| Basic Information | |
|---|---|
| Family ID | F007783 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 345 |
| Average Sequence Length | 43 residues |
| Representative Sequence | VIKALVAKYPELREAFAGVVARAVDPSGRDYGTLLAMKDVK |
| Number of Associated Samples | 283 |
| Number of Associated Scaffolds | 345 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.16 % |
| % of genes near scaffold ends (potentially truncated) | 97.39 % |
| % of genes from short scaffolds (< 2000 bps) | 90.14 % |
| Associated GOLD sequencing projects | 262 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.59 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.522 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (8.406 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.739 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.043 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 21.74% β-sheet: 20.29% Coil/Unstructured: 57.97% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 345 Family Scaffolds |
|---|---|---|
| PF04679 | DNA_ligase_A_C | 44.93 |
| PF00171 | Aldedh | 11.88 |
| PF07786 | HGSNAT_cat | 2.32 |
| PF13298 | LigD_N | 2.03 |
| PF01797 | Y1_Tnp | 1.74 |
| PF00293 | NUDIX | 1.45 |
| PF01144 | CoA_trans | 1.16 |
| PF14235 | DUF4337 | 1.16 |
| PF01479 | S4 | 1.16 |
| PF13432 | TPR_16 | 0.87 |
| PF00578 | AhpC-TSA | 0.87 |
| PF00144 | Beta-lactamase | 0.58 |
| PF00069 | Pkinase | 0.58 |
| PF07676 | PD40 | 0.58 |
| PF13414 | TPR_11 | 0.58 |
| PF00005 | ABC_tran | 0.58 |
| PF13525 | YfiO | 0.58 |
| PF00731 | AIRC | 0.58 |
| PF01882 | DUF58 | 0.58 |
| PF13744 | HTH_37 | 0.58 |
| PF01464 | SLT | 0.29 |
| PF05726 | Pirin_C | 0.29 |
| PF13563 | 2_5_RNA_ligase2 | 0.29 |
| PF07719 | TPR_2 | 0.29 |
| PF01618 | MotA_ExbB | 0.29 |
| PF02518 | HATPase_c | 0.29 |
| PF00881 | Nitroreductase | 0.29 |
| PF00006 | ATP-synt_ab | 0.29 |
| PF10397 | ADSL_C | 0.29 |
| PF04237 | YjbR | 0.29 |
| PF03734 | YkuD | 0.29 |
| PF13473 | Cupredoxin_1 | 0.29 |
| PF02581 | TMP-TENI | 0.29 |
| PF00150 | Cellulase | 0.29 |
| PF03471 | CorC_HlyC | 0.29 |
| PF02547 | Queuosine_synth | 0.29 |
| PF13466 | STAS_2 | 0.29 |
| PF13620 | CarboxypepD_reg | 0.29 |
| PF07992 | Pyr_redox_2 | 0.29 |
| PF02652 | Lactate_perm | 0.29 |
| PF04055 | Radical_SAM | 0.29 |
| PF12802 | MarR_2 | 0.29 |
| PF00364 | Biotin_lipoyl | 0.29 |
| PF01804 | Penicil_amidase | 0.29 |
| PF08238 | Sel1 | 0.29 |
| PF00072 | Response_reg | 0.29 |
| COG ID | Name | Functional Category | % Frequency in 345 Family Scaffolds |
|---|---|---|---|
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 44.93 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 11.88 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 11.88 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 11.88 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.32 |
| COG3503 | Uncharacterized membrane protein, DUF1624 family | Function unknown [S] | 2.32 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 1.74 |
| COG4670 | Acyl CoA:acetate/3-ketoacid CoA transferase | Lipid transport and metabolism [I] | 1.16 |
| COG2057 | Acyl-CoA:acetate/3-ketoacid CoA transferase, beta subunit | Lipid transport and metabolism [I] | 1.16 |
| COG1788 | Acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunit | Lipid transport and metabolism [I] | 1.16 |
| COG1721 | Uncharacterized conserved protein, DUF58 family, contains vWF domain | Function unknown [S] | 0.58 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.58 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.58 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.58 |
| COG1741 | Redox-sensitive bicupin YhaK, pirin superfamily | General function prediction only [R] | 0.29 |
| COG1620 | L-lactate permease | Energy production and conversion [C] | 0.29 |
| COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 0.29 |
| COG2366 | Acyl-homoserine lactone (AHL) acylase PvdQ | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.29 |
| COG2730 | Aryl-phospho-beta-D-glucosidase BglC, GH1 family | Carbohydrate transport and metabolism [G] | 0.29 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.29 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.29 |
| COG3934 | Endo-1,4-beta-mannosidase | Carbohydrate transport and metabolism [G] | 0.29 |
| COG0809 | S-adenosylmethionine:tRNA-ribosyltransferase-isomerase (queuine synthetase) | Translation, ribosomal structure and biogenesis [J] | 0.29 |
| COG0352 | Thiamine monophosphate synthase | Coenzyme transport and metabolism [H] | 0.29 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.52 % |
| Unclassified | root | N/A | 3.48 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000789|JGI1027J11758_12759397 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 753 | Open in IMG/M |
| 3300000953|JGI11615J12901_10743003 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300001648|JGI20242J16303_108096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 521 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101204968 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 646 | Open in IMG/M |
| 3300003152|Ga0052254_1192410 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 682 | Open in IMG/M |
| 3300004080|Ga0062385_10288520 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 934 | Open in IMG/M |
| 3300004082|Ga0062384_100717181 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 690 | Open in IMG/M |
| 3300004091|Ga0062387_100052093 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1968 | Open in IMG/M |
| 3300004092|Ga0062389_100591694 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1272 | Open in IMG/M |
| 3300004152|Ga0062386_101290901 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 607 | Open in IMG/M |
| 3300004153|Ga0063455_100730573 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 672 | Open in IMG/M |
| 3300004631|Ga0058899_11369228 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 765 | Open in IMG/M |
| 3300005180|Ga0066685_10411816 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 939 | Open in IMG/M |
| 3300005187|Ga0066675_10076602 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2145 | Open in IMG/M |
| 3300005435|Ga0070714_102101097 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 550 | Open in IMG/M |
| 3300005436|Ga0070713_100987868 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 812 | Open in IMG/M |
| 3300005533|Ga0070734_10676655 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 587 | Open in IMG/M |
| 3300005537|Ga0070730_11015909 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 517 | Open in IMG/M |
| 3300005539|Ga0068853_100879476 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 860 | Open in IMG/M |
| 3300005541|Ga0070733_10122870 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1670 | Open in IMG/M |
| 3300005544|Ga0070686_100748946 | Not Available | 783 | Open in IMG/M |
| 3300005553|Ga0066695_10118184 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1636 | Open in IMG/M |
| 3300005557|Ga0066704_10436440 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 866 | Open in IMG/M |
| 3300005598|Ga0066706_10144706 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1781 | Open in IMG/M |
| 3300005598|Ga0066706_11318412 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 546 | Open in IMG/M |
| 3300005602|Ga0070762_10232199 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1140 | Open in IMG/M |
| 3300005764|Ga0066903_101153277 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1434 | Open in IMG/M |
| 3300005834|Ga0068851_10653359 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 644 | Open in IMG/M |
| 3300005893|Ga0075278_1055400 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 603 | Open in IMG/M |
| 3300005921|Ga0070766_10054194 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2263 | Open in IMG/M |
| 3300005921|Ga0070766_11073757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 555 | Open in IMG/M |
| 3300005993|Ga0080027_10085209 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1173 | Open in IMG/M |
| 3300005995|Ga0066790_10414633 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 576 | Open in IMG/M |
| 3300005995|Ga0066790_10474040 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 535 | Open in IMG/M |
| 3300006028|Ga0070717_10093281 | All Organisms → cellular organisms → Bacteria | 2545 | Open in IMG/M |
| 3300006028|Ga0070717_10151402 | All Organisms → cellular organisms → Bacteria | 2007 | Open in IMG/M |
| 3300006032|Ga0066696_10218041 | All Organisms → cellular organisms → Bacteria | 1224 | Open in IMG/M |
| 3300006041|Ga0075023_100344751 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
| 3300006046|Ga0066652_100841887 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 877 | Open in IMG/M |
| 3300006052|Ga0075029_100139815 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1481 | Open in IMG/M |
| 3300006052|Ga0075029_100327130 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
| 3300006052|Ga0075029_100631712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera → unclassified Thauera → Thauera sp. CAU 1555 | 718 | Open in IMG/M |
| 3300006052|Ga0075029_101282977 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300006059|Ga0075017_101089980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. | 624 | Open in IMG/M |
| 3300006059|Ga0075017_101231440 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300006102|Ga0075015_100199737 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
| 3300006162|Ga0075030_100204211 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1590 | Open in IMG/M |
| 3300006162|Ga0075030_101030046 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 648 | Open in IMG/M |
| 3300006162|Ga0075030_101359228 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
| 3300006163|Ga0070715_10122450 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1242 | Open in IMG/M |
| 3300006163|Ga0070715_10133528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1197 | Open in IMG/M |
| 3300006358|Ga0068871_100513914 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1081 | Open in IMG/M |
| 3300006794|Ga0066658_10333452 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 810 | Open in IMG/M |
| 3300006797|Ga0066659_11641017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300006871|Ga0075434_100527459 | All Organisms → cellular organisms → Bacteria | 1201 | Open in IMG/M |
| 3300009088|Ga0099830_10474806 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1018 | Open in IMG/M |
| 3300009088|Ga0099830_11416540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
| 3300009088|Ga0099830_11709950 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300009143|Ga0099792_10393190 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 847 | Open in IMG/M |
| 3300009143|Ga0099792_10486937 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 770 | Open in IMG/M |
| 3300009519|Ga0116108_1215905 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300009521|Ga0116222_1256744 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 754 | Open in IMG/M |
| 3300009522|Ga0116218_1478951 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300009522|Ga0116218_1518156 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
| 3300009524|Ga0116225_1433155 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
| 3300009552|Ga0116138_1216645 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300009632|Ga0116102_1097646 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300009634|Ga0116124_1155868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. | 638 | Open in IMG/M |
| 3300009641|Ga0116120_1143699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. | 770 | Open in IMG/M |
| 3300009683|Ga0116224_10063383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1801 | Open in IMG/M |
| 3300009698|Ga0116216_10116379 | All Organisms → cellular organisms → Bacteria | 1645 | Open in IMG/M |
| 3300009764|Ga0116134_1107397 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1007 | Open in IMG/M |
| 3300009839|Ga0116223_10462451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. | 741 | Open in IMG/M |
| 3300010043|Ga0126380_11072194 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 684 | Open in IMG/M |
| 3300010046|Ga0126384_11107515 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 726 | Open in IMG/M |
| 3300010329|Ga0134111_10047210 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1555 | Open in IMG/M |
| 3300010343|Ga0074044_10820200 | Not Available | 608 | Open in IMG/M |
| 3300010359|Ga0126376_11694062 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 667 | Open in IMG/M |
| 3300010360|Ga0126372_10787578 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 940 | Open in IMG/M |
| 3300010361|Ga0126378_10182264 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2166 | Open in IMG/M |
| 3300010361|Ga0126378_10812442 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1044 | Open in IMG/M |
| 3300010361|Ga0126378_12695841 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300010366|Ga0126379_12380128 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300010366|Ga0126379_12708936 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
| 3300010379|Ga0136449_103312393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. | 619 | Open in IMG/M |
| 3300010396|Ga0134126_10234249 | All Organisms → cellular organisms → Bacteria | 2179 | Open in IMG/M |
| 3300010399|Ga0134127_11612969 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 723 | Open in IMG/M |
| 3300010401|Ga0134121_12483651 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
| 3300011120|Ga0150983_10680582 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300011120|Ga0150983_12284538 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300011271|Ga0137393_11519675 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 559 | Open in IMG/M |
| 3300012019|Ga0120139_1142336 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
| 3300012189|Ga0137388_11976064 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300012200|Ga0137382_10341393 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1049 | Open in IMG/M |
| 3300012202|Ga0137363_10831677 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 783 | Open in IMG/M |
| 3300012203|Ga0137399_10575501 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 946 | Open in IMG/M |
| 3300012210|Ga0137378_10164004 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2063 | Open in IMG/M |
| 3300012210|Ga0137378_11159058 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 688 | Open in IMG/M |
| 3300012357|Ga0137384_10553713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 941 | Open in IMG/M |
| 3300012361|Ga0137360_11011802 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 717 | Open in IMG/M |
| 3300012362|Ga0137361_10060843 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3159 | Open in IMG/M |
| 3300012469|Ga0150984_100655959 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
| 3300012683|Ga0137398_10040336 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2711 | Open in IMG/M |
| 3300012918|Ga0137396_10134808 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1789 | Open in IMG/M |
| 3300012918|Ga0137396_10365549 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1068 | Open in IMG/M |
| 3300012918|Ga0137396_10768828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. | 709 | Open in IMG/M |
| 3300012927|Ga0137416_10429640 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300012927|Ga0137416_11568747 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300012929|Ga0137404_11407609 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 644 | Open in IMG/M |
| 3300012931|Ga0153915_11162961 | Not Available | 901 | Open in IMG/M |
| 3300012931|Ga0153915_13523240 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300012971|Ga0126369_12139950 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300012971|Ga0126369_12868553 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300012984|Ga0164309_11658034 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300014153|Ga0181527_1195965 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300014160|Ga0181517_10262222 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 920 | Open in IMG/M |
| 3300014165|Ga0181523_10389851 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 777 | Open in IMG/M |
| 3300014165|Ga0181523_10606916 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300014165|Ga0181523_10770970 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300014166|Ga0134079_10624986 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300014199|Ga0181535_10757311 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300014200|Ga0181526_10380949 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 896 | Open in IMG/M |
| 3300014200|Ga0181526_10678223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. | 650 | Open in IMG/M |
| 3300014200|Ga0181526_10807172 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
| 3300014496|Ga0182011_10658469 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300014501|Ga0182024_12050490 | Not Available | 631 | Open in IMG/M |
| 3300014638|Ga0181536_10311132 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300014638|Ga0181536_10493072 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300014654|Ga0181525_10072200 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1929 | Open in IMG/M |
| 3300014839|Ga0182027_10278527 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1901 | Open in IMG/M |
| 3300015052|Ga0137411_1326467 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 6598 | Open in IMG/M |
| 3300016270|Ga0182036_11248976 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300016294|Ga0182041_10102101 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2110 | Open in IMG/M |
| 3300016404|Ga0182037_11889520 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300016750|Ga0181505_10229891 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300017822|Ga0187802_10028952 | All Organisms → cellular organisms → Bacteria | 1955 | Open in IMG/M |
| 3300017822|Ga0187802_10392115 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300017823|Ga0187818_10479258 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
| 3300017928|Ga0187806_1244630 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300017933|Ga0187801_10065630 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1337 | Open in IMG/M |
| 3300017933|Ga0187801_10474826 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300017934|Ga0187803_10384711 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300017936|Ga0187821_10226398 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 725 | Open in IMG/M |
| 3300017936|Ga0187821_10386673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
| 3300017938|Ga0187854_10233953 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 801 | Open in IMG/M |
| 3300017938|Ga0187854_10461109 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300017941|Ga0187850_10256537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. | 785 | Open in IMG/M |
| 3300017942|Ga0187808_10079512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Silvibacterium → Silvibacterium bohemicum | 1413 | Open in IMG/M |
| 3300017943|Ga0187819_10212110 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1140 | Open in IMG/M |
| 3300017943|Ga0187819_10561526 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 648 | Open in IMG/M |
| 3300017970|Ga0187783_11083470 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300017972|Ga0187781_10476070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 895 | Open in IMG/M |
| 3300017973|Ga0187780_10740115 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 710 | Open in IMG/M |
| 3300017993|Ga0187823_10369613 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300017995|Ga0187816_10568002 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300018001|Ga0187815_10210657 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 823 | Open in IMG/M |
| 3300018006|Ga0187804_10214755 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 824 | Open in IMG/M |
| 3300018020|Ga0187861_10325160 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300018024|Ga0187881_10214605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. | 815 | Open in IMG/M |
| 3300018030|Ga0187869_10081155 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1659 | Open in IMG/M |
| 3300018038|Ga0187855_10267293 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1003 | Open in IMG/M |
| 3300018040|Ga0187862_10296248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1023 | Open in IMG/M |
| 3300018043|Ga0187887_10338205 | Not Available | 888 | Open in IMG/M |
| 3300018043|Ga0187887_10844644 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
| 3300018047|Ga0187859_10689899 | Not Available | 580 | Open in IMG/M |
| 3300018057|Ga0187858_10088943 | All Organisms → cellular organisms → Bacteria | 2122 | Open in IMG/M |
| 3300018060|Ga0187765_11127130 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300018062|Ga0187784_11037314 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 651 | Open in IMG/M |
| 3300018062|Ga0187784_11105319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 629 | Open in IMG/M |
| 3300018085|Ga0187772_10428381 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 924 | Open in IMG/M |
| 3300018086|Ga0187769_11395401 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300018088|Ga0187771_10642821 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300018090|Ga0187770_10050358 | All Organisms → cellular organisms → Bacteria | 2997 | Open in IMG/M |
| 3300018090|Ga0187770_10370766 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
| 3300018090|Ga0187770_10503251 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300018090|Ga0187770_11533989 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
| 3300018433|Ga0066667_11289547 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
| 3300018468|Ga0066662_11104629 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300018468|Ga0066662_12985496 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300019278|Ga0187800_1337553 | All Organisms → cellular organisms → Bacteria | 1782 | Open in IMG/M |
| 3300019284|Ga0187797_1041424 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 778 | Open in IMG/M |
| 3300019786|Ga0182025_1284429 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1743 | Open in IMG/M |
| 3300019787|Ga0182031_1036477 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 656 | Open in IMG/M |
| 3300019890|Ga0193728_1028154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2797 | Open in IMG/M |
| 3300019890|Ga0193728_1348065 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
| 3300020002|Ga0193730_1129393 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 685 | Open in IMG/M |
| 3300020150|Ga0187768_1105374 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 644 | Open in IMG/M |
| 3300020580|Ga0210403_11049231 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
| 3300020580|Ga0210403_11241305 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300020581|Ga0210399_10160049 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1864 | Open in IMG/M |
| 3300020583|Ga0210401_10931085 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 728 | Open in IMG/M |
| 3300020583|Ga0210401_11504105 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300021088|Ga0210404_10705478 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300021170|Ga0210400_10121903 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2082 | Open in IMG/M |
| 3300021171|Ga0210405_10286842 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1302 | Open in IMG/M |
| 3300021178|Ga0210408_10876119 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 700 | Open in IMG/M |
| 3300021181|Ga0210388_10123143 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2237 | Open in IMG/M |
| 3300021181|Ga0210388_11753253 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300021401|Ga0210393_10132873 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1995 | Open in IMG/M |
| 3300021404|Ga0210389_10588846 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 874 | Open in IMG/M |
| 3300021406|Ga0210386_10739933 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 847 | Open in IMG/M |
| 3300021406|Ga0210386_11155198 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 656 | Open in IMG/M |
| 3300021407|Ga0210383_11604481 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300021420|Ga0210394_11692673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300021432|Ga0210384_10547834 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1040 | Open in IMG/M |
| 3300021432|Ga0210384_11559996 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300021474|Ga0210390_10495586 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1029 | Open in IMG/M |
| 3300021474|Ga0210390_11343315 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300021479|Ga0210410_10007349 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 9513 | Open in IMG/M |
| 3300021559|Ga0210409_10521744 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1053 | Open in IMG/M |
| 3300021560|Ga0126371_12707380 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300021858|Ga0213852_1483456 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 727 | Open in IMG/M |
| 3300022522|Ga0242659_1050925 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 732 | Open in IMG/M |
| 3300022724|Ga0242665_10220563 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 633 | Open in IMG/M |
| 3300022732|Ga0224569_100046 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7678 | Open in IMG/M |
| 3300022875|Ga0224553_1122783 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300024225|Ga0224572_1105724 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
| 3300024271|Ga0224564_1117320 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300024295|Ga0224556_1146355 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
| 3300025412|Ga0208194_1001527 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4731 | Open in IMG/M |
| 3300025427|Ga0208077_1014597 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1127 | Open in IMG/M |
| 3300025441|Ga0208456_1069132 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300025454|Ga0208039_1099000 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300025507|Ga0208188_1141525 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300025627|Ga0208220_1088512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 846 | Open in IMG/M |
| 3300025906|Ga0207699_11292011 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300025910|Ga0207684_10113180 | All Organisms → cellular organisms → Bacteria | 2323 | Open in IMG/M |
| 3300025914|Ga0207671_10254432 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1381 | Open in IMG/M |
| 3300025927|Ga0207687_10426838 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1095 | Open in IMG/M |
| 3300025928|Ga0207700_10004978 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7898 | Open in IMG/M |
| 3300025972|Ga0207668_10059125 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2683 | Open in IMG/M |
| 3300026023|Ga0207677_10394349 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1172 | Open in IMG/M |
| 3300026041|Ga0207639_10848503 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 853 | Open in IMG/M |
| 3300026223|Ga0209840_1006973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2542 | Open in IMG/M |
| 3300026281|Ga0209863_10178514 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 618 | Open in IMG/M |
| 3300026467|Ga0257154_1027520 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 847 | Open in IMG/M |
| 3300026480|Ga0257177_1072097 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300026508|Ga0257161_1048627 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 855 | Open in IMG/M |
| 3300026557|Ga0179587_10535154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 770 | Open in IMG/M |
| 3300027011|Ga0207740_1023141 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 802 | Open in IMG/M |
| 3300027073|Ga0208366_1018016 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 770 | Open in IMG/M |
| 3300027109|Ga0208603_1035092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 782 | Open in IMG/M |
| 3300027480|Ga0208993_1052257 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 738 | Open in IMG/M |
| 3300027497|Ga0208199_1069166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 742 | Open in IMG/M |
| 3300027559|Ga0209222_1063226 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 712 | Open in IMG/M |
| 3300027567|Ga0209115_1027048 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1288 | Open in IMG/M |
| 3300027604|Ga0208324_1166001 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
| 3300027604|Ga0208324_1195846 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
| 3300027684|Ga0209626_1001241 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5487 | Open in IMG/M |
| 3300027696|Ga0208696_1045399 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1552 | Open in IMG/M |
| 3300027765|Ga0209073_10294741 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 641 | Open in IMG/M |
| 3300027783|Ga0209448_10054370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1346 | Open in IMG/M |
| 3300027783|Ga0209448_10169450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. | 727 | Open in IMG/M |
| 3300027812|Ga0209656_10368581 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
| 3300027824|Ga0209040_10114610 | All Organisms → cellular organisms → Bacteria | 1504 | Open in IMG/M |
| 3300027825|Ga0209039_10255851 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300027826|Ga0209060_10229729 | Not Available | 852 | Open in IMG/M |
| 3300027829|Ga0209773_10276597 | Not Available | 701 | Open in IMG/M |
| 3300027842|Ga0209580_10310410 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 785 | Open in IMG/M |
| 3300027842|Ga0209580_10425221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 662 | Open in IMG/M |
| 3300027855|Ga0209693_10035002 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2457 | Open in IMG/M |
| 3300027867|Ga0209167_10504869 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 662 | Open in IMG/M |
| 3300027869|Ga0209579_10185957 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1111 | Open in IMG/M |
| 3300027874|Ga0209465_10259393 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300027875|Ga0209283_10202066 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1320 | Open in IMG/M |
| 3300027889|Ga0209380_10154789 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1340 | Open in IMG/M |
| 3300027889|Ga0209380_10193112 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1195 | Open in IMG/M |
| 3300027896|Ga0209777_10682228 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300027903|Ga0209488_10931435 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 607 | Open in IMG/M |
| 3300027905|Ga0209415_10737909 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300027905|Ga0209415_10792729 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
| 3300028047|Ga0209526_10253364 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1204 | Open in IMG/M |
| 3300028560|Ga0302144_10258071 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300028562|Ga0302151_10012254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia rhynchosiae | 3260 | Open in IMG/M |
| 3300028665|Ga0302160_10094647 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 652 | Open in IMG/M |
| 3300028736|Ga0302214_1043807 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 914 | Open in IMG/M |
| 3300028759|Ga0302224_10116734 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1034 | Open in IMG/M |
| 3300028773|Ga0302234_10482360 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300028780|Ga0302225_10559329 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
| 3300028801|Ga0302226_10353331 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
| 3300028906|Ga0308309_10861069 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 787 | Open in IMG/M |
| 3300028909|Ga0302200_10109275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1486 | Open in IMG/M |
| 3300029914|Ga0311359_10298174 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1333 | Open in IMG/M |
| 3300029939|Ga0311328_10178568 | All Organisms → cellular organisms → Bacteria | 1666 | Open in IMG/M |
| 3300029951|Ga0311371_11178459 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 888 | Open in IMG/M |
| 3300029953|Ga0311343_11000194 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 657 | Open in IMG/M |
| 3300029999|Ga0311339_10941483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. | 816 | Open in IMG/M |
| 3300029999|Ga0311339_10943291 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 814 | Open in IMG/M |
| 3300030007|Ga0311338_11113719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. | 756 | Open in IMG/M |
| 3300030020|Ga0311344_11128884 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 598 | Open in IMG/M |
| 3300030043|Ga0302306_10226404 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300030045|Ga0302282_1371718 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300030058|Ga0302179_10093903 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1327 | Open in IMG/M |
| 3300030503|Ga0311370_11586340 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300030524|Ga0311357_10350495 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1404 | Open in IMG/M |
| 3300030659|Ga0316363_10358961 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300030706|Ga0310039_10372970 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300030707|Ga0310038_10187867 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 995 | Open in IMG/M |
| 3300030746|Ga0302312_10353378 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300030838|Ga0311335_10215110 | Not Available | 1286 | Open in IMG/M |
| 3300030878|Ga0265770_1082292 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 631 | Open in IMG/M |
| 3300031028|Ga0302180_10313301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. | 805 | Open in IMG/M |
| 3300031090|Ga0265760_10229148 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300031231|Ga0170824_107123530 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1105 | Open in IMG/M |
| 3300031236|Ga0302324_100244269 | All Organisms → cellular organisms → Bacteria | 2809 | Open in IMG/M |
| 3300031344|Ga0265316_10058584 | All Organisms → cellular organisms → Bacteria | 2999 | Open in IMG/M |
| 3300031521|Ga0311364_11097881 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 792 | Open in IMG/M |
| 3300031525|Ga0302326_11851392 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300031680|Ga0318574_10652613 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
| 3300031708|Ga0310686_103649164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. | 764 | Open in IMG/M |
| 3300031708|Ga0310686_106648337 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300031715|Ga0307476_10221690 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1376 | Open in IMG/M |
| 3300031720|Ga0307469_10338916 | All Organisms → cellular organisms → Bacteria | 1257 | Open in IMG/M |
| 3300031754|Ga0307475_10889991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rhizobacter → unclassified Rhizobacter → Rhizobacter sp. OV335 | 703 | Open in IMG/M |
| 3300031823|Ga0307478_11640001 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300031910|Ga0306923_11862333 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
| 3300031962|Ga0307479_11979456 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300032001|Ga0306922_12326788 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 513 | Open in IMG/M |
| 3300032005|Ga0307411_10495037 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
| 3300032160|Ga0311301_11386759 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 878 | Open in IMG/M |
| 3300032160|Ga0311301_12056854 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 663 | Open in IMG/M |
| 3300032160|Ga0311301_12227768 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
| 3300032160|Ga0311301_13026558 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300032173|Ga0315268_11836233 | Not Available | 619 | Open in IMG/M |
| 3300032180|Ga0307471_100761916 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1134 | Open in IMG/M |
| 3300032205|Ga0307472_100131286 | All Organisms → cellular organisms → Bacteria | 1792 | Open in IMG/M |
| 3300032205|Ga0307472_101100652 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 752 | Open in IMG/M |
| 3300032261|Ga0306920_100203587 | All Organisms → cellular organisms → Bacteria | 2954 | Open in IMG/M |
| 3300032515|Ga0348332_11548408 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1040 | Open in IMG/M |
| 3300032722|Ga0316231_1266269 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 695 | Open in IMG/M |
| 3300032770|Ga0335085_10980482 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300032782|Ga0335082_10474834 | Not Available | 1113 | Open in IMG/M |
| 3300032783|Ga0335079_10117907 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2997 | Open in IMG/M |
| 3300032783|Ga0335079_10810386 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 969 | Open in IMG/M |
| 3300032805|Ga0335078_11889886 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 644 | Open in IMG/M |
| 3300032829|Ga0335070_10001078 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 31242 | Open in IMG/M |
| 3300032892|Ga0335081_10054179 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6260 | Open in IMG/M |
| 3300032892|Ga0335081_10161798 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3177 | Open in IMG/M |
| 3300032892|Ga0335081_10352724 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1916 | Open in IMG/M |
| 3300032954|Ga0335083_10305584 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1395 | Open in IMG/M |
| 3300033134|Ga0335073_10836376 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 981 | Open in IMG/M |
| 3300033405|Ga0326727_10329837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1469 | Open in IMG/M |
| 3300033545|Ga0316214_1032080 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 747 | Open in IMG/M |
| 3300034091|Ga0326724_0620487 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.41% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.54% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.38% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.64% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.64% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.06% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.77% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.48% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.48% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.48% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.19% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.19% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.19% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.61% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.32% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.32% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.32% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.03% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.74% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.45% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.87% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.87% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.87% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.87% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.58% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.58% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.58% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.58% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.58% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.58% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.58% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.58% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.58% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.29% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 0.29% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.29% |
| Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Sediment | 0.29% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.29% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.29% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.29% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.29% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.29% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.29% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.29% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.29% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.29% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.29% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.29% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.29% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.29% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.29% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.29% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.29% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.29% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.29% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.29% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.29% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300001648 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003152 | Freshwater sediment microbial communities from Loktak Lake, India | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005893 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_202 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
| 3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
| 3300009634 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 | Environmental | Open in IMG/M |
| 3300009641 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012019 | Permafrost microbial communities from Nunavut, Canada - A7_5cm_12M | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300014153 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaG | Environmental | Open in IMG/M |
| 3300014160 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014496 | Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
| 3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020150 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MG | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021858 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022522 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU1 | Host-Associated | Open in IMG/M |
| 3300022875 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 10-14 | Environmental | Open in IMG/M |
| 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
| 3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
| 3300024295 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5 | Environmental | Open in IMG/M |
| 3300025412 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025427 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025441 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025454 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025507 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025627 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026223 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 (SPAdes) | Environmental | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300026467 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-A | Environmental | Open in IMG/M |
| 3300026480 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-B | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027011 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 29 (SPAdes) | Environmental | Open in IMG/M |
| 3300027073 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027109 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008 (SPAdes) | Environmental | Open in IMG/M |
| 3300027480 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027559 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028560 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_2 | Environmental | Open in IMG/M |
| 3300028562 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_3 | Environmental | Open in IMG/M |
| 3300028665 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_3 | Environmental | Open in IMG/M |
| 3300028736 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_3 | Environmental | Open in IMG/M |
| 3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300028801 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300028909 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_1 | Environmental | Open in IMG/M |
| 3300029914 | III_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029939 | I_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029953 | II_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030020 | II_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030043 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030045 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_3 | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300030746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_1 | Environmental | Open in IMG/M |
| 3300030838 | I_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
| 3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032722 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18027 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Host-Associated | Open in IMG/M |
| 3300034091 | Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J11758_127593971 | 3300000789 | Soil | LVRAIVAKYPEFRDGFDAVVARAVEPSGRDFGSMVQMKEIK* |
| JGI11615J12901_107430031 | 3300000953 | Soil | SNTGASFQANMAVIKAVVAKYPEFRDAFAGVIARAVDPSGRDYGTLLPMKEIK* |
| JGI20242J16303_1080961 | 3300001648 | Forest Soil | DISNSNQTYQVNVAVMKALIAKFPELRGAFAGIVVRAVDPSGRDYGTMLAMKEIK* |
| JGIcombinedJ26739_1012049681 | 3300002245 | Forest Soil | AYQSNVAVMKALLKKYPELRDAFAAVVARAVDPAGHDYGTLLAMKDIK* |
| Ga0052254_11924101 | 3300003152 | Sediment | NTNAAYQDNVNVMKALVTKFPEVRDAFAAVVARAVDTSGRDYGTLLAMKDIK* |
| Ga0062385_102885202 | 3300004080 | Bog Forest Soil | TNQTYQSNVAVVKALITKYPELRDAFAAVVARAVDPNGHDYGTMLVMKDIK* |
| Ga0062384_1007171812 | 3300004082 | Bog Forest Soil | VMKALVAKYPELRDAFVAVVARAVDPAGRDYGTLLAMKDIK* |
| Ga0062387_1000520931 | 3300004091 | Bog Forest Soil | MKALVAKYPEVRDAFAAVVARAVDPAGRDYGTLLAMKDIK* |
| Ga0062389_1005916941 | 3300004092 | Bog Forest Soil | DASNSNQAYQNNVAVMKALVAKYPEVRDAFAAVVARAVDPAGRDYGTLLAMKDIK* |
| Ga0062386_1012909012 | 3300004152 | Bog Forest Soil | QMFDENMAVIRAIVGRYPEVREAFAGVVARATEPSGHDYGTLLAMKDVK* |
| Ga0063455_1007305732 | 3300004153 | Soil | AAAFADNTAVIKALLGQFPELRTAFGGVVARAVGPNGSDYGTMLAMKDVK* |
| Ga0058899_113692282 | 3300004631 | Forest Soil | YQNNVAVMKALVAKYPELREAFAGIVVRAVDPSGHDYGTLLAMREIK* |
| Ga0066685_104118161 | 3300005180 | Soil | DNMAVMKALIAKYPELHEAFGGIVARAVEPSGRDYGSLMAMKDIK* |
| Ga0066675_100766022 | 3300005187 | Soil | TAKTFQDNMAVISAVVGKYPEFREIFQGVVARAVDPAGHDYGTLLAMKDVK* |
| Ga0070714_1021010971 | 3300005435 | Agricultural Soil | VNVMKAALQKWPELRDAFAGIVARAVDASGQDYGTLLAMKDIK* |
| Ga0070713_1009878681 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | PNVAYQDNVNVMKALVTKYPEVRDAFAAVVARAVDASGRDYGTLLAMKDIK* |
| Ga0070734_106766551 | 3300005533 | Surface Soil | LLLKYPEFRDAFAGVVARAVEPSGKDYGSLVSMKDIK* |
| Ga0070730_110159092 | 3300005537 | Surface Soil | VIKALVAKYPELREAFAGVVARAVDPSGRDYGTLLAMKDVK* |
| Ga0068853_1008794762 | 3300005539 | Corn Rhizosphere | TNVMKAVLTKFPELREAFDGVVARAVEMSGRDYGSMLAMKDIK* |
| Ga0070733_101228702 | 3300005541 | Surface Soil | TAQTFQDNMAVIKALVAKYPEFRDGFEGVVARAVEPTTGRDYGSLLPMKEIK* |
| Ga0070686_1007489462 | 3300005544 | Switchgrass Rhizosphere | KAFAQRYPEYRTAFAGYVARAVDPSTGADYGTVLNMADVK* |
| Ga0066695_101181843 | 3300005553 | Soil | QECMAVMKALLLKFPELRDAFDGIVARAVEPSGKDYGALMHMKDVK* |
| Ga0066704_104364401 | 3300005557 | Soil | VVTKYPEVRDAFAAIVARAVDPSGRDYGTLLAMKDIK* |
| Ga0066706_101447063 | 3300005598 | Soil | MKALLLKFPELRDAFDGIVARAVEPSGKDYGALMHMKDVK* |
| Ga0066706_113184122 | 3300005598 | Soil | AKTFQDNMAVISAVVGKYPEFREIFQGVVARAVDPAGHDYGTLLAMKDVK* |
| Ga0070762_102321991 | 3300005602 | Soil | VIGALIAKYPELKEAFAGVVARAVDPSGRDYGTLLAMKEIK* |
| Ga0066903_1011532771 | 3300005764 | Tropical Forest Soil | SNANLAYQDNLNVIKALVTKYPEVRDAFAAVVARAVDASGRDYGTLLAMKDVK* |
| Ga0068851_106533591 | 3300005834 | Corn Rhizosphere | KAVLTKFPELREAFDGVVARAVEMSGRDYGSMLAMKDIK* |
| Ga0075278_10554002 | 3300005893 | Rice Paddy Soil | QSDLSNTAAAFADNTAVIKALLAQFPELRNAFGGVVARAVGPNGNDYGTMLAMKDVK* |
| Ga0070766_100541941 | 3300005921 | Soil | VGKFPEFRDAFDGVVARAVEPTTGRDYGSLLPMKDIK* |
| Ga0070766_110737571 | 3300005921 | Soil | GADISNTAQAYQSNVAVMKTLLKKYPELRDAFAAVVARAVDPAGHDYGTLLAMKDIK* |
| Ga0080027_100852091 | 3300005993 | Prmafrost Soil | HVLLVKYPELREAFAAIVARAVDPTGRDYGSLVTMKEIK* |
| Ga0066790_104146332 | 3300005995 | Soil | MIKALVAKLPELREAFAGVVARAVEPSGRDYGSLMATKDIK* |
| Ga0066790_104740402 | 3300005995 | Soil | ENTAVIKALVAKFPELREAFAGVVARAVDPSGRDYGTLLATKDIK* |
| Ga0070717_100932814 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | QAYQSNVAVMKAITAKYPELRDAFAGVVARATEPTGRDYGTLLAMKDIK* |
| Ga0070717_101514021 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | TKYPELRDAFAAVVVRAVDPGGHDYGTMLAMKDVK* |
| Ga0066696_102180412 | 3300006032 | Soil | ITKYPEFRDAFDGVVARGVESSGRDYGTMMPMKDIK* |
| Ga0075023_1003447512 | 3300006041 | Watersheds | ALVTKYPELREAFDGVVPRAVEPSGRDYGSLLAMKNIK* |
| Ga0066652_1008418872 | 3300006046 | Soil | MKALLLKFPELREAFDGIVSRAVEPSGKDYGALMHMKDVK* |
| Ga0075029_1001398153 | 3300006052 | Watersheds | NVAVTKALLARFPEFRDAFAGVIVRAVEPSGRDYGSLMAMKDVK* |
| Ga0075029_1003271303 | 3300006052 | Watersheds | FQENSAVIKALAAKFPEFREAFAGVVARAVDPSGHDYGTLLAMKDIK* |
| Ga0075029_1006317121 | 3300006052 | Watersheds | EAADISNNAHTFQENTAVIKGLIVKFPEFREAFGGVVARAVDPSGHDYGTLLAMKDIK* |
| Ga0075029_1012829771 | 3300006052 | Watersheds | AVIKALIAKYPEFREAFAGVVARAVDPSGHDYGTLLAMKDIK* |
| Ga0075017_1010899801 | 3300006059 | Watersheds | VIKALVAKFPEFRETFASVVARAVDPSGRDYGTLLAMKDIK* |
| Ga0075017_1012314401 | 3300006059 | Watersheds | VAGEINLVVKWETGDASNPAQSYADNQVVAKALVAKYPELRDGFAAIVARATEPSGRDYGTLLPMKEIK* |
| Ga0075015_1001997371 | 3300006102 | Watersheds | NTVVIKALITKYPEFRDAFAGVVARAVDPSGHDYGTLLAMKDIK* |
| Ga0075030_1002042111 | 3300006162 | Watersheds | LDLFVKHRVSDASNSNQTYQDNIALMKALIAKFPEFREAFPGVEVLAVDSNGRDYGTLLAMKDIK* |
| Ga0075030_1010300462 | 3300006162 | Watersheds | VAKYPELRDAFAGVVARAVDPSGRDYGTLLAMKDVK* |
| Ga0075030_1013592281 | 3300006162 | Watersheds | NQAYQSNVAVMKALVAKYPEVRDAFAGVVARAVDPAGRDYGTLLAMKDIK* |
| Ga0070715_101224501 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | ALVTKFPELRDAFQGIVCRAVESSGKDYGSLMAMKDIK* |
| Ga0070715_101335282 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | NVNVMKALVAKIPEVRDAFAAVVARAVDTSGHDYGTLLAMKDIK* |
| Ga0068871_1005139142 | 3300006358 | Miscanthus Rhizosphere | ALVAKYPEFRDAFDSVVVRAVEPSGRDFGSLLPMKGIK* |
| Ga0066658_103334521 | 3300006794 | Soil | KFPELREAFDGIVARAVEHSGKDYGALMHMKDLK* |
| Ga0066659_116410171 | 3300006797 | Soil | KALVTKYPEVRDAFAAVVARAVDPAGRDYGTLLAMKDIK* |
| Ga0075434_1005274591 | 3300006871 | Populus Rhizosphere | ENMNVMKALVTKFPELRDAFQGIVCRAVESSGKDYGSLMAMKDIK* |
| Ga0099830_104748061 | 3300009088 | Vadose Zone Soil | LLAKYPELRDAFAAVVVRAVDPAGRDYGTMLAMKDIK* |
| Ga0099830_114165401 | 3300009088 | Vadose Zone Soil | ALVAKYPEFRDAFDGVVVRAVEPSGRDYGSLLAMKDIK* |
| Ga0099830_117099501 | 3300009088 | Vadose Zone Soil | QNNVAAMKALVAKYPELRDAFAAVVVRAVDPSGHDYGTMLAMKDIK* |
| Ga0099792_103931902 | 3300009143 | Vadose Zone Soil | VMKALVTKYPELRDIFAGMVARAVDPGGRDYGTLLAMKDIK* |
| Ga0099792_104869371 | 3300009143 | Vadose Zone Soil | IAVMRALVTKYPEFKQAFAAVNARAVDPSGRDYGTLLSMKDIK* |
| Ga0116108_12159052 | 3300009519 | Peatland | SNTARTFQENTALIKALVVKFPEFRGAFAGVVARAVEPSGRDYGTLVAMKDIK* |
| Ga0116222_12567441 | 3300009521 | Peatlands Soil | KALVAKYPEVREAFAAVVARAVDNSGRDYGTLLSMKDIK* |
| Ga0116218_14789512 | 3300009522 | Peatlands Soil | AVIKALVVKYPEVRDAFAAVVARAVDPSGRDYGTLLAMKDVK* |
| Ga0116218_15181562 | 3300009522 | Peatlands Soil | AVIKALVAKYPELKDAFAGVVARAVDPSGHDYGTLLAMKEIK* |
| Ga0116221_14367101 | 3300009523 | Peatlands Soil | VAFRDNMAVSKAIVAKYPEVRDAFSAVIARAVDARGHDYGSVLPMKDVK* |
| Ga0116225_14331551 | 3300009524 | Peatlands Soil | AAKYPELRDAFAGVVARAVDPSGHDFGTLLAMKDIK* |
| Ga0116138_12166452 | 3300009552 | Peatland | FQENTAVIKTLVAKFPEFREAFAGVVARAVDSSGRDYGTLMAMKDIK* |
| Ga0116102_10976461 | 3300009632 | Peatland | RTFQENTAVIKALIAKFPEFREAFAGVVARAVDPSGHDYGTLLAMKDIK* |
| Ga0116124_11558681 | 3300009634 | Peatland | ENSTVIKALVAKFPELREAFAGAVARAVDPSGHDYGTLLAMKDVK* |
| Ga0116120_11436991 | 3300009641 | Peatland | LVAKFTEFREAFAGAVARAVDPSGRDYGTLLEMKDIK* |
| Ga0116224_100633832 | 3300009683 | Peatlands Soil | AKYPEFREAFDGVVARAVEPTTGRDYGSLLPMKDIK* |
| Ga0116216_101163791 | 3300009698 | Peatlands Soil | ENTAVIKALVAKFPEFREAFAGVVARAVDPSGRDYGTLMAMKDIK* |
| Ga0116134_11073973 | 3300009764 | Peatland | ENTAVIKALVAKFPEFREAFAGVVARAVDPSGRDYGSLMEMKDIK* |
| Ga0116223_104624511 | 3300009839 | Peatlands Soil | TALIKALVARFPEFRDAFAGVVARAVEPSGHDFSSLMAMKDIK* |
| Ga0126380_110721941 | 3300010043 | Tropical Forest Soil | KALLVKYPELRDAFDGVVARAVEPSGKDYGALMKMKDIK* |
| Ga0126384_111075151 | 3300010046 | Tropical Forest Soil | KFPEFRDAFGGVVTRAVAPSGQDYGSLLTMSNIK* |
| Ga0134111_100472103 | 3300010329 | Grasslands Soil | VTKYPELRDAFAGIVARAVEPSGRDYGSLLAMKDIK* |
| Ga0074044_108202001 | 3300010343 | Bog Forest Soil | KFPEFREAFAGVVARAVDPSGHNFSSLMAMKDIK* |
| Ga0126376_116940622 | 3300010359 | Tropical Forest Soil | AYQENINVMKALVARFPEVRDTFAAVVARAVDTSGRDYGTLLAMKDIK* |
| Ga0126372_107875781 | 3300010360 | Tropical Forest Soil | CMSVMKALLLKFPELRDAFDGVVARAIEPSGKDYGALMKMKDIK* |
| Ga0126378_101822641 | 3300010361 | Tropical Forest Soil | NVSNANLAYQDNLNVIKALVTKYPEVRGAFAAVVARAVDVSGRDYGTLLAMKDVK* |
| Ga0126378_108124421 | 3300010361 | Tropical Forest Soil | KFPELREAFGGIVARAVEPSGKDYGSLMAMKDIK* |
| Ga0126378_126958412 | 3300010361 | Tropical Forest Soil | TKFPELRDAFAGVVCRGVEPSGKDYGSLMPMKDIK* |
| Ga0126379_123801282 | 3300010366 | Tropical Forest Soil | LVARFPEFRDAFAGVVVRAVEPSGRDYGSLTGMKDIK* |
| Ga0126379_127089362 | 3300010366 | Tropical Forest Soil | NANQAYQDNVAVMKALVAKFPEVRDGFAAAVARAVDASGQDYGTLLAMKDIK* |
| Ga0136449_1033123932 | 3300010379 | Peatlands Soil | ALVAKFPEFREAFAGVVARAVDPSGRDYGSLMAMKDIK* |
| Ga0134126_102342493 | 3300010396 | Terrestrial Soil | VTKFPELREAFDDMVVRAVEPSGRDYGSMMPMKDIK* |
| Ga0134127_116129692 | 3300010399 | Terrestrial Soil | LKFPELRDAFDGVVARGVEASGRDYGTLLPMKDIH* |
| Ga0134121_124836512 | 3300010401 | Terrestrial Soil | VAVIKALVAKYPEVRDAFAAVVARAVDPSGRDYGTLLAMKDIK* |
| Ga0150983_106805822 | 3300011120 | Forest Soil | ALVAKYPEVRDALAGVVARAVDPSGRDYGTLLAMKDVK* |
| Ga0150983_122845382 | 3300011120 | Forest Soil | TKFPELKDAFAGIVARAVDPSGRDYGTMLAMKDIK* |
| Ga0137393_115196751 | 3300011271 | Vadose Zone Soil | AKYPEFRDAFNGVVVRAVEPSGRDYGSLLAMKDIK* |
| Ga0120139_11423362 | 3300012019 | Permafrost | KALAAKYPEVRDAFAAIVARAVDPGGRDYGTLLAMKDIK* |
| Ga0137388_119760642 | 3300012189 | Vadose Zone Soil | ANISNTGQTYQTNLAVIKALVTKYPEVRDAFAAVVARAVDPAGRDYGTLLAMKDIK* |
| Ga0137382_103413932 | 3300012200 | Vadose Zone Soil | VAYQENVNVMKALVTRFPEVRDAFSAVVARAVDTTGRDYGTLLAMKDIK* |
| Ga0137363_108316772 | 3300012202 | Vadose Zone Soil | ALVTKYPELRDAFASVVVRAVDPSGHDYGTMLAMKDIK* |
| Ga0137399_105755011 | 3300012203 | Vadose Zone Soil | AKYPELRDGFAGIVVRAVEPSGRDYGSMLAMKDIK* |
| Ga0137378_101640041 | 3300012210 | Vadose Zone Soil | DVSNTNQAYQSNVAVIKALVTKYPEVREAFAAVVARAVDPSGRDYGTLLAMKDIK* |
| Ga0137378_111590582 | 3300012210 | Vadose Zone Soil | AVMKALLLKFPELREAFDGIVSRAVEPSGKDYGALMRMKDVK* |
| Ga0137384_105537132 | 3300012357 | Vadose Zone Soil | QAYQSNVAVIKALVTKYPEVREAFTAVVARAVDPNGRDYGTLLAMKDIK* |
| Ga0137360_110118022 | 3300012361 | Vadose Zone Soil | SVMKALLLKFPELREAFDGIVSRAVEASGKDYGALMHMKDLK* |
| Ga0137361_100608431 | 3300012362 | Vadose Zone Soil | GLVTKYPELRDAFAGIVARAVEPSGRDYGSLLAMKDIK* |
| Ga0150984_1006559592 | 3300012469 | Avena Fatua Rhizosphere | ILQKWPELRDAFAGVVARAVDATGRDYGTLLAMKDIK* |
| Ga0137398_100403361 | 3300012683 | Vadose Zone Soil | ALVTKYPELRDAFAAIVARAVDPSGRDYGTMLAMKDIK* |
| Ga0137396_101348081 | 3300012918 | Vadose Zone Soil | VIKALVTKHPEVRDAFAAVVARAVDPAGRDYGTLLAMKDIR* |
| Ga0137396_103655491 | 3300012918 | Vadose Zone Soil | KYPELREAFAGVVARAVEPSGRDYGSLVAMKDVK* |
| Ga0137396_107688282 | 3300012918 | Vadose Zone Soil | VAVIKALVAKFPEFREAFAGVVARAVEPSGRDYGSLMAMKDIK* |
| Ga0137416_104296401 | 3300012927 | Vadose Zone Soil | KYPEFREAFAGVVARAVEPSGRDYGSLLAMKDVK* |
| Ga0137416_115687471 | 3300012927 | Vadose Zone Soil | TYQTNLAVIKALVTKYPEVRDAFAAVVARAVDPAGRDYGTLLAMKDIK* |
| Ga0137404_114076091 | 3300012929 | Vadose Zone Soil | STQTYQNNVSAMKALVAKHPEVRDAFAAVVARAVDPSGRDFGTLLAMKDIK* |
| Ga0153915_111629611 | 3300012931 | Freshwater Wetlands | ADNVAVIKALVGRLPQLREAFGGVVARAVNPSGAEYGSLLAMKDVK* |
| Ga0153915_135232401 | 3300012931 | Freshwater Wetlands | VVARYPELRGAFAGVVARAVDSSGRDYGSLLAMKDVK* |
| Ga0126369_121399501 | 3300012971 | Tropical Forest Soil | VSNTAETYKVNGVVTRALVARFPEFRDAFAGVVVRAVEPSGRDYGSLTGMKDIK* |
| Ga0126369_128685531 | 3300012971 | Tropical Forest Soil | AADISNTAQSFQENIAVIHALVARYPELRDAFDDVVARAVDPSGRDYGTMLPMKEIK* |
| Ga0164309_116580341 | 3300012984 | Soil | NSNQMYQDNIALIKALIAKYPEFREAFSGVEAVAVDSSGRDYGTLLAMKDIK* |
| Ga0181527_11959652 | 3300014153 | Bog | VIKALVAKFPEFRESFAGVIARAVEPSGHDFSTLLTMKDIK* |
| Ga0181517_102622222 | 3300014160 | Bog | ADISNTNQAYQVNVAVIKALVAKYPEVRDAFAGVVARAVDPSGRDYGTLLAMKDVK* |
| Ga0181523_103898511 | 3300014165 | Bog | AYQANIAVMKALLTKYPELRDAFAAVVARGVDPSGRDYGTMSAMKDIK* |
| Ga0181523_106069161 | 3300014165 | Bog | NQTYQSNVAVMKALVAKYPELRDAFTSVVARAVDPSGRDYGTMLAMKDIK* |
| Ga0181523_107709701 | 3300014165 | Bog | AVIKALVARFPEFREAFAGVVARAVEPSGRDFGTLLAMKDIK* |
| Ga0134079_106249862 | 3300014166 | Grasslands Soil | LTKFPELRDAFDGVVTRAVEPSGRDYGSMLAMKDIK* |
| Ga0181535_107573111 | 3300014199 | Bog | LVAKYPELRDAFAGVVARAVDPSGRDYGTLLAIKDIK* |
| Ga0181526_103809491 | 3300014200 | Bog | NTNQAYQNNVAVIKALVAKYPELKDAFAGVVARAVDPGGHDYGTLLAMKDVK* |
| Ga0181526_106782231 | 3300014200 | Bog | TTRTFQENTAVIKALIAKFPEFREAFAGVVARAVDPSGHDYGTLLAMKDIK* |
| Ga0181526_108071722 | 3300014200 | Bog | FQENSAAIKALVGKFPELREAFAGVVARAVDPSGRDYGTLLAMKDIK* |
| Ga0182011_106584692 | 3300014496 | Fen | ARAFEENTSVIKALVGKFPELREAFQGVVARAVEPSGRDYGTLMAMKEIK* |
| Ga0182024_120504902 | 3300014501 | Permafrost | QENAAVGKALVAKFPEFRGSFAGVVARAVEPSGRDFSSLLAMKDVK* |
| Ga0181536_103111323 | 3300014638 | Bog | KFPELREAFAGAVARAVEPSGRDYGTLLEMKDIK* |
| Ga0181536_104930721 | 3300014638 | Bog | KALVARSPELREAFDGVVARAVEPSGHDYGSLMAMKDIK* |
| Ga0181525_100722001 | 3300014654 | Bog | TARTFQENTAVIKGLVTRYPELRDAFGGVVARAVDPSGRDYGTLLPMKEIK* |
| Ga0182027_102785272 | 3300014839 | Fen | MKALVVRYSEFRDGFSAIVVRAVAPDGQDYGTLLPMKDIK* |
| Ga0137411_13264678 | 3300015052 | Vadose Zone Soil | VAVIKALLAKYPELRKHSPESRGRAVDPRGRDYGTLLAMKDVK* |
| Ga0182036_112489761 | 3300016270 | Soil | NVSNTNQAYQDNVAVMKAMVTKYPELRDAFAAVVARAVDATGRDYGTLLAMKDIR |
| Ga0182041_101021011 | 3300016294 | Soil | MKALVTKFPELRDAFEGIVARAVEPSGRDYGSLMPMKEIK |
| Ga0182037_118895201 | 3300016404 | Soil | NVNVMKALVTRFPEVRDAFAAVVARAVDTSGRDYGTLLAMKDIK |
| Ga0181505_102298911 | 3300016750 | Peatland | NTAVIKALVARFPEFRDAFGGVVARGVDPSGHDFSSLLAMKDIK |
| Ga0187802_100289523 | 3300017822 | Freshwater Sediment | SDTAHTFRENTAVIKALLARFPEFRDAFGSVVARAVDPSGHDYGTLLAMKDIK |
| Ga0187802_103921152 | 3300017822 | Freshwater Sediment | VLVAKYPEVRKAFACVVARAVDPSDRDYGTLLAMKDIK |
| Ga0187818_104792582 | 3300017823 | Freshwater Sediment | FQENTAMIEALVVKFPELREAFAGVVARAVEPSGRDYGTLMTMKEIK |
| Ga0187806_12446301 | 3300017928 | Freshwater Sediment | TNLAYQNNVAVIKALVAKYPEVRDAFASVVARAVDPNGHDYGTLLAM |
| Ga0187801_100656302 | 3300017933 | Freshwater Sediment | LVAKFPELRDGFSGVVARAVEPSGRDYGTLIAMKEIK |
| Ga0187801_104748262 | 3300017933 | Freshwater Sediment | RENTAVIKALLARFPEFRDAFGSVVARAVDPSGHDYGTLLAMKDIK |
| Ga0187803_103847111 | 3300017934 | Freshwater Sediment | LLAKFPEFRDAFAGVVARAVEPSGRDYGSLMPMKEIK |
| Ga0187821_102263981 | 3300017936 | Freshwater Sediment | QENVNVMKALVTKIPEVRDAFAAVVARAVDTSGRDYGTLLAMKDIK |
| Ga0187821_103866731 | 3300017936 | Freshwater Sediment | NVAVIKALATKYPEIRNAFAAIVARAVDPTGRDYGTLLAMKDIK |
| Ga0187854_102339531 | 3300017938 | Peatland | KGLVAKYPELRDAFAGVVARAVDPNGRDYGTLLAMKDIK |
| Ga0187854_104611091 | 3300017938 | Peatland | KALVAKFPEFRDAFAGVVARAVEPSGHDFSSLMAMKDIK |
| Ga0187850_102565371 | 3300017941 | Peatland | NNALTFQENTAVIKALVAKFPEFREAFAGVVARAVDSSGRDYGTLMAMKEIK |
| Ga0187808_100795123 | 3300017942 | Freshwater Sediment | DTQRAFDDNMAVIRAIVARYPEFREAFAGVIARATEPSGRDYGTLLAMKDVK |
| Ga0187819_102121101 | 3300017943 | Freshwater Sediment | DPQRAFDDNMAVIRAFIGRYPEFREAFAGVVARATEPSGRDYGTLLAMKDVK |
| Ga0187819_105615261 | 3300017943 | Freshwater Sediment | VSVINAVVAKYPEVRDTFAGVVARAVDPSGRDFGTLLAMKDIK |
| Ga0187783_110834701 | 3300017970 | Tropical Peatland | ANQAYQDNVAVMKALVAKFPEVRDAFAAVVARAVDASGQDYGTLLAMKDIK |
| Ga0187781_104760703 | 3300017972 | Tropical Peatland | MAVIRAIVGRYPEFREAFAGVVARATEPSGRDYGTLLAMKDVK |
| Ga0187780_107401152 | 3300017973 | Tropical Peatland | YQDNVAVMKALVAKFPEVRDAFAAIVARAVDASGQDYGTMLAMKDIK |
| Ga0187823_103696131 | 3300017993 | Freshwater Sediment | AAKYPEVRDAFASIIARAVEPSGRDYGTMLAVKEIK |
| Ga0187816_105680022 | 3300017995 | Freshwater Sediment | IKALVAKYPELQDAFAAVVARAVDSSGRDYGTLLAMKEIK |
| Ga0187815_102106571 | 3300018001 | Freshwater Sediment | LVAKFPEFRQAFAGVVARAVDPSGRDYGTLMAMKDVK |
| Ga0187804_102147552 | 3300018006 | Freshwater Sediment | YQDNVNVMKALVTKYPEVRDAFAAVVARAVDQAGHDYGTLLAMKDIK |
| Ga0187861_103251601 | 3300018020 | Peatland | AKFPEFREAFAGVVARAVEPSGRDYGSLIEMKDIK |
| Ga0187881_102146052 | 3300018024 | Peatland | ARTFQENTALIKALVVKFPEFRGAFAGVVARAVEPSGRDYGTLVAMKDIK |
| Ga0187869_100811551 | 3300018030 | Peatland | LLAKFPELRDAFAGVAARAVEPSGRDFSSLMAMKDIK |
| Ga0187855_102672932 | 3300018038 | Peatland | SNTNAAYQANIAVMKALLTKYPELRDAFAAVVARGVDPSGRDYGTMSAMKDIK |
| Ga0187862_102962481 | 3300018040 | Peatland | AVAAKFPELRDAFAGVVARAVDASGNDYGTMLPMKEIK |
| Ga0187887_103382052 | 3300018043 | Peatland | TAVIRALVAKYPEVRQAFAGVVARAVDSGGRDFVTLIAMKDIK |
| Ga0187887_108446442 | 3300018043 | Peatland | YWAADVSNTAQTFQENSAVIHALLTRYPELRQAFSGIVARAVTATGEDYGTLLAMKDIH |
| Ga0187859_106898992 | 3300018047 | Peatland | LVAKYPEVRQAFAGVVARAVDPGGRDFVTLIAMKDIK |
| Ga0187858_100889431 | 3300018057 | Peatland | AKFPEFREAFAGVVARAVESSGRDYGTLVAMKDIK |
| Ga0187765_111271301 | 3300018060 | Tropical Peatland | SNVSVIKALVAKYPEVRDAFSAMVARAVDANGHDFGTLLAMKDIK |
| Ga0187784_110373141 | 3300018062 | Tropical Peatland | KALVAKFPELRDAFAAIVARAVDPSGHDFGTLLAMKDIK |
| Ga0187784_111053191 | 3300018062 | Tropical Peatland | AKFPELKSGFDAVVARAVAPSGEDYGSLVEMKDIK |
| Ga0187772_104283813 | 3300018085 | Tropical Peatland | DTKKTFDENMAVIRAIVGRYPEFREAFAGVVARATEPSGRDYGTLLAMKDVK |
| Ga0187769_113954012 | 3300018086 | Tropical Peatland | SNTGQANQNNVAVIKALVAKFPELRDAFAAVVARAVDPSGRDFGTLLAMKDIK |
| Ga0187771_106428212 | 3300018088 | Tropical Peatland | LAKFPELRTAFAGVVARAVTPSGDDYGSLVSMKEIK |
| Ga0187770_100503581 | 3300018090 | Tropical Peatland | TQQMFEENTAVIRALVGRYPEFRDAFAGVIARATEPSGRDYGTLLAMKDVK |
| Ga0187770_103707662 | 3300018090 | Tropical Peatland | AKFPELRTAFAGVVARAVTPSGDDYGSLVSMKEIK |
| Ga0187770_105032512 | 3300018090 | Tropical Peatland | VIKALVAKFPEFRNAFAGVVARAVEPSGRDYGTLMAMKDIK |
| Ga0187770_115339891 | 3300018090 | Tropical Peatland | YQSNVAVIKALVAKHPEMREAFAAVVARAVDPSGRDYGTLLGMKDIK |
| Ga0066667_112895471 | 3300018433 | Grasslands Soil | MAVISAVVGKYPEFREIFQGVVARAVDPAGHDYGTLLAMKDVK |
| Ga0066662_111046291 | 3300018468 | Grasslands Soil | QKYPEVRDAFDGVVARGVESSGRDYGTMMPMKDIK |
| Ga0066662_129854962 | 3300018468 | Grasslands Soil | ALVTKYPEVRDAFAAVVARAVDPAGRDYGTLLAMKDIK |
| Ga0187800_13375531 | 3300019278 | Peatland | AKAVLAKFPELRTAFAGVVARAVTPSGDDYGSLVSMKEIK |
| Ga0187797_10414241 | 3300019284 | Peatland | VAVMKALVGKYPELRDAFAGVVARATDPSGRDYGTLLAMKDIK |
| Ga0182025_12844291 | 3300019786 | Permafrost | LKALLGKYPELRDRFAAIVARAVDASGRDYGTMLAMKDINR |
| Ga0182031_10364771 | 3300019787 | Bog | GGHESSDKALIAKFPELRPAFSGIVARATTPSGQDYGTLLSMKDIR |
| Ga0193728_10281543 | 3300019890 | Soil | MKALVSKYPELRDAFAAIVARAVDPGGRDYGTMLAMKDIK |
| Ga0193728_13480651 | 3300019890 | Soil | MTVMKALIAKYPELREAFGGIVARAVEPSGRDYGSLMAMKDIK |
| Ga0193730_11293931 | 3300020002 | Soil | VAKYPEFREAFAGIVARAVETSGRDYGSLMAMKDIK |
| Ga0187768_11053742 | 3300020150 | Tropical Peatland | LADTGRAFQENNTVINTLVAKFPELRDGFQAVVARATDPAGRDYGTMVAMKDIK |
| Ga0210403_110492311 | 3300020580 | Soil | ADISNTNQAYQNNLAVIKALVAKYPELRDAFAGIVARAVDPAGRDYGTLLAMKDIK |
| Ga0210403_112413052 | 3300020580 | Soil | ALVTKYPEVRDAFAAVVARAVDPSGQDYGTLLAMKDIK |
| Ga0210399_101600491 | 3300020581 | Soil | ENTAVIKALVAKFPEFREAFAGVVARAVEPSGRDYGSLMAMKDIK |
| Ga0210401_109310852 | 3300020583 | Soil | LVGKFPEFRDAFDGVVARAVEPTTGRDYGSLLPMKDIK |
| Ga0210401_115041052 | 3300020583 | Soil | SALVGKFPEFRDAFDGVVARAVEPTTGRDYGSLQQMKDIK |
| Ga0210404_107054781 | 3300021088 | Soil | DVSDTGLAFRENSAIIKALLAKFPELRNAFAGVVARAVDPSGRDYGTLLAMKDIK |
| Ga0210400_101219033 | 3300021170 | Soil | NQAYQGNVNVIKAVATKYPEVRDAFAAVVARAVDPQGRDYGTLLAMKDIK |
| Ga0210405_102868423 | 3300021171 | Soil | VIKALVTKFPEFREAFAGVVARAVEPSGRDYGSLMAMKDIK |
| Ga0210408_108761191 | 3300021178 | Soil | ENTAVIKALISKFSEFRDAFDGVVARAVEPSTGRDYGSLLAMKDIK |
| Ga0210388_101231432 | 3300021181 | Soil | MKALVAKYPEVREAFAAVVARAVDPGGRDYGTPLAMKDIK |
| Ga0210388_117532531 | 3300021181 | Soil | YQSNVAVIGALIAKYPELKEAFAGVVARAVDPSGRDYGTLLAMKEIK |
| Ga0210393_101328731 | 3300021401 | Soil | ALVGKFPEFRDAFDGVVARAVEPTTGRDYGSLLPMKDIK |
| Ga0210389_105888461 | 3300021404 | Soil | NVAVMKALLKKYPELRDAFAAVVARAVDPAGHDYGTLLAMKDIK |
| Ga0210386_107399331 | 3300021406 | Soil | QAADVSNTTQAYQSNVAVIGALIAKYPELKEAFAGVVARAVDPSGRDYGTLLAMKEIK |
| Ga0210386_111551981 | 3300021406 | Soil | ASVADTNQTYQSNVAVMKALVTKYPELKDAFTGVVARATDSSGRDYGTMLAMKDIK |
| Ga0210383_116044811 | 3300021407 | Soil | TKYPELRDAFAGVVARAVDPSARDYGTLLAMKDVK |
| Ga0210394_116926732 | 3300021420 | Soil | VIKALVSKFPEVRDAFAAVVARAVEPGGRDYGTLLTMKEIR |
| Ga0210384_105478341 | 3300021432 | Soil | VSNPNLAYQDNLNVIKALVTKYPEVRDAFAAVVARAVDTTGRDYGTLLAMKDVK |
| Ga0210384_115599961 | 3300021432 | Soil | AANISNTVQTFQTNLAVIKALVIKYPEVRDAFAAVVARAVDPAGRDYGTLLAMKDIK |
| Ga0210390_104955862 | 3300021474 | Soil | KYPEFRDAFEGVVARAVEPSTGRDYGSLLPMKDIK |
| Ga0210390_113433151 | 3300021474 | Soil | VAKYPEVREAFAAVVARAVDASGRDYGTLMAMKDIK |
| Ga0210410_100073491 | 3300021479 | Soil | AADISNTSQAYQTNVAVIKAVAAKYPEVRHAFAGVVARAVDPGGRDYGTLLAMKDIK |
| Ga0210409_105217442 | 3300021559 | Soil | KALVAKFPEFREAFAGVVARAVEPSGRDYGSLMAMKDIK |
| Ga0126371_127073801 | 3300021560 | Tropical Forest Soil | MKALIAKYPEFRSAFGAVVARAVQADGKDYGSLMPVKDIK |
| Ga0213852_14834563 | 3300021858 | Watersheds | AKYPELRDNFDGVIARGVEPSGRDYGTMLHMKDIK |
| Ga0242659_10509251 | 3300022522 | Soil | TYSSNVAVMKALLVKYPELRGAFVSVVARAGEPSGRDYGTMLAMKDIK |
| Ga0242665_102205631 | 3300022724 | Soil | TNVSNTNVAYQENVNVMKALVTRFPEVRDAFSAVVARAVDTTGRDYGTLLAMKDIK |
| Ga0224569_1000461 | 3300022732 | Rhizosphere | LVAKYPELRDAFVSVVARAVDPSGRDYGTLLAMKDIK |
| Ga0224553_11227832 | 3300022875 | Soil | ISDTARVFQENSTVIKALVAKFPELREAFAGAVARAVDPSGHDYGTLLAMKDVK |
| Ga0224572_11057241 | 3300024225 | Rhizosphere | ADTTQAYQTNVAVMKALLVKYPELRDAFAGIVARATDPSGRDYGTMLAMKEIK |
| Ga0224564_11173201 | 3300024271 | Soil | KALLVKYPELRDAFAGIVARATDPSGRDYGTMLAMKEIK |
| Ga0224556_11463552 | 3300024295 | Soil | YQNNVAVMKSLVAKYPELRDAFTGVVARAVDPNGRDYGTLLAMKEIK |
| Ga0208194_10015275 | 3300025412 | Peatland | SLVAKYPELRDAFTGVVARAVDPNGRDYGTLLAMKEIK |
| Ga0208077_10145972 | 3300025427 | Arctic Peat Soil | YQNNVTVIKALVAKYPELRDAFAGVVARAVDPSGRDYGTLLAMKDVK |
| Ga0208456_10691321 | 3300025441 | Peatland | VIKALVARSPELREAFDGVVARAVEPSGHDYGSLMAMKDIK |
| Ga0208039_10990001 | 3300025454 | Peatland | VSNTTRTFQENTAVIKALIAKFPEFREAFAGVVARAVDPSGHDYGTLLAMKDIK |
| Ga0208188_11415251 | 3300025507 | Peatland | SALTFPENTAVIKALVAKFPEFREAFAGVVARAVDPSGRDYGSLMEMKDIK |
| Ga0208220_10885121 | 3300025627 | Arctic Peat Soil | DNMAVMKALITKFPEFRDAFDEMVARAVEPSGKDFGSLLSMKDIK |
| Ga0207699_112920112 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | AIVTKYPEVRDAFAAVVARAVDSTGRDYGTLLAMKDIK |
| Ga0207684_101131801 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | IKALVMKYPEVRDAFAAVVARAVDPSGRDYGTLLAMKDVK |
| Ga0207671_102544322 | 3300025914 | Corn Rhizosphere | AILTKFPELRDAFDGVVARAVEMSGRDYGSMLAMKDIK |
| Ga0207687_104268382 | 3300025927 | Miscanthus Rhizosphere | ILTKFPELRDAFDGVVARAVEMSGRDYGSMLAMKDIK |
| Ga0207700_1000497811 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | KAILAKFPELRDAFEGIVARAVEMSGRDYGSMLAMKDIK |
| Ga0207668_100591253 | 3300025972 | Switchgrass Rhizosphere | IKAIVAKYPEFREAFAGIVARAVEPSGKDYGSLMAMKEIK |
| Ga0207677_103943491 | 3300026023 | Miscanthus Rhizosphere | NVMKAILAKFPELRDAFEGIVARAVEMSGRDYGSMLAMKDIK |
| Ga0207639_108485031 | 3300026041 | Corn Rhizosphere | TKFPELREAFDGVVARAVEMSGRDYGSMLAMKDIK |
| Ga0209840_10069735 | 3300026223 | Soil | AKFPEFREAFAGVVARAVEPSGHDYGTLMAMKEIK |
| Ga0209863_101785142 | 3300026281 | Prmafrost Soil | HVLLVKYPELREAFAAIVARAVDPTGRDYGSLVTMKEIK |
| Ga0257154_10275201 | 3300026467 | Soil | TYQSNVAVMKALVTKYPELRDAFAAIVARAVDPSGRDYGTMLAMKDIK |
| Ga0257177_10720972 | 3300026480 | Soil | LIKALVAKYPEFREAFAGVVARAVEPSGHDYGSLMAMKDVK |
| Ga0257161_10486271 | 3300026508 | Soil | KALVAKFPEFREAFAGVVARAVEPSGHDYGSLMAMKDIK |
| Ga0179587_105351541 | 3300026557 | Vadose Zone Soil | KALVSKYPELRDAFAAIVARAVDPGGRDYGTMLAMKDIK |
| Ga0207740_10231412 | 3300027011 | Tropical Forest Soil | TAVMKALVAKYPEVRDAFAAVVARAVDPTGRDYGTLLAMKDIK |
| Ga0208366_10180161 | 3300027073 | Forest Soil | MKALVTKYPELRDAFDGIVARAVEPSGRDYGSLLAMKSIK |
| Ga0208603_10350921 | 3300027109 | Forest Soil | QASDISNSNQTYQVNVAVMKALIAKFPELRGAFAGIVVRAVDPSGRDYGTMLAMKEIK |
| Ga0208993_10522572 | 3300027480 | Forest Soil | RTFKENAALIKALVAKYPELREAFAGVVARAVETSGRDYGTLLAIKDVK |
| Ga0208199_10691662 | 3300027497 | Peatlands Soil | YQSNVAVMKGLVAKYPELRDGFASVVARAVDPSGHDYGTLLAMKEIK |
| Ga0209222_10632262 | 3300027559 | Forest Soil | YQSNIAVMKALVTKYPELRDAFGSVVARAVDPGGHDYGTLLAIKDIK |
| Ga0209115_10270482 | 3300027567 | Forest Soil | KALVTKYPELRDAFGSVVARAVDPGGHDYGTLLAIKDIK |
| Ga0208324_11660011 | 3300027604 | Peatlands Soil | ADISNTQLAYQNNIAVIKALVVKYPEVRDAFAAVVARAVDPSGRDYGTLLAMKDVK |
| Ga0208324_11958461 | 3300027604 | Peatlands Soil | AVIKALVAKYPELKDAFAGVVARAVDPSGHDYGTLLAMKEIK |
| Ga0209626_10012418 | 3300027684 | Forest Soil | VATKYPEVRDAFAAVVARAVDPQGRDYGTLLAMKDIK |
| Ga0208696_10453991 | 3300027696 | Peatlands Soil | KYPEFREAFDGVVARAVEPTTGRDYGSLLPMKDIK |
| Ga0209073_102947411 | 3300027765 | Agricultural Soil | AVLAKFPELRDAFDGVVTRAVEMSGRDYGSMLAMKDIK |
| Ga0209448_100543701 | 3300027783 | Bog Forest Soil | MKALVAKYPEVRDAFAAVVARAVDPAGRDYGTLLAMKDIK |
| Ga0209448_101694502 | 3300027783 | Bog Forest Soil | ALIAKYPEFREAFAGVVARAVDPSGHDYGTLLAMRDIK |
| Ga0209656_103685812 | 3300027812 | Bog Forest Soil | AKYPEFRDAFDGVVARAVEPTTGRDYGSLLPMKDIK |
| Ga0209040_101146101 | 3300027824 | Bog Forest Soil | DNVAVIKALVAKYPEFRDAFDGVVARAVEPTTGRDYGSLLPMKEIK |
| Ga0209039_102558512 | 3300027825 | Bog Forest Soil | LANQDNMAVIKALVTKYPELRDAFSAVVALAEDDSGHDYGSVLPMKDVK |
| Ga0209060_102297291 | 3300027826 | Surface Soil | AYQDNVAVMKGLVAKFPELKDAFAGIVARAVDTGGRDYGTMLAMKDIK |
| Ga0209773_102765971 | 3300027829 | Bog Forest Soil | VADVSNTNQTYQSNVAVVKALITKYPELRDAFAAVVARAVDPNGHDYGTMLVMKDIK |
| Ga0209580_103104103 | 3300027842 | Surface Soil | GNVAVIKAIANKYPEVRGAFAAIVARAVDPTGRDYGTLLAMKDIK |
| Ga0209580_104252211 | 3300027842 | Surface Soil | LIAKYPEFKDAFAGVVARAVDPSGHDFGTLLAMKDIK |
| Ga0209693_100350021 | 3300027855 | Soil | RTYQSNLIVIKALVAKFPELKTAFVGVVARAVEPGGRDYGTLLAMKDVK |
| Ga0209167_105048691 | 3300027867 | Surface Soil | AKFPEVRDAFAAVVARAVDQTGRDYGTLLAMKDIK |
| Ga0209579_101859572 | 3300027869 | Surface Soil | AVVTKFPELRDAFPSVDAIAIDPSSRDYSTLLAMKDIK |
| Ga0209465_102593932 | 3300027874 | Tropical Forest Soil | ALIQKYPEFRSAFGAVVARAVQADGKDYGSLMPVKDIK |
| Ga0209283_102020662 | 3300027875 | Vadose Zone Soil | AKYPEFRDAFDGVVARAVEPSGRDYGSLLAMKDIK |
| Ga0209380_101547892 | 3300027889 | Soil | VTKYPELREAFAGIVVRAVDSGGHDYGTLLGMKEIK |
| Ga0209380_101931122 | 3300027889 | Soil | GADISNTAQAYQSNVAVMKTLLKKYPELRDAFAAVVARAVDPAGHDYGTLLAMKDIK |
| Ga0209777_106822281 | 3300027896 | Freshwater Lake Sediment | SVIKALVGKFPELREAFQGVVARAVEPSGRDYGTLMAMKEIK |
| Ga0209488_109314351 | 3300027903 | Vadose Zone Soil | AVMRALVTKYPEFKQAFAAVNARAVDPSGRDYGTLLSMKDIK |
| Ga0209415_107379092 | 3300027905 | Peatlands Soil | SNTRQMFDENMAVIRAIVGRYPQLREAFAGVVARATEPSGRDYGTLLAMKDVK |
| Ga0209415_107927292 | 3300027905 | Peatlands Soil | SNTARTFQENTALIKALVARFPEFRDAFAGVVARAVEPSGHDFSSLMAMKDIK |
| Ga0209526_102533641 | 3300028047 | Forest Soil | NTNLAYQGNVNVIKAVATKYPEVRDAFAAVVARAVDPQGRDYGTLLAMKDIK |
| Ga0302144_102580711 | 3300028560 | Bog | LAKYPELRDAFSSVVARAVDPSGRDYGTLLAVKDVK |
| Ga0302151_100122547 | 3300028562 | Bog | ARVFQENSTVIKALVAKFPELREAFAGAVARAVDPSGHDYGTLLAMKDVK |
| Ga0302160_100946471 | 3300028665 | Fen | LIKALVARFPEFRDAFAGVAARAIDPAGQGYGSMLPMKEIK |
| Ga0302214_10438072 | 3300028736 | Fen | AKALVVKFPEFRDAFAGVVTRAVEPAGRDYGSLLLMKDIK |
| Ga0302224_101167342 | 3300028759 | Palsa | YQNNVSVMKALVTKFPEVKDAFAGIVARAVDPSGRDYGTMLAMKDIK |
| Ga0302234_104823601 | 3300028773 | Palsa | VTVIKALVAKYPEVRDAFAGVVARAVDPSGRDYGTLLAMKDVK |
| Ga0302225_105593292 | 3300028780 | Palsa | TQIYQSNVAVIKALIAKYPELRSAFAAVVARAVDPSGRDYGTLLAMKDIH |
| Ga0302226_103533312 | 3300028801 | Palsa | VMKALIAKYPELRDAFTAVVARAVDPSGHDYGTLLAMKDIK |
| Ga0308309_108610692 | 3300028906 | Soil | VIGALIAKYPELKEAFAGVVARAVDPSGRDYGTLLAMKEIK |
| Ga0302200_101092751 | 3300028909 | Bog | VAAKYPEVRKAFSGIVARATTAGGQDYGTLLVMKDIS |
| Ga0311359_102981741 | 3300029914 | Bog | VSVMKALVTKFPELKDAFAGIVARAVDPSGRDYGTMLAMKDIK |
| Ga0311328_101785681 | 3300029939 | Bog | MKSLVAKYPELRDAFTGVVARAVDPNGRDYGTLLAMKEIK |
| Ga0311371_111784591 | 3300029951 | Palsa | TARTFQENTAVIKGLVTRYPELRDAFGGVVARAVDPSGRDYGTLLPMKEIK |
| Ga0311343_110001941 | 3300029953 | Bog | NNVAVMKSLVAKYPELRDAFTGVVARAVDPNGRDYGTLLAMKEIK |
| Ga0311339_109414831 | 3300029999 | Palsa | TARAFQDNSAVIKALLGKYPELREAFAGVVARAVDPSGRDYGTLLAMKDVK |
| Ga0311339_109432911 | 3300029999 | Palsa | NLAVIKALVAKYPELRDAFAAVVARAVDPGGHDFGTMLAMKEIK |
| Ga0311338_111137192 | 3300030007 | Palsa | DISDTARAFQDNSAVIKALLGKYPELREAFAGVVARAVDPSGRDYGTLLAMKDVK |
| Ga0311344_111288841 | 3300030020 | Bog | NVAVMKSLVAKYPELRDAFTGVVARAVDPNGRDYGTLLAMKEIK |
| Ga0302306_102264042 | 3300030043 | Palsa | AKFPELREAFAGVVARAVDQWGRDYGTLLAMKDIK |
| Ga0302282_13717182 | 3300030045 | Fen | TTQAYQNNVAVMKSLVAKYPELRDAFTGVVARAVDPNGRDYGTLLAMKEIK |
| Ga0302179_100939032 | 3300030058 | Palsa | LAVMKALVAKYPELRDAFAAVVARAVDPGGHDFGTMLAMKEIK |
| Ga0311370_115863401 | 3300030503 | Palsa | QAADVSDTSRTFQENTAVIKALIAKFPEFREAFAGVVARAVDPSGHDFGTLLTMKDIK |
| Ga0311357_103504951 | 3300030524 | Palsa | ALVTKFPEVKDAFAGIVARAVDPSGRDYGTMLAMKDIK |
| Ga0316363_103589611 | 3300030659 | Peatlands Soil | YQDNVAVIKAVAAKYPELRDAFAGVVARAVDPSGHDFGTLLAMKDIK |
| Ga0310039_103729702 | 3300030706 | Peatlands Soil | LVKYPEFRDAFDGVVVRAVEPSGRDYGSLLPMKDIK |
| Ga0310038_101878671 | 3300030707 | Peatlands Soil | KYPEFREAFEGVVARAVEPTTGRDYGSLLPMKDIK |
| Ga0302312_103533781 | 3300030746 | Palsa | AVMKALIAKYPELRDAFTAVVARAVDPSGHDYGTLLAMKDIK |
| Ga0311335_102151101 | 3300030838 | Fen | KALVARFPEFREAFAGVAARAIDPTGQGYGSMLPMKEIK |
| Ga0265770_10822922 | 3300030878 | Soil | QAYQSNVTVMKTLLKKYPELRDAFAAVVARAVDPAGHDYGTLLAMKDIK |
| Ga0302180_103133011 | 3300031028 | Palsa | FQDNSAVIKALLGKYPELREAFAGVVARAVDPSGRDYGTLLAMKDVK |
| Ga0265760_102291481 | 3300031090 | Soil | SDTTRAFQDNSAVIKALLGKYPELREAFAGVVARAVDPSGRDYGTLLAMKDVKDVK |
| Ga0170824_1071235302 | 3300031231 | Forest Soil | ALVTKYPELRDIFAGMVARAVDPNGRDYGTLLAMKDIK |
| Ga0302324_1002442693 | 3300031236 | Palsa | KALVGKFPEFREAFAGVVARAVDPSGRDYGTLLAMKDVK |
| Ga0265316_100585841 | 3300031344 | Rhizosphere | IKTIVAKYPEVRDAFAAIVARAVDTSGHDFGSVVPMKDVK |
| Ga0311364_110978812 | 3300031521 | Fen | VARFPEFREAFAGVAARAIDPTGQGYGSMLPMKEIK |
| Ga0302326_118513922 | 3300031525 | Palsa | VAKFPELREAFAGVVARAVDQWGRDYGTLLAMKDIK |
| Ga0318574_106526132 | 3300031680 | Soil | AVIAKYPEFKNAFTGVEAFAVDPNGRNYGTLLAMKDIK |
| Ga0310686_1036491642 | 3300031708 | Soil | LLGKYPELREAFAGVVARAVDPSGRDYGTLLAMKDVK |
| Ga0310686_1066483373 | 3300031708 | Soil | IVIKALVAKFPEFRGAFAGVVARAVEPSGRDYGTLLSMKDLK |
| Ga0307476_102216901 | 3300031715 | Hardwood Forest Soil | LVAKYPEIRASFAAVVARAVDSSGRDYGTLLAMKDIK |
| Ga0307469_103389161 | 3300031720 | Hardwood Forest Soil | MKVGRALLAKFPELREAFAGVEVRAVDPSGRDYGSLLAMKDIK |
| Ga0307475_108899911 | 3300031754 | Hardwood Forest Soil | AVIKALVTKYPEFREAFAGVVARAVEPSGRDYGSLVAMKDIK |
| Ga0307478_116400012 | 3300031823 | Hardwood Forest Soil | NIAVMKALITKYPEFRDAFEGIVARGVESAGRDYGTMMPMKDLK |
| Ga0306923_118623332 | 3300031910 | Soil | MVTKYPELRDAFAAVVARAVDATGRDYGTLLAMKDIR |
| Ga0307479_119794562 | 3300031962 | Hardwood Forest Soil | KALVIKYPELRDAFAAVVARAVDPAGRDYGTLLAMKDIK |
| Ga0306922_123267881 | 3300032001 | Soil | SDTGKAFQDNTAVIRGVLARYPELRDAFTSVVARATDPSGRDYGTMLKIADVK |
| Ga0307411_104950371 | 3300032005 | Rhizosphere | LTKWPELREGFQTIVARAVAPAGNDYGSMMAMKDVK |
| Ga0311301_113867591 | 3300032160 | Peatlands Soil | GRYPQLREAFAGVVARATEPSGRDYGTLLAMKDVK |
| Ga0311301_120568542 | 3300032160 | Peatlands Soil | ISNSNQTYQNNVAVIKAVAAKYPELRDAFAGVVARAVDLSGHDFGTLLAMKDIK |
| Ga0311301_122277682 | 3300032160 | Peatlands Soil | KALVAKFPEFREAFAGVVARAVEPSGRDYGTLMAMKEIK |
| Ga0311301_130265582 | 3300032160 | Peatlands Soil | KALVAKFPEFREAFAGVVARAVDPSGRDYGSLMAMKDIK |
| Ga0315268_118362332 | 3300032173 | Sediment | TAVIRALLAQFPEFRNAFAAVVARAVAANGNDYGTILAMKDVK |
| Ga0307471_1007619161 | 3300032180 | Hardwood Forest Soil | MTVMKALVAKYPEFREAFAGIVARAVETSGRDYGSLMAMKDIK |
| Ga0307472_1001312863 | 3300032205 | Hardwood Forest Soil | MFKALIAKYPELREGFGGIVARAVESSGRDYGSLMAMKDIK |
| Ga0307472_1011006522 | 3300032205 | Hardwood Forest Soil | FQTNLSVIKALVTKYPEVRDAFAAVVARAVDPAGRDYGTLLAMKDIK |
| Ga0306920_1002035871 | 3300032261 | Soil | ALVTKYPEVRDSFAAVVARAVDTSGRDYGTLLAMKDIK |
| Ga0348332_115484081 | 3300032515 | Plant Litter | DISNTTQTYQNNVAVMKALVAKYPELRDAFVSVVARAVDPSGRDYGTLLAMKDIK |
| Ga0316231_12662691 | 3300032722 | Freshwater | KTLVAKFPELRSAFSGIVARATTASGQDYGTLLAMKDIH |
| Ga0335085_109804821 | 3300032770 | Soil | SKYPELREGFNAIVVRAVAPNGEDYGTLLAMKDIK |
| Ga0335082_104748342 | 3300032782 | Soil | ATVARFPEFRDAFDGIAARAVEPSGRDYGSMLPVKEIK |
| Ga0335079_101179071 | 3300032783 | Soil | KALVAKYPELRDAFVSVVARAVDPSGRDYGTLLAMKDIK |
| Ga0335079_108103862 | 3300032783 | Soil | NTNQAYQSNLAVIQALVQKYPEVRDAFAGIVARAIDSSNRDYGTLQAMKDIK |
| Ga0335078_118898861 | 3300032805 | Soil | ALLAKFPELRDGFDGMVVRAVEPSGKDYGSMLAMKDIK |
| Ga0335070_1000107823 | 3300032829 | Soil | KDNVEVIKALVAKYPELRNAFAGVVARAVEPSGRDYGTMLMMKDIK |
| Ga0335081_100541791 | 3300032892 | Soil | MRALVSKFPEFRQAFDGLVARAVEPSGKDYGSLLAIKDLP |
| Ga0335081_101617981 | 3300032892 | Soil | LAKYPELRDAFAAVVARAVDPSGHDYGTLLAMKDIK |
| Ga0335081_103527243 | 3300032892 | Soil | ARYPEFRDAFAGVVARATETSGRDYGTMLAMKDVK |
| Ga0335083_103055842 | 3300032954 | Soil | GAAFQDNIAVIKALVAKYPELRDGFGGVVARATETSGKDYGTLLLMSEIK |
| Ga0335073_108363762 | 3300033134 | Soil | SNMAVIKALVAKYPELREAFAAVVARAVDPSGHDYGTLLAMKEIR |
| Ga0326727_103298372 | 3300033405 | Peat Soil | KALVGKYPELKEAFAGVVARAVDPSGRDYGTLLAMKDIK |
| Ga0316214_10320801 | 3300033545 | Roots | DVSNTTQAYQSNVAVIGALIAKYPELKEAFAGVVARAVDPSGRDYGTLLAMKEIK |
| Ga0326724_0620487_424_534 | 3300034091 | Peat Soil | AAKFPELRDAFHGVVARAVDPSGRDYGTLVAMKEIK |
| ⦗Top⦘ |