSALES* |
| Ga0066695_103869382 | 3300005553 | Soil | MGRRSEIEAEARKSGNVVTSVSVGGATAYIASGEIEIPPSALLS* |
| Ga0066661_100416563 | 3300005554 | Soil | QQGVLMGRPSEIEAEARKSGGVVTSVSVGGATAYIASGEIEVPPSALVS* |
| Ga0066700_104683851 | 3300005559 | Soil | VSMGRRSEIEAEARKSGSVVTSVSVGGATTYIASGEIEVPPFALVS* |
| Ga0066693_100341341 | 3300005566 | Soil | EAEARKSDGVVTSVSVGGAAAHIASGEIEVPQSALVS* |
| Ga0066702_100951191 | 3300005575 | Soil | QQGVSMGRRSEIEAEAIKSGSVVTSVSVGGAAAYIASGEIEVPPSALVS* |
| Ga0066702_108211351 | 3300005575 | Soil | QGVSMGRRSEIEAEARKSGGVVTSVSVGGATAYIASGEIEVPPSALVS* |
| Ga0066702_108979812 | 3300005575 | Soil | RSEIEAEARKSDDVVTSVIVGGATTYVASGEIDVPPSALVS* |
| Ga0066691_106719873 | 3300005586 | Soil | QQGVLMGRRSDIEAEARKRDGVVTSVSVGGATTYIASGEIDVPPFALES* |
| Ga0070761_102106875 | 3300005591 | Soil | SMGRRSDIEAEARKRDDVVTSVSVGGATIYSASGEIEVPPSALVS* |
| Ga0066706_111684892 | 3300005598 | Soil | ARMRDGVVTSVSVGGATTYIASGEIEVPPFALVS* |
| Ga0070763_108069811 | 3300005610 | Soil | SIQQGVSMGRRSEIEAEARKSGNAVTSVSVGGATAYIASGEIEVPPSVLLS* |
| Ga0066903_1045792241 | 3300005764 | Tropical Forest Soil | QGVSMGRRSEIEAEARTSGGVVTSVSVGGATAYIASGEIEVPRSALVS* |
| Ga0074470_100634671 | 3300005836 | Sediment (Intertidal) | EARKSGGVVTSVSVGGATAYIASGEIEVPPSALVS* |
| Ga0068863_1013379792 | 3300005841 | Switchgrass Rhizosphere | EMEAQARKSGGVVTSVSVGGATAYIASGEIEVLPSALVS* |
| Ga0075030_1008326311 | 3300006162 | Watersheds | VSMGRRSEIEAEARKSGDVVTSVSVGGATAYIASGEIEVPPSALVS* |
| Ga0075018_107072642 | 3300006172 | Watersheds | AEARKSDGVVTSVSVGGATAHVASGEIDVPPSALVS* |
| Ga0075014_1001386893 | 3300006174 | Watersheds | IQQGVSMGRPSEMEAEARKSGSVVTSVSVGGATAHIASGEIEVPPSALVS* |
| Ga0070712_1003833801 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MGRRSEIEAEAHKSDGVVTSVSVSGATTYVASGEIEVPPSALAP* |
| Ga0070765_1014619432 | 3300006176 | Soil | QGVSMGRRSDIEAEARKRDGVVTSVSVGGATTYIASGEIEVPPSALVS* |
| Ga0068871_1006845713 | 3300006358 | Miscanthus Rhizosphere | VSIGRRSEIEAEARKSDGVVTSISVGGATARVASGEIDVPPSALVS* |
| Ga0074050_116857272 | 3300006577 | Soil | VSMGRGSEIDAEARKGRDVVTSVSVGGATAHIASGEIEVPPSALVS* |
| Ga0079222_122593171 | 3300006755 | Agricultural Soil | GVSMGRRSEIEAEARKSGSVVTSVSVGGAAAHIASGEIEVPLCALVS* |
| Ga0066659_110147521 | 3300006797 | Soil | MGRQSEIEAEARKSGNVVTSVSVGGATAYIASGEIEVPP |
| Ga0066660_103053071 | 3300006800 | Soil | QQGVSMGRRSQIEAEARKSGNVVTSVSVGGATAYIASGEIEVPPSALVS* |
| Ga0075425_1005061571 | 3300006854 | Populus Rhizosphere | MEAQARKSGGVVTSVSVGGATAYIASGEIEVPPFALVS* |
| Ga0075436_1009428291 | 3300006914 | Populus Rhizosphere | ARKSGGVVTSVSVGGATAYIASGEIEVPPFALAGLLV* |
| Ga0075436_1012647222 | 3300006914 | Populus Rhizosphere | SIQQGVSMGRRSEIEAEARKRDGVVTSVSVGGATAYIASGEIDVPPSALMS* |
| Ga0075436_1015369341 | 3300006914 | Populus Rhizosphere | GVLMGRRSEMEAQARKSGGAVTSVSVGGATAYVASGEIEVPPSALVS* |
| Ga0079219_122319222 | 3300006954 | Agricultural Soil | ETEARKRDGVVTSVSVGGATTYIASGEIEVPPSALES* |
| Ga0099827_112980532 | 3300009090 | Vadose Zone Soil | GRRSDIEAEARKRDGVVTAVSVGGATTYIASGEIEVPPFALVS* |
| Ga0105240_117200761 | 3300009093 | Corn Rhizosphere | GVSMLRPSEIEAEARMSGSVVTSVSVGGATAYIASGEIDVPPSALVS* |
| Ga0066709_1021577621 | 3300009137 | Grasslands Soil | YQQGVSMGRRSELEAEARKSGRVVTSVSVGGAAGNIASGEIEVPPSALVS* |
| Ga0066709_1033211992 | 3300009137 | Grasslands Soil | GRRSEMEAQARKSGGVVTSVSVGGATAYIASGEIEVPPFALVS* |
| Ga0099792_106410911 | 3300009143 | Vadose Zone Soil | EAEARKSDGVVTAVSVGGAAAYIASGEIEVPPSALVS* |
| Ga0099792_107352782 | 3300009143 | Vadose Zone Soil | EIEAEARKSGAVVTSVSVGGATANIASGEIEVPPSALVS* |
| Ga0099792_107778871 | 3300009143 | Vadose Zone Soil | GVSMGRRSEIEAEARKSGSVVTSVSVGGATTYIASGEIDVPPSALVS* |
| Ga0111538_136266102 | 3300009156 | Populus Rhizosphere | GVSMGRRSEIEAEARKSGGVVTSVSVGGATAYIASGEIEVPPSALVS* |
| Ga0105248_121514531 | 3300009177 | Switchgrass Rhizosphere | RRSEIEAEARMSGSVVTSVSVGGATAYIASGEIDVPPSALVS* |
| Ga0116102_11930051 | 3300009632 | Peatland | EARKSGSVVTSVSVGGATAYIASGEIEVPPSALVS* |
| Ga0116135_14186901 | 3300009665 | Peatland | MGRRSEIEAEARKSGSVVTSVSVGGATVWIASGEIEVPPSALVS* |
| Ga0116216_107606132 | 3300009698 | Peatlands Soil | DIEAEARKRAGVVTSVSVGGATAYIASGEIEVPPSAIVS* |
| Ga0126380_118126061 | 3300010043 | Tropical Forest Soil | QQGVSMGRRSEIEAEARKSDGVVTSVSVGGATAYVASGEIDVPSSALVS* |
| Ga0126382_111057252 | 3300010047 | Tropical Forest Soil | SIQQGVSMGRRSEIEAEARKSGSVVTSVSVGGATAYIASGEIDVPPSALVS* |
| Ga0126382_121545092 | 3300010047 | Tropical Forest Soil | GRRSDIEAEARKSDGVVTSVSVGGAAAYIASGEIEVPQSALVS* |
| Ga0134082_105481012 | 3300010303 | Grasslands Soil | QQGVLMGRRSEMEAEARKSGGVVTSVSVGGATAYIASGEIEVPPFALAS* |
| Ga0134064_104717981 | 3300010325 | Grasslands Soil | MGRRSEIEAEARKSGNVVTSVSVGGATAYIASGEIEVPPFARVS* |
| Ga0134080_103376041 | 3300010333 | Grasslands Soil | QQGVSMGRRSEIEAEARKSGSVVTSVSVGGATTYIASGEIDVPPSALVS* |
| Ga0134063_101654221 | 3300010335 | Grasslands Soil | PSEIEAEARMRGGVVTSVSVGGATTYIASGEIEVPPFTLVS* |
| Ga0134063_105636332 | 3300010335 | Grasslands Soil | MGRRSEMEAEARKSGGVVTSVSVGGATAYIASGDIEVPPFALVS* |
| Ga0134071_105023151 | 3300010336 | Grasslands Soil | MGRRSEIEAEARKSENVVSSVSVGGAAAYIASGEIEVPPSALCGPNRNQK* |
| Ga0074045_103691132 | 3300010341 | Bog Forest Soil | RRSDIEAEARKRDDIVTAVSVGGATTYIASGEIEVPPSALVS* |
| Ga0126370_113170501 | 3300010358 | Tropical Forest Soil | SEIEAEARKSGNVVTSVSVGGAATYIASGEIDVPPSALVYS* |
| Ga0126376_100598981 | 3300010359 | Tropical Forest Soil | QQGVSMGRRSEIEAEARKSGSVVTSVSVGGAAANIASGEIEVPPSALVS* |
| Ga0126376_130861912 | 3300010359 | Tropical Forest Soil | VSMGRRSEIEAEAQKSGSVVTSVSVGGATTYIASGEIDVPPSALVS* |
| Ga0126372_100646571 | 3300010360 | Tropical Forest Soil | QQGVSMGRRSEIEAEARKSGSVVTSVSVGGGTTYIASGEIDVPPSALVS* |
| Ga0126379_109937322 | 3300010366 | Tropical Forest Soil | LQGVSMGRRSEIEAEARKSGSVVTSVSIGGATSYVASGEIEVPPSALVS* |
| Ga0126379_114549891 | 3300010366 | Tropical Forest Soil | LTGRRSEIDAEARKSGGVVTSVSVGGATAYIASGEIEVPPSALVS* |
| Ga0134128_102555921 | 3300010373 | Terrestrial Soil | KADGVVTSVSVGGATTYVASGEIEVPPSALVSRTTG* |
| Ga0136449_1032827581 | 3300010379 | Peatlands Soil | IQQGVSMGRRSEIEAEARKSGGVVTSVSVGGATAYIASGEIEVPPSALVS* |
| Ga0134126_115951091 | 3300010396 | Terrestrial Soil | EARKADGVVTSVSVGGATTYVASGEIEVPPSALASRTTG* |
| Ga0126383_132563071 | 3300010398 | Tropical Forest Soil | IQQGVSMGRRSELEAEARKSGSVVTSVSVGGAAGNIASGEIEVPPSALVS* |
| Ga0134127_119756523 | 3300010399 | Terrestrial Soil | QGVSMGRPSEIEAQARKSGGVVTSVSVGGATSYVASGEIDVPPSALDICKEV* |
| Ga0134121_111515642 | 3300010401 | Terrestrial Soil | GVLMGRRSEMEAEARKSGGVVISVSVGGATAYVASGEIEVPPSALVS* |
| Ga0126350_101019791 | 3300010880 | Boreal Forest Soil | MGRRSDIEAEARKRDGLVTAVSVGGATTYIASGEIEVPPFALVS* |
| Ga0150983_148164391 | 3300011120 | Forest Soil | GRRSEIEAEARKSGSFVTSVRVGGATAYIASGEIEVPPSALVS* |
| Ga0137392_107369401 | 3300011269 | Vadose Zone Soil | EARKSDGVVTSVSVGGATAYVASGEIDVPPSALVS* |
| Ga0137393_115791521 | 3300011271 | Vadose Zone Soil | MGRRSEIEAEARKSGGVVTSVSVGGATAYIASGEIEVPPSALVS* |
| Ga0137389_104588711 | 3300012096 | Vadose Zone Soil | GVSMGRRSEIEAEARKSGNVVTSVSVGGATAYIASGEIEVPPFALES* |
| Ga0137383_105000162 | 3300012199 | Vadose Zone Soil | MGRRSEIEAEARKSGSVVTSVSVGGATTYIASGEIDVPPFALES* |
| Ga0137379_103456251 | 3300012209 | Vadose Zone Soil | EARKSDDVVTSVSVGGATTHVASGEIDVPPSALVS* |
| Ga0137379_109548932 | 3300012209 | Vadose Zone Soil | QGVSMGRRSEIEAEARKSDSVVTSVSVGGTTAYVASGEIEVPPSALES* |
| Ga0137384_109297722 | 3300012357 | Vadose Zone Soil | IEAEARKRDGVVTSVRVGGATTYIASGEIEVPPSALVS* |
| Ga0137361_100825111 | 3300012362 | Vadose Zone Soil | LSIQQGVSMGRRSEIEAEARKSDGVVTSVSVGGATAYIASGEIDVPPSALV* |
| Ga0137398_100310361 | 3300012683 | Vadose Zone Soil | AEARKSGSVVTSVSVGGATTYIASGEIDVPPSALVS* |
| Ga0137395_100275941 | 3300012917 | Vadose Zone Soil | ARKSGSVVTSVSVGGATTYIASGEIDVPPSALVS* |
| Ga0137413_116420482 | 3300012924 | Vadose Zone Soil | QQGVSMGRRSEIEAEARKRDDVVTSVSAGGATTYIASGEIEVPPFALES* |
| Ga0137404_101175671 | 3300012929 | Vadose Zone Soil | MGRRSEIEAEARKRDGVVTSVSVGCATTYIASGEIEVPPFALAS* |
| Ga0137404_105770391 | 3300012929 | Vadose Zone Soil | IEAEARKSGGVVTSVSVGGATAYIASGKIEVPPSALVS* |
| Ga0137410_118782441 | 3300012944 | Vadose Zone Soil | AEARKSGSVVTSVSVGGATAYMASGEIEVPLSALV* |
| Ga0126369_122391242 | 3300012971 | Tropical Forest Soil | EIEAEAHKSDGVVTSVSVGGAAARIASGEIEVPQSALLS* |
| Ga0134110_100503993 | 3300012975 | Grasslands Soil | QQGVLMGRRSEIEAEARKSGNVVTYVSVGGATAYIASDEIEVPPSALLS* |
| Ga0134110_103774631 | 3300012975 | Grasslands Soil | AEARKRDGVVTSVSVGGATTYIASGEIDVPPFALES* |
| Ga0134110_105215051 | 3300012975 | Grasslands Soil | EARKSGSVVTSVSVGGATTYIASGEIEVPPFALVS* |
| Ga0134087_102313961 | 3300012977 | Grasslands Soil | IEAEARKSGNVVTSVSVGGATAYIASGEIEIPPSALLS* |
| Ga0164308_116136112 | 3300012985 | Soil | SMGHRSEIEAEARKRDDLMTSVGVGAATTYIASGEIEVPPSGLVS* |
| Ga0164308_116318992 | 3300012985 | Soil | IGRRSEMEAEARKSGGVVTSVSVGGATTHIASGEVEVPPSALQS* |
| Ga0164305_107485691 | 3300012989 | Soil | IEAEARKSGSVVTSVSVGGATTYIASGEIDVPPFALES* |
| Ga0157370_105458443 | 3300013104 | Corn Rhizosphere | LMGRRSEIEAEARKSGSAVTSVSVGGVAAHIASGEIEVPPSALVSQ* |
| Ga0157370_108866791 | 3300013104 | Corn Rhizosphere | MGRRSEIEAEARKSGSVVTSVSVGGVAAHIASGEIEVPPSAL |
| Ga0134078_100059361 | 3300014157 | Grasslands Soil | IEAEARKSGSVVTSVSVGGATTYIASGEIDVPPSALVS* |
| Ga0181529_106089051 | 3300014161 | Bog | AEARKSGGVVTSVSVGGATAYIASGEIEVPPSALVS* |
| Ga0181532_106106712 | 3300014164 | Bog | RSEIEAEARKSGGVVTSVSVGGATAYIASGEIEVPPSALVS* |
| Ga0181531_108216532 | 3300014169 | Bog | SIQQGVTMGRRSEIEAEARKSGGVVTSVSVGGATAYIASGEIEVPASALMS* |
| Ga0181516_102651061 | 3300014655 | Bog | GVSMGRRSEIEAEARKSGGVVTSVSVGGATAYIASGEIDVPPSALVS* |
| Ga0134073_103944281 | 3300015356 | Grasslands Soil | MGRRSEIEAEARKSGNVVTYVSVGGATAYIASDEIEVPPSALLS* |
| Ga0132256_1011579621 | 3300015372 | Arabidopsis Rhizosphere | QGVLMGRRSEMEAEARKSGGVVTSVSVGGATAYVASGEIEVPPSALVS* |
| Ga0132257_1030674881 | 3300015373 | Arabidopsis Rhizosphere | SEIEAEARKSGSVVTSVSVGGATTYIASGEIDVPPSALVS* |
| Ga0132257_1041305211 | 3300015373 | Arabidopsis Rhizosphere | QQGVFMGRRSEMEAQARKSQGVVTSVSVGGATAYIASGEIEVPAFALMS* |
| Ga0182036_103542121 | 3300016270 | Soil | GRRSEIEAEARKTGSVVTSVSVRGATAYIASGEIDVPPSALVS |
| Ga0182041_104229793 | 3300016294 | Soil | QGVSMGRRSEMEAEARKNGSVVTSVSVGGATAYVASGEIDVPPSALVS |
| Ga0182041_108956001 | 3300016294 | Soil | PSEIEAAARKSGSIVTSVSVGGATAYIASGEIDVPPSALVS |
| Ga0182041_123149241 | 3300016294 | Soil | AEARKSGSVVTSVSVGGATSYVASGEIEVPPSALVS |
| Ga0182032_105151691 | 3300016357 | Soil | SMGRRSEIEAEARKSGSVVTSVSVGGATSYVASGEIEVPPSALVS |
| Ga0182040_115117782 | 3300016387 | Soil | RRSKIEAEARKSGSVVTSVSVGGAAANIASGEIEVPPSALVS |
| Ga0182038_114366142 | 3300016445 | Soil | EIEAEARKSGSVVTSVSVGGAAANIASGEIEVPPSALVS |
| Ga0182038_117064822 | 3300016445 | Soil | EIEAEARKSGSVVTSVSVGGATSYVASGEIEVPPSALVS |
| Ga0134112_101715252 | 3300017656 | Grasslands Soil | MGRRSEIEAEARKSGNVVTSVSVGGATAYIASGEIEIPPSALLT |
| Ga0187802_100764582 | 3300017822 | Freshwater Sediment | DAEARKSGGVVTSVSVGGATAYIASGEIEVPPSALVS |
| Ga0187824_102143172 | 3300017927 | Freshwater Sediment | SIQQGVSMGRRSEIEAEARRSAGAVTSVSVGGATAYIASGEIEVPPSALVS |
| Ga0187848_104323531 | 3300017935 | Peatland | AEARKSGGVVTSVSVGGATAYIASGEIEVPPSALVS |
| Ga0187821_105154822 | 3300017936 | Freshwater Sediment | RSEIEAEARKSGSVVTSVSVGGAAAYIASGEIEVPPSALVP |
| Ga0187775_100927752 | 3300017939 | Tropical Peatland | IQQGVSMGRRSEIEAEARKSGSVVTSVSVGGAAASIASGEIEVPPSALVS |
| Ga0187853_100151227 | 3300017940 | Peatland | VARKRDGVVTSVSVGGATAYIASGEIDVPPVALVS |
| Ga0187879_102308561 | 3300017946 | Peatland | IQQGVSMGRRSEIEAEARKSGSVVTSVSVGGATAYMASGEIEVPPSALVS |
| Ga0187879_106772232 | 3300017946 | Peatland | GVSMGRRSEIEAEARKSGSVVTSVSVGGATAYIASGEIEVPPSALVS |
| Ga0187817_104141861 | 3300017955 | Freshwater Sediment | EADARKSGGVVTSVSVGGAAANVASGEIEVPPSALVS |
| Ga0187779_106044671 | 3300017959 | Tropical Peatland | SIQQGVSMGRRSEIEAEARRSGGAVTSVSVGGATAYIASGEIEVPPSALVS |
| Ga0187778_103546572 | 3300017961 | Tropical Peatland | SIGRRSEIEAEARKSDGVVTSVSVGGATAYVASGEIDVPPSALVS |
| Ga0187776_104483442 | 3300017966 | Tropical Peatland | VSMGRRSEIEAEARKSGSVVTSVSVGGATAYIASGEIDVPPSALLS |
| Ga0187781_101296811 | 3300017972 | Tropical Peatland | MGRRSEIEAEAHKSGSVVTSVSVGGATAYIASGELDVPPSALVS |
| Ga0187777_113993741 | 3300017974 | Tropical Peatland | EAEARKSGSVVTSVSVGGATSYIASGEIEVPPSALVS |
| Ga0181520_104438891 | 3300017988 | Bog | DIEAEARKRDDRMTSVSVGGATTYVASGEIDVPSFALEQ |
| Ga0181520_109801721 | 3300017988 | Bog | IEAEARKSGGVVTSVSVGGATAYIASGEIEVPPSALVS |
| Ga0187823_100921271 | 3300017993 | Freshwater Sediment | ILQGVSMGRRSEIEAEARKSGSVVASVSVGGATSYIASGEIEVPPSALVS |
| Ga0187888_12331572 | 3300018008 | Peatland | SILQGVSMGRRSEIEAEARKSGGVVTSVSVGGATAYIASGEIEVPPSALVS |
| Ga0187874_100133497 | 3300018019 | Peatland | LSIQQGVSMGRRSEIEAVARKRDGVVTSVSVGGATAYIASGEIDVPPVALVS |
| Ga0187863_103864882 | 3300018034 | Peatland | QQGVSMGRRSEIEAEARKSGGVVTSVSVGGATAYIASGEIEVPPSALVS |
| Ga0187863_104357851 | 3300018034 | Peatland | SEIEAEARKSGGVVTSVSVGGATAYIASGEIEVPPSALLS |
| Ga0187855_100174351 | 3300018038 | Peatland | RSEIEAEARKSGGVVTSVSVGGATAYIASGEIEVPPSALVS |
| Ga0187862_104034561 | 3300018040 | Peatland | SEIEAEARKSGGVVTSVSVGGATAYIASGEIEVPPSALVS |
| Ga0187871_103433802 | 3300018042 | Peatland | QQGVSMGRRSEIEAEARKSGGVVTSVSVSGATAYIASGEIEVPPSALVS |
| Ga0187890_100440961 | 3300018044 | Peatland | EIEAVARKRDGVVTSVSVGGATAYIASGEIDVPPVALVS |
| Ga0187858_106225762 | 3300018057 | Peatland | LSIQQGVSMGRRSEIEAEARKNDGVVTSVSVGGATAYVASGEIDVPPSALVS |
| Ga0187766_107924201 | 3300018058 | Tropical Peatland | GVSMGRRSEIDAEARKDRGVVTSVSVGGAAAHIASGEIEVPPSALVS |
| Ga0187772_110176892 | 3300018085 | Tropical Peatland | IEAEARKSGSVVTSVSVGGAAANIASGEIEVPPSALVS |
| Ga0187769_101006393 | 3300018086 | Tropical Peatland | SIQQGVSMGRRSEIEAEARKSGSVVTSVSVGGAAANIASGEIEVPLSALV |
| Ga0187771_116579181 | 3300018088 | Tropical Peatland | AEARKSGSVVTSVSVGGAAANIASGEIEVPPSALVS |
| Ga0187774_103095691 | 3300018089 | Tropical Peatland | GVSMGRRSEIEAEARKSGSVVTSVSVGGATAYIASGEIDVPPSALVS |
| Ga0187770_101594423 | 3300018090 | Tropical Peatland | IEASARKANGAVTSVSVSGAVAYVASGEIEAPGSMPPV |
| Ga0066655_104955031 | 3300018431 | Grasslands Soil | EIEAEARMRDGVVTSVSVGGATTYIASGEIEVPPFALVS |
| Ga0066655_109409831 | 3300018431 | Grasslands Soil | MGRRSEIEAEARKSGSVVTSVTVGGATTYIASGEIDVPPSALVS |
| Ga0066667_103162784 | 3300018433 | Grasslands Soil | QQGVLMGRRSDIEAEARKRDGVVTSVSVGGATTYIASGEIEVPPYALVS |
| Ga0066667_103512361 | 3300018433 | Grasslands Soil | IQQGVSMGRRSEIEAEARKSGSVVTSVSVGGATTSIASGEIDVPPSALVS |
| Ga0066667_107786361 | 3300018433 | Grasslands Soil | QQGVLMGRRSEIEAEARKSGNVVTSVSVGGATAYIASGEIEVPPFALES |
| Ga0182031_12586953 | 3300019787 | Bog | GRRSEIEAEARKSEDIVTSVSVSGATVYIASGEIEVPPSALVS |
| Ga0187768_10447593 | 3300020150 | Tropical Peatland | RSEIDAEARKSGGVVTSVRVGGATTYIASGEIEVPPFALVS |
| Ga0179592_100366845 | 3300020199 | Vadose Zone Soil | EAGARKRDGVVTSVSVGGATFYIASGEIEVPPSALVS |
| Ga0210407_105687251 | 3300020579 | Soil | QQGVSMGRRSDIEAEAHKRDGMVTSVSVGGATTYIASGEIEVPPSALVS |
| Ga0210403_106421141 | 3300020580 | Soil | RRSEIEAEARKSGSVVTSVSVGGATTYIASGEIEVPPFALES |
| Ga0210403_115336422 | 3300020580 | Soil | SEIEAEARKSGSVVTSVSVGGATTYIASGMIDVPPFALES |
| Ga0210399_109932212 | 3300020581 | Soil | EARKSGSVVTSVSVGGATTYIASGEIDVPPSALVS |
| Ga0210401_109622042 | 3300020583 | Soil | RRSEIEAEARKSGSVVTSVSVGGATTYIASGMIDVPPFALES |
| Ga0210401_111933111 | 3300020583 | Soil | EARKSESVVTSVSVGGATTYIASGEIDVPPSALVS |
| Ga0210406_109609192 | 3300021168 | Soil | LSIEQGVSMGRRSDIEAEARKRDGVVTSVSVGGATTYIASGEIEVPPFALVS |
| Ga0210400_103824111 | 3300021170 | Soil | GVSMGRRSDIEAEARKRDGVVTSVSVGGATTYIASGEIEVPPFALVS |
| Ga0210400_105048201 | 3300021170 | Soil | GRRSDIEAEARKRDGVVTSVSVGGATTYIASGEIEVPPFALES |
| Ga0210400_109270391 | 3300021170 | Soil | RSEIEAEARKSGGVVTSVSLGRATAYIASGEIEVPPSALVS |
| Ga0210408_100737086 | 3300021178 | Soil | AEARKSGSVVTSVSVGGAAANVASGEIEVPPSALVS |
| Ga0210408_111028822 | 3300021178 | Soil | QQGVSMGRRSEIEAEARKSGSVVTSVSVGGAAAHIASGEIEVPPSALVS |
| Ga0210396_102709593 | 3300021180 | Soil | AEARKSGGVVTSVSVGGATTYVASGEIEVPLSALES |
| Ga0210396_113348031 | 3300021180 | Soil | SMGRRSEIEAEARKSGSVVTSVSVGGATTYIASGEIDVPPSALVS |
| Ga0210396_117242362 | 3300021180 | Soil | SMGRRSEIEAEARKSGSVVTSISVGGAAAYIASGEIEVPPSALES |
| Ga0213876_103507202 | 3300021384 | Plant Roots | SEIEAEARKSGSVVTSVSVGGATTYIASGEIEVPPSALMS |
| Ga0210393_116695862 | 3300021401 | Soil | LSIQQGVSMGRRSDIEAGARKRDGVVTSVSVGGATTYIASGEIEVPPLALVS |
| Ga0210387_115591401 | 3300021405 | Soil | SAIETEAHKRDGVVTAVSVGGATTYIASGEIDVPPFALVS |
| Ga0210386_111827792 | 3300021406 | Soil | SIQQGVLMGRRSDIEAEARKSGSVVTSVSVGGATTYIASGEIDVPPSALVS |
| Ga0210394_100260546 | 3300021420 | Soil | QQGVLMGRRSEIEAEARKSGGVVTSVSVGGATAYIASGEIEMPPSALVS |
| Ga0210384_107258171 | 3300021432 | Soil | EAHKRDGMVTSVSVGGATTYIASGEIEVPPSALVS |
| Ga0210384_111628301 | 3300021432 | Soil | EARKRDGVVTSVSVGGATTYIASGEIEVPPFALVS |
| Ga0210384_114891222 | 3300021432 | Soil | AEARKSGSVVTSVSVGGATVSIARGEIEVPPSALVS |
| Ga0210391_105152692 | 3300021433 | Soil | SMGRRGEIEAPARKSEGGVTSVSVGGATAYIASGEIEVPRSALVS |
| Ga0210391_110592692 | 3300021433 | Soil | MGRRSEIEAEARKSGNVVTSVSVGGATTYIASGEIDVPPFALESC |
| Ga0210391_111232042 | 3300021433 | Soil | DIEAEARKRDDVVTSVSVGGATTYIASGEIEVPPFALVS |
| Ga0213879_100545141 | 3300021439 | Bulk Soil | RRSEIEAEARKSGSVVTSVSVGGATSYIASGEIEVPPAALVS |
| Ga0213879_101523212 | 3300021439 | Bulk Soil | IEAEARKSGSVVTSVSVGGATSYIASGEIEVPRSALVS |
| Ga0213879_102667831 | 3300021439 | Bulk Soil | AEARKSGSVVTSVSVGGATSYIASGEIEVPPSALVS |
| Ga0210390_105449172 | 3300021474 | Soil | GVSMGRRSEIEAEARKSGNVVTSVSVGGATTYIASGAIDVPPFALES |
| Ga0210390_112230662 | 3300021474 | Soil | IQQGVSMGRRSEIEAEARKSGSVVTSVSVGGATTYVASGMIYVPPFALES |
| Ga0210402_102112033 | 3300021478 | Soil | QGVLMGRRSEIEAEARKRDGVVTSVSVGGATTYIASGEIEVPPSALVS |
| Ga0210410_113621811 | 3300021479 | Soil | GVSMGRRSESEAVARKSGSVVTSVSVGGATAYIASGEIEVPLSALVS |
| Ga0210409_101540121 | 3300021559 | Soil | LSIQQGVSMGRRSEIEAEARKSDGVVTSVSVGGTTVYIASGEIDVPPSALV |
| Ga0210409_103723791 | 3300021559 | Soil | QQGVSMGRRSEIEAEARKSGSVVTSVSVGGATAYIASGEIDVPPSALVS |
| Ga0210409_112465191 | 3300021559 | Soil | EAEARKSGSVVTSVSVGGAAAHIASGEIEVPPSALVS |
| Ga0210409_113019771 | 3300021559 | Soil | QQGVLMGRRSDIEAEARNSGSVVTSVSVGGATTYIASGEIDVPPSALVS |
| Ga0213852_12498332 | 3300021858 | Watersheds | EAEARKSGGVVTSVSVGGATAYIASGEIEVPPSALVS |
| Ga0242655_100407821 | 3300022532 | Soil | VSMGRRSEIEAVARKSGSVVTSVSVGGATAYIASGEIEVPLSALVS |
| Ga0242653_10119231 | 3300022712 | Soil | GRRSEIEAVARKSGSVVTSVSVGGATAYIASGEIEVPLSALVS |
| Ga0242665_101335962 | 3300022724 | Soil | IQQGASMGRRSEIEAEARKSGSVVTSVSVGGATTYIASGEIDVPPSALVS |
| Ga0233356_10452411 | 3300023046 | Soil | GVSMGRRSEIEAEARKSDDVVTSVSVGGATTYVASGEIDVPPSALVS |
| Ga0247695_10439651 | 3300024179 | Soil | EAEARKSGSVVTSVSVGGAAANIASGEIEVPPSALVS |
| Ga0247671_10321782 | 3300024284 | Soil | SMGRRSEIEAEARKSGSVVTSVSVGGAAANIASGEIEVPPSALVS |
| Ga0207695_115415542 | 3300025913 | Corn Rhizosphere | GVSMLRPSEIEAEARMSGSVVTSVSVGGATAYIASGEIDVPPSALVS |
| Ga0207652_108537082 | 3300025921 | Corn Rhizosphere | IEAEARKCGSVVTSVSVGGATAYIATGAIEVPPSALVS |
| Ga0207644_116229952 | 3300025931 | Switchgrass Rhizosphere | EAEARKSRGVVNSVSVGGATACIASGEIEVPPFALAS |
| Ga0207704_103204311 | 3300025938 | Miscanthus Rhizosphere | SMGRRSEIEAEARMSGSVVTSVSVGGATAYIASGEIDVPPSALVS |
| Ga0207661_105502671 | 3300025944 | Corn Rhizosphere | SDGVVTSVSVGGATAYVASGEIDVPPSALVSRAGRA |
| Ga0207641_115181361 | 3300026088 | Switchgrass Rhizosphere | IEAEARMSGSVVTSVSVGGATAYIASGEIDVPPSALVS |
| Ga0209240_10838112 | 3300026304 | Grasslands Soil | DIEAEARKRDGVVTAVSVGGATTYTASGEIEVPPFALVS |
| Ga0209688_10939432 | 3300026305 | Soil | MGRRSDIEAEARKRDGVVTSVSVGGATTYIASGEIDVPPFALES |
| Ga0209265_10830002 | 3300026308 | Soil | MGRRSQIEAEARKSGNVVTSVSVGGATADIASGEIEVPPSALVSQTSK |
| Ga0209055_12287451 | 3300026309 | Soil | EIEAEALKSGGVVTSVSVGGAAAYIASGEIEVPPSALVS |
| Ga0209153_10376384 | 3300026312 | Soil | DIEAEARKRDGVVISVSVGGATTYIASGEIDVPPFALES |
| Ga0209471_11156672 | 3300026318 | Soil | MGRRSEIEAEARKSGNVVTSVSVGGATAYIASGEIEVPPFALES |
| Ga0209687_10082291 | 3300026322 | Soil | MGRRSEIEAEARKSGNVVTSVSVGGPTAYIASGEIEIPPSALLS |
| Ga0209801_10753493 | 3300026326 | Soil | QAEARMRDGVVTSVSLGGATTYIASGEIEVPPSALVS |
| Ga0209473_12524711 | 3300026330 | Soil | GVLMGRRSDIEAEARKSDGVVTSISVGGAAAYIASGEIEVPQSALVS |
| Ga0209267_12695292 | 3300026331 | Soil | VSMGRPSEIEAEARMRDGVVTSVSVGGATTYIASGEIEVPPFTLVS |
| Ga0209057_10214006 | 3300026342 | Soil | AEARKSGSVVTSVSVGGAAANIASGEIEVPPSALES |
| Ga0257146_10439822 | 3300026374 | Soil | EARKSGGVVTSVSVGGATAYIASGEIEVPPSALVS |
| Ga0257168_10363812 | 3300026514 | Soil | EARMRDGVVTSVSVGGATTYIASGEIEVPPFALVS |
| Ga0209808_11996101 | 3300026523 | Soil | MGRRSEIEAEARKSGNVVTSVSVGGATAYIASGEIEVPRSALL |
| Ga0209690_12046792 | 3300026524 | Soil | MGRPSEIEAEARMRDGVVTSVSVGGATTYIASGEIEVPPFTLVS |
| Ga0209161_101076131 | 3300026548 | Soil | IQQGVLMGRRSEIEAEARKSGNVVTSVSVGGATAYIASGEIEIPPSALLS |
| Ga0179593_11704165 | 3300026555 | Vadose Zone Soil | GVSMGRRSDIEAEARKRDGVVTAVSVGGATTYIASGEIEVPPFALVS |
| Ga0179587_100589701 | 3300026557 | Vadose Zone Soil | RCDIEAGARKRDGVVTSVSVGGATFYIASGEIEVPPSALVS |
| Ga0179587_102725632 | 3300026557 | Vadose Zone Soil | MGRRSEIEAKARKRDGVVTSVSVGGATTYIASGEIEVPPFALVS |
| Ga0209179_11208221 | 3300027512 | Vadose Zone Soil | AEARKRDGVVTAVSVGGATTYIASGEIEVPPFALVS |
| Ga0209735_10218361 | 3300027562 | Forest Soil | EAEARKRDGVVTSVSVGGATTYIASGEIEVPPFALES |
| Ga0209115_11232771 | 3300027567 | Forest Soil | SMGRRSEIEAEARKSGNVMTSVSVGGATTYIASGEIEYSGAKTT |
| Ga0209003_10507021 | 3300027576 | Forest Soil | MGRRSEIEAEARKSGSIVTSVSVGGATTYIASGEIDVPPSALVS |
| Ga0209733_11778131 | 3300027591 | Forest Soil | GVSMGRRSEIEAEARKSGSVVTSVSVGGATTYIASGEIDVPPFALES |
| Ga0209736_10038371 | 3300027660 | Forest Soil | RSEIEAEARTSGSVVTSVSVGGATTYIASGEIDVPPFALES |
| Ga0209588_10458263 | 3300027671 | Vadose Zone Soil | IQQGVSMGRRSDIEAEARKRDGVVTAVSVGGATTYIASGEIEVPPFALVS |
| Ga0209177_100255733 | 3300027775 | Agricultural Soil | RSEIEAEAGKSGNVVTSVSVGGATAYIASGEIEVPPSALVS |
| Ga0209074_100176814 | 3300027787 | Agricultural Soil | SMGRRSELEVEARKSGNVVTSVSVGGAAAYIASGEIEVPPSALVTREAQ |
| Ga0209580_104950382 | 3300027842 | Surface Soil | RRSEIEAEARKRDGVVTSVSVGGATTYIASGEIEVPPSALVS |
| Ga0209274_103824911 | 3300027853 | Soil | GRRSEIEAEARKSGSVVTSVSVGGATAYIASGEIEVPPSALVS |
| Ga0209693_100950253 | 3300027855 | Soil | IQQGVSMGRRSEIEAEARKSGGVVTSVSVGGATAYIASGEIEVPPSALVS |
| Ga0209701_101625361 | 3300027862 | Vadose Zone Soil | PSEIEAEARMRDGVVTSVSVGGATTYIASGEIEVPPFALVS |
| Ga0209380_106632982 | 3300027889 | Soil | GVSMGRRSEIEAEARKSGGVVTSVSVGGATAYIASGEIEVPPSALVS |
| Ga0209488_103513061 | 3300027903 | Vadose Zone Soil | MGRRSEIEAEARKSDGVVTSVSVGGTTVYIASGEI |
| Ga0209583_100352203 | 3300027910 | Watersheds | SEIEAEARKSDGVVTSVSVGGTTVYIASGEIDVPPSALV |
| Ga0268264_115435551 | 3300028381 | Switchgrass Rhizosphere | MGRRSQIEAEARKNGGVVTSVSVGGATAYIASGEIEVLPSALVS |
| Ga0268264_126918601 | 3300028381 | Switchgrass Rhizosphere | SEIEAEARMSGSVVTSVSVGGATAYIASGEIDVPPSALVS |
| Ga0302152_101388621 | 3300028572 | Bog | GRRSEIEAEARKSDGVVTSVSVGGATAYVASGEIDVPPSALVS |
| Ga0302220_100970071 | 3300028742 | Palsa | MGRRSEIEAEARKSDGVVTSVSVGGATAYVASGEIDVPPSALVS |
| Ga0302233_101711872 | 3300028746 | Palsa | MGRRSDIEAEARKRDDVVTSVSVGGATTYIASGEIDVPPSALVS |
| Ga0302219_100762801 | 3300028747 | Palsa | IQQGVSMGRRSEIEAEARKSGGVVTSVSVSGATAYIASGEIEVPPSALVS |
| Ga0302224_102381041 | 3300028759 | Palsa | SMGRRSEIEAEARKSDGVVTSVSVGGATAYVASGEIDVPPSALVS |
| Ga0302225_102757802 | 3300028780 | Palsa | IQQGVSMGRRSDIEAEARKRDDVVTSVSVGGATTYSASGEIEVPPSALVS |
| Ga0302225_103596211 | 3300028780 | Palsa | EARKRDGVVTSVSVGGATTYIASGEIEVPPSALVS |
| Ga0302222_101759531 | 3300028798 | Palsa | IDAEARKRDDVVTSVSVGGATAYVASGEIEVPPSALVS |
| Ga0302226_102851182 | 3300028801 | Palsa | EIEAEARKSAGLVTSVSVSGATAYIASGDIEVPPSALVS |
| Ga0302146_102740591 | 3300028867 | Bog | EIEAEARNIGGVVTSVSVGGATAYIASGEIEVPPSALTS |
| Ga0222749_106691811 | 3300029636 | Soil | RSEIEAEARKSGGVVTSVSVGGATAYIATGEIEVPASALVS |
| Ga0311352_112213862 | 3300029944 | Palsa | AEARKRGGVVTSVSVSGATTYIASGEIEVPPFSLES |
| Ga0311330_111995262 | 3300029945 | Bog | ARKSGSVVSSVSVGGATAYIASGEIEVPPSALLVS |
| Ga0311342_106059592 | 3300029955 | Bog | EARKHNDVVTSISVGGATTYIASGEIEVPGFALES |
| Ga0311342_110089741 | 3300029955 | Bog | AHARKRDGVVTSVSVGGATTDIASGEIEVPPSALAS |
| Ga0302304_101580812 | 3300029993 | Palsa | SMGRRSDIEAEARKRDGVVTSVSVGGATTYIASGEIEVPPSVLVS |
| Ga0311339_100520098 | 3300029999 | Palsa | QGVSMGRRSEIEAEARKRDEVVTSVSVGGATTYIASGEIEVPPSALVS |
| Ga0311339_113089041 | 3300029999 | Palsa | GRRSEIEAEARKSGSVVTSVSVGGATVYIASGEIEVPPSALLS |
| Ga0311338_119734312 | 3300030007 | Palsa | ILQGVSMGRRSEIEAEARKSEGVVTSVSVGGATVYIASGEIEVPPSALVS |
| Ga0302306_102170652 | 3300030043 | Palsa | LSIQQGVSMGRRSDIEAEARKREGVVISVSVGGATTYIASGEIDVPSFALES |
| Ga0302182_102231361 | 3300030054 | Palsa | GVSMGRRSDIEAEARKRDDVVTSVSVGGATTYSASGEIEVPPSALVS |
| Ga0302176_100081661 | 3300030057 | Palsa | LEAEARKRDDVVTSVSVAGPTAYVASGEIEVPPSALVS |
| Ga0311353_111507902 | 3300030399 | Palsa | GRRSDIEAKARKRDDVVTSVSVGGATAYVASGEIEVPPSALVS |
| Ga0302183_103686541 | 3300030509 | Palsa | VSMGRRSEIEAEARKSDGVVTCVSVGGATAYVASGEIEVPPSALVS |
| Ga0311372_110457754 | 3300030520 | Palsa | EIEAEARKSGSVVTSVSVAGGTAYIASGEIEVPPSALVS |
| Ga0311357_100590078 | 3300030524 | Palsa | RSELEAEARKRDDVVTSVSVAGPTAYVASGEIEVPPSALVS |
| Ga0311357_112054711 | 3300030524 | Palsa | EIEAEARKSGSVVTSVSVGGATAYIASGEIEVPPSALVS |
| Ga0311356_117752811 | 3300030617 | Palsa | EAEARKSGAVVTSVSVGGATSYIASGEIDVPTSALVS |
| Ga0311354_107698002 | 3300030618 | Palsa | DIEAEASKQDGIVSAVRVRGATTYIASGEIDVPPSALVS |
| Ga0265462_113204851 | 3300030738 | Soil | QQGVSMGRRSEIEAEARKRDDVVTSVSVGGATTYIASGELDVPPFALAS |
| Ga0073994_123932452 | 3300030991 | Soil | QGVSMGRRSEIEAEARKSGSVVTSVSVGGATAYIASGEIDVPTSALVS |
| Ga0170834_1025260511 | 3300031057 | Forest Soil | RRSEIEAEARKRDGVVTSVSVGGATAYIASGEIDVPPSVLMS |
| Ga0170834_1118113822 | 3300031057 | Forest Soil | MGRRSEIEAEARKSGAVVTSVSVGGATAYIASGEFDVPPSALVS |
| Ga0170834_1128418162 | 3300031057 | Forest Soil | MGRRSDIEAEARKSDGVVTSVSVGGATTYIASGEIEVPPSALVC |
| Ga0170822_168830412 | 3300031122 | Forest Soil | GRRSDIEAEARKRDGVVTAVNVGGATTYIASGEIEVPPFALES |
| Ga0170824_1071799572 | 3300031231 | Forest Soil | IEAEARKLDGVVTSVSVGGATTYIASGEIEVPPSALVS |
| Ga0170824_1238754921 | 3300031231 | Forest Soil | RSEIEAEARKSGGVVSCVSVGGATAYIASGEIEVPPSALVS |
| Ga0302325_128605811 | 3300031234 | Palsa | SMGRRSEIEAEARKSGSVVTSVSVGGATVYIASGEIEVPPSALLS |
| Ga0302324_1002598085 | 3300031236 | Palsa | VSMGRRSEIEAEARKSGSVVTSVSVAGGTAYIASGEIEVPPSALVS |
| Ga0302324_1025017321 | 3300031236 | Palsa | EIEAEARKSGSVVTSVSVGGATVYIASGEIEVPPSALLS |
| Ga0302318_104758981 | 3300031258 | Bog | QARKRDGVVTSVSVGGATTDIASGEIEVPPSALAS |
| Ga0318538_100433864 | 3300031546 | Soil | QQGVSMGRRSEIEAEARKSGSVVTSVSVGGAAANIASGEIEVPPSALVS |
| Ga0318571_103214241 | 3300031549 | Soil | RRSEIEAEARKTGSVVTSVSVRGATAYIASGEIDVPPSALVS |
| Ga0318515_107623531 | 3300031572 | Soil | GVSMGRRSEIEAEARKSGSVVTSVSVGGAAANIASGEIEVPPSALVS |
| Ga0310686_1016618621 | 3300031708 | Soil | LSIQQGVSMGRRSDIEAEARKRDDVVISVSVGGTTTYIASGEIEVPPSALVS |
| Ga0307476_111279902 | 3300031715 | Hardwood Forest Soil | VSMGRRSDIEAEARKRDDVVTSVSVGGATAYLASGEIEVPPSALVS |
| Ga0307476_112613661 | 3300031715 | Hardwood Forest Soil | SEIEAEARKSGGVVTSVSVGGATAYIASGEIEVPPSGLVS |
| Ga0307474_106825982 | 3300031718 | Hardwood Forest Soil | EARKSGGVVTSVSVGGATAYIASGEIEVPPSGLVSY |
| Ga0306917_102218781 | 3300031719 | Soil | GVSMGRRSEIEAEARKTGSVVTSVSVRGATAYIASGEIDVPPSALVS |
| Ga0318501_100797541 | 3300031736 | Soil | LQGVSMGRRSEIEAEARKSGSVVTSVSVGGATSYIASGEIEVPPSALVS |
| Ga0307468_1005442611 | 3300031740 | Hardwood Forest Soil | QGVSMGRRSEIEAEARKNGAVVTSVSVGGATAYIASGEIDVPPSALVS |
| Ga0318502_106728441 | 3300031747 | Soil | MGRRSEIEAEARKSGSVVTSVSVGGATAYIASGEIHVPPSALVS |
| Ga0318492_105698132 | 3300031748 | Soil | AVGRRSEIEAEARKSGSVVTSVSVGGATSYIASGEIEVPLSALVS |
| Ga0307477_105660091 | 3300031753 | Hardwood Forest Soil | VQQGVLMGRRSDIDAEARKRDGVVTSVSVGGATTYIASGEIDVPPFALES |
| Ga0307475_109165703 | 3300031754 | Hardwood Forest Soil | QGVSMGRRSEIEAEARKSGSVVTSVSVGGAAANIASGEIEVPSSALLS |
| Ga0307475_112188132 | 3300031754 | Hardwood Forest Soil | MGRRSELEAEARKSGSVVTSVSVGGATTYIASGEIDVPPSALVS |
| Ga0302319_102335201 | 3300031788 | Bog | SMGRRSDIEAEARKRHDVVTSVSVGGATTYVASGEIDVPPFALVS |
| Ga0307478_110751951 | 3300031823 | Hardwood Forest Soil | QQGVSMGRRSEIEAEARKSGSVVTSVSVGGAAAYIASGEIEVPPSALVSQTTG |
| Ga0307478_110766592 | 3300031823 | Hardwood Forest Soil | DIDAEARKREGVVTSVSVGGATTYVASGEIDVPPFALES |
| Ga0302315_104537102 | 3300031837 | Palsa | QQGVSMGRRSDIEAEARKRDGVVISVSIGGATTYIASGEIDVPSFALES |
| Ga0306923_109457671 | 3300031910 | Soil | AEARKTGSVVTSVSVRGATAYIASGEIDVPPSALVS |
| Ga0306923_111856801 | 3300031910 | Soil | GRTSEIEAEARKSGSVVTSVSVGGAAAYIASGEIEVPPSALVS |
| Ga0318530_101588282 | 3300031959 | Soil | SILQGVAVGRRSEIEAEARKSGSVVTSVSVGGATSYIASGEIEVPLSALVS |
| Ga0318530_101971722 | 3300031959 | Soil | QGVSMGRRSEIEARARKSGGIVTSVSVGGATAYVASGEIEVPPSALVS |
| Ga0307479_104998963 | 3300031962 | Hardwood Forest Soil | EACKSGSVVTSVSVGGATVRIASGEIEVPPSALVS |
| Ga0307479_107907962 | 3300031962 | Hardwood Forest Soil | QGVSMGRRSEIEAEARKSGSVVTSVSVGGAAANIASGEIEVPPSALVS |
| Ga0306922_117395102 | 3300032001 | Soil | GVSIGRRSEIEAEARKSDGVVTSVSVGGATAYVASGEIDVPPSALVS |
| Ga0318559_101613892 | 3300032039 | Soil | VGRRSEIEAEARKSGSVVTSVSVGGATSYIASGEIEVPPSALVS |
| Ga0318549_103201661 | 3300032041 | Soil | LQGASMGRRSEIEAEARKSGSVVTSVSVGGATSYVASGEIEVPPSALVS |
| Ga0318556_102711952 | 3300032043 | Soil | IQQGVSMGRRSEIEARARKSGGIVTSVSVGGATAYVASGEIEVPPSALVS |
| Ga0318506_105160031 | 3300032052 | Soil | EARKSGSVVTSVSVGGATSYIASGEIEVPPSALVS |
| Ga0318504_100876703 | 3300032063 | Soil | IRQGVSMGRRSEIEAEARKTGSVVTSVSVRGATAYIASGEIDVPPSALVS |
| Ga0318510_100933001 | 3300032064 | Soil | VSMGRRSEIEAEARKSGSVVTSVSVGGAAANIASGEIEVPPSALVS |
| Ga0318514_100880711 | 3300032066 | Soil | GVSMGRRSEIEAEARKSGSVVTSVSVGGATSYIASGEIEVPLSALVS |
| Ga0318540_102212382 | 3300032094 | Soil | LQGVAVGRRSEIEAEARKSGSVVTSVSVGGATSYIASGEIEVPLSALVS |
| Ga0307472_1012982821 | 3300032205 | Hardwood Forest Soil | SIQQGVSMGRRSEIEAEARKSGSVVTSVSVGGAAANIASGEIEVPSSALLS |
| Ga0307472_1026699951 | 3300032205 | Hardwood Forest Soil | RSEIEAEAHKSGSVVTSVSVGGAAAHIASGEIEVPQSALVS |
| Ga0306920_1022958052 | 3300032261 | Soil | EIEAEAGKSGSVVTSVSVGGATSYIASGEIEVPPSALVS |
| Ga0335085_109714241 | 3300032770 | Soil | QQGVSMGRRSEIEAEARKSGSVVASVSVGGATTYIASGELDVPPSALVS |
| Ga0316628_1037422481 | 3300033513 | Soil | EIEAEARKSGGVVTSVSVGGATAYVASGEIDVPPSALMS |
| Ga0334850_030785_840_974 | 3300033828 | Soil | MGRRSEIEAEARKSGSVVTSVSVAGGTAYIASGEIEVPPSALVS |
| ⦗Top⦘ |