Basic Information | |
---|---|
Family ID | F007760 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 345 |
Average Sequence Length | 43 residues |
Representative Sequence | IDWKEAMELLRSAPQTPPLLLELAEDEKVNPLEKLGETFEKLET |
Number of Associated Samples | 271 |
Number of Associated Scaffolds | 345 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 2.32 % |
% of genes near scaffold ends (potentially truncated) | 96.81 % |
% of genes from short scaffolds (< 2000 bps) | 91.30 % |
Associated GOLD sequencing projects | 248 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.58 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (68.696 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.594 % of family members) |
Environment Ontology (ENVO) | Unclassified (21.159 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.594 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.28% β-sheet: 0.00% Coil/Unstructured: 59.72% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 345 Family Scaffolds |
---|---|---|
PF01336 | tRNA_anti-codon | 85.80 |
PF00491 | Arginase | 5.80 |
PF01261 | AP_endonuc_2 | 1.45 |
PF02585 | PIG-L | 0.58 |
PF07478 | Dala_Dala_lig_C | 0.58 |
PF00248 | Aldo_ket_red | 0.29 |
PF00152 | tRNA-synt_2 | 0.29 |
PF01258 | zf-dskA_traR | 0.29 |
PF13366 | PDDEXK_3 | 0.29 |
PF13419 | HAD_2 | 0.29 |
PF02702 | KdpD | 0.29 |
PF01820 | Dala_Dala_lig_N | 0.29 |
PF00829 | Ribosomal_L21p | 0.29 |
PF00005 | ABC_tran | 0.29 |
PF00528 | BPD_transp_1 | 0.29 |
PF00144 | Beta-lactamase | 0.29 |
COG ID | Name | Functional Category | % Frequency in 345 Family Scaffolds |
---|---|---|---|
COG0010 | Arginase/agmatinase family enzyme | Amino acid transport and metabolism [E] | 5.80 |
COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 0.58 |
COG0017 | Aspartyl/asparaginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.29 |
COG0173 | Aspartyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.29 |
COG0261 | Ribosomal protein L21 | Translation, ribosomal structure and biogenesis [J] | 0.29 |
COG1181 | D-alanine-D-alanine ligase or related ATP-grasp enzyme | Cell wall/membrane/envelope biogenesis [M] | 0.29 |
COG1190 | Lysyl-tRNA synthetase, class II | Translation, ribosomal structure and biogenesis [J] | 0.29 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.29 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.29 |
COG1734 | RNA polymerase-binding transcription factor DksA | Transcription [K] | 0.29 |
COG2205 | K+-sensing histidine kinase KdpD | Signal transduction mechanisms [T] | 0.29 |
COG2269 | Elongation factor P--beta-lysine ligase (EF-P beta-lysylation pathway) | Translation, ribosomal structure and biogenesis [J] | 0.29 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.29 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 68.70 % |
All Organisms | root | All Organisms | 31.30 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2124908009|FWIRA_GRAM18401DOTXK | Not Available | 517 | Open in IMG/M |
2189573000|GPBTN7E02HMGYA | Not Available | 508 | Open in IMG/M |
3300000655|AF_2010_repII_A100DRAFT_1090723 | Not Available | 536 | Open in IMG/M |
3300000955|JGI1027J12803_106327337 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1787 | Open in IMG/M |
3300000955|JGI1027J12803_107886858 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 704 | Open in IMG/M |
3300003219|JGI26341J46601_10183518 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 573 | Open in IMG/M |
3300004080|Ga0062385_11061615 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 547 | Open in IMG/M |
3300004082|Ga0062384_101339425 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 525 | Open in IMG/M |
3300004480|Ga0062592_102561645 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 514 | Open in IMG/M |
3300004635|Ga0062388_100316351 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1312 | Open in IMG/M |
3300005167|Ga0066672_10256334 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1127 | Open in IMG/M |
3300005172|Ga0066683_10655828 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 628 | Open in IMG/M |
3300005178|Ga0066688_10870956 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 558 | Open in IMG/M |
3300005181|Ga0066678_10954794 | Not Available | 558 | Open in IMG/M |
3300005332|Ga0066388_106864756 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 573 | Open in IMG/M |
3300005355|Ga0070671_100490520 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1056 | Open in IMG/M |
3300005434|Ga0070709_10342484 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1102 | Open in IMG/M |
3300005434|Ga0070709_10521888 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 905 | Open in IMG/M |
3300005435|Ga0070714_101991807 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 566 | Open in IMG/M |
3300005435|Ga0070714_102071921 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 554 | Open in IMG/M |
3300005435|Ga0070714_102355849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 518 | Open in IMG/M |
3300005439|Ga0070711_100263942 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1356 | Open in IMG/M |
3300005440|Ga0070705_101138601 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 640 | Open in IMG/M |
3300005447|Ga0066689_10958290 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 527 | Open in IMG/M |
3300005471|Ga0070698_100309613 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1510 | Open in IMG/M |
3300005518|Ga0070699_100016678 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6306 | Open in IMG/M |
3300005538|Ga0070731_10874613 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 596 | Open in IMG/M |
3300005540|Ga0066697_10358750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 848 | Open in IMG/M |
3300005541|Ga0070733_10090118 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1948 | Open in IMG/M |
3300005542|Ga0070732_10177646 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1270 | Open in IMG/M |
3300005542|Ga0070732_10427945 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 799 | Open in IMG/M |
3300005559|Ga0066700_10481559 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 868 | Open in IMG/M |
3300005569|Ga0066705_10706681 | Not Available | 607 | Open in IMG/M |
3300005578|Ga0068854_100115446 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2031 | Open in IMG/M |
3300005591|Ga0070761_11013425 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 527 | Open in IMG/M |
3300005602|Ga0070762_11297810 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 505 | Open in IMG/M |
3300005607|Ga0070740_10324612 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 611 | Open in IMG/M |
3300005610|Ga0070763_10618679 | Not Available | 629 | Open in IMG/M |
3300005712|Ga0070764_10066160 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1878 | Open in IMG/M |
3300005712|Ga0070764_10851750 | Not Available | 569 | Open in IMG/M |
3300005764|Ga0066903_103697033 | Not Available | 823 | Open in IMG/M |
3300005921|Ga0070766_10192916 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1270 | Open in IMG/M |
3300005921|Ga0070766_10440284 | Not Available | 859 | Open in IMG/M |
3300005983|Ga0081540_1170040 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 831 | Open in IMG/M |
3300006034|Ga0066656_10345613 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui | 961 | Open in IMG/M |
3300006034|Ga0066656_11035197 | Not Available | 527 | Open in IMG/M |
3300006050|Ga0075028_100299559 | Not Available | 896 | Open in IMG/M |
3300006059|Ga0075017_101057722 | Not Available | 633 | Open in IMG/M |
3300006059|Ga0075017_101572174 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 519 | Open in IMG/M |
3300006059|Ga0075017_101641520 | Not Available | 508 | Open in IMG/M |
3300006162|Ga0075030_101063535 | Not Available | 637 | Open in IMG/M |
3300006176|Ga0070765_100633279 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1009 | Open in IMG/M |
3300006176|Ga0070765_102265051 | Not Available | 506 | Open in IMG/M |
3300006354|Ga0075021_10837269 | Not Available | 595 | Open in IMG/M |
3300006358|Ga0068871_100226612 | Not Available | 1621 | Open in IMG/M |
3300006358|Ga0068871_100399034 | Not Available | 1224 | Open in IMG/M |
3300006794|Ga0066658_10658884 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui | 574 | Open in IMG/M |
3300006800|Ga0066660_11147201 | Not Available | 613 | Open in IMG/M |
3300006852|Ga0075433_10034976 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4318 | Open in IMG/M |
3300006852|Ga0075433_11099494 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui | 691 | Open in IMG/M |
3300006854|Ga0075425_100399811 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui | 1583 | Open in IMG/M |
3300006881|Ga0068865_100257355 | Not Available | 1380 | Open in IMG/M |
3300006893|Ga0073928_10273905 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1280 | Open in IMG/M |
3300006893|Ga0073928_10392904 | Not Available | 1016 | Open in IMG/M |
3300006893|Ga0073928_10823552 | Not Available | 640 | Open in IMG/M |
3300007788|Ga0099795_10543121 | Not Available | 547 | Open in IMG/M |
3300009012|Ga0066710_101726534 | Not Available | 951 | Open in IMG/M |
3300009038|Ga0099829_10450916 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
3300009038|Ga0099829_11510139 | Not Available | 555 | Open in IMG/M |
3300009089|Ga0099828_11308107 | Not Available | 641 | Open in IMG/M |
3300009090|Ga0099827_10169922 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1796 | Open in IMG/M |
3300009090|Ga0099827_10302312 | Not Available | 1354 | Open in IMG/M |
3300009098|Ga0105245_10768357 | Not Available | 1000 | Open in IMG/M |
3300009137|Ga0066709_100822900 | Not Available | 1347 | Open in IMG/M |
3300009137|Ga0066709_102999361 | Not Available | 620 | Open in IMG/M |
3300009143|Ga0099792_10277331 | Not Available | 986 | Open in IMG/M |
3300009524|Ga0116225_1356572 | Not Available | 651 | Open in IMG/M |
3300009524|Ga0116225_1520040 | Not Available | 529 | Open in IMG/M |
3300009545|Ga0105237_11688552 | Not Available | 640 | Open in IMG/M |
3300009553|Ga0105249_11772769 | Not Available | 690 | Open in IMG/M |
3300009628|Ga0116125_1089081 | Not Available | 817 | Open in IMG/M |
3300009665|Ga0116135_1233800 | Not Available | 710 | Open in IMG/M |
3300009698|Ga0116216_10116814 | Not Available | 1642 | Open in IMG/M |
3300009824|Ga0116219_10541540 | Not Available | 642 | Open in IMG/M |
3300009839|Ga0116223_10098841 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1847 | Open in IMG/M |
3300010043|Ga0126380_10623590 | Not Available | 853 | Open in IMG/M |
3300010047|Ga0126382_10036654 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. | 2749 | Open in IMG/M |
3300010335|Ga0134063_10489170 | Not Available | 614 | Open in IMG/M |
3300010336|Ga0134071_10382300 | Not Available | 715 | Open in IMG/M |
3300010337|Ga0134062_10398227 | Not Available | 673 | Open in IMG/M |
3300010343|Ga0074044_11016867 | Not Available | 543 | Open in IMG/M |
3300010361|Ga0126378_11485363 | Not Available | 768 | Open in IMG/M |
3300010361|Ga0126378_12229829 | Not Available | 625 | Open in IMG/M |
3300010362|Ga0126377_13207380 | Not Available | 528 | Open in IMG/M |
3300010366|Ga0126379_10320248 | Not Available | 1567 | Open in IMG/M |
3300010366|Ga0126379_12584511 | Not Available | 606 | Open in IMG/M |
3300010375|Ga0105239_11937275 | Not Available | 684 | Open in IMG/M |
3300010375|Ga0105239_12914780 | Not Available | 558 | Open in IMG/M |
3300010376|Ga0126381_104720054 | Not Available | 524 | Open in IMG/M |
3300010379|Ga0136449_102636288 | Not Available | 716 | Open in IMG/M |
3300010859|Ga0126352_1297009 | Not Available | 599 | Open in IMG/M |
3300011081|Ga0138575_1136493 | Not Available | 503 | Open in IMG/M |
3300011120|Ga0150983_11584650 | Not Available | 880 | Open in IMG/M |
3300011120|Ga0150983_12617919 | Not Available | 552 | Open in IMG/M |
3300011120|Ga0150983_14789349 | Not Available | 771 | Open in IMG/M |
3300011269|Ga0137392_10283877 | Not Available | 1367 | Open in IMG/M |
3300011269|Ga0137392_10609505 | Not Available | 906 | Open in IMG/M |
3300012096|Ga0137389_11401448 | Not Available | 594 | Open in IMG/M |
3300012208|Ga0137376_10897562 | Not Available | 761 | Open in IMG/M |
3300012210|Ga0137378_10581269 | Not Available | 1029 | Open in IMG/M |
3300012212|Ga0150985_116389138 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 719 | Open in IMG/M |
3300012212|Ga0150985_119785209 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 533 | Open in IMG/M |
3300012349|Ga0137387_10471666 | Not Available | 911 | Open in IMG/M |
3300012354|Ga0137366_10044587 | Not Available | 3420 | Open in IMG/M |
3300012363|Ga0137390_10816378 | Not Available | 890 | Open in IMG/M |
3300012917|Ga0137395_10426346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 951 | Open in IMG/M |
3300012917|Ga0137395_10732177 | Not Available | 716 | Open in IMG/M |
3300012924|Ga0137413_10964592 | Not Available | 666 | Open in IMG/M |
3300012924|Ga0137413_11672303 | Not Available | 522 | Open in IMG/M |
3300012930|Ga0137407_10409499 | Not Available | 1257 | Open in IMG/M |
3300012961|Ga0164302_10714729 | Not Available | 744 | Open in IMG/M |
3300012987|Ga0164307_11468499 | Not Available | 576 | Open in IMG/M |
3300013297|Ga0157378_10444804 | Not Available | 1285 | Open in IMG/M |
3300014160|Ga0181517_10176840 | Not Available | 1182 | Open in IMG/M |
3300014325|Ga0163163_11802977 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 672 | Open in IMG/M |
3300014501|Ga0182024_12503486 | Not Available | 556 | Open in IMG/M |
3300014654|Ga0181525_10117606 | Not Available | 1464 | Open in IMG/M |
3300014654|Ga0181525_10694590 | Not Available | 571 | Open in IMG/M |
3300015265|Ga0182005_1218708 | Not Available | 579 | Open in IMG/M |
3300015356|Ga0134073_10056468 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1067 | Open in IMG/M |
3300015358|Ga0134089_10099131 | Not Available | 1115 | Open in IMG/M |
3300015374|Ga0132255_104945755 | Not Available | 564 | Open in IMG/M |
3300015374|Ga0132255_105972029 | Not Available | 515 | Open in IMG/M |
3300016387|Ga0182040_11111907 | Not Available | 662 | Open in IMG/M |
3300017654|Ga0134069_1106485 | Not Available | 917 | Open in IMG/M |
3300017822|Ga0187802_10309202 | Not Available | 617 | Open in IMG/M |
3300017823|Ga0187818_10044542 | All Organisms → cellular organisms → Bacteria | 1906 | Open in IMG/M |
3300017924|Ga0187820_1051181 | Not Available | 1117 | Open in IMG/M |
3300017924|Ga0187820_1072385 | Not Available | 959 | Open in IMG/M |
3300017925|Ga0187856_1072189 | Not Available | 1436 | Open in IMG/M |
3300017927|Ga0187824_10301400 | Not Available | 567 | Open in IMG/M |
3300017928|Ga0187806_1226011 | Not Available | 642 | Open in IMG/M |
3300017930|Ga0187825_10086715 | Not Available | 1077 | Open in IMG/M |
3300017936|Ga0187821_10256381 | Not Available | 685 | Open in IMG/M |
3300017936|Ga0187821_10356734 | Not Available | 591 | Open in IMG/M |
3300017937|Ga0187809_10341709 | Not Available | 559 | Open in IMG/M |
3300017942|Ga0187808_10268303 | Not Available | 765 | Open in IMG/M |
3300017943|Ga0187819_10391822 | Not Available | 799 | Open in IMG/M |
3300017959|Ga0187779_10072180 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2040 | Open in IMG/M |
3300017959|Ga0187779_10995473 | Not Available | 581 | Open in IMG/M |
3300017970|Ga0187783_10096637 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2177 | Open in IMG/M |
3300017972|Ga0187781_10069205 | All Organisms → cellular organisms → Bacteria | 2430 | Open in IMG/M |
3300017972|Ga0187781_10288827 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Andersenbacteria → Candidatus Andersenbacteria bacterium RIFCSPHIGHO2_12_FULL_45_11 | 1163 | Open in IMG/M |
3300017972|Ga0187781_10896810 | Not Available | 646 | Open in IMG/M |
3300017973|Ga0187780_10782507 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 690 | Open in IMG/M |
3300017974|Ga0187777_11405592 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
3300017975|Ga0187782_10682353 | Not Available | 791 | Open in IMG/M |
3300017995|Ga0187816_10361034 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
3300017998|Ga0187870_1167771 | Not Available | 791 | Open in IMG/M |
3300018007|Ga0187805_10563450 | Not Available | 537 | Open in IMG/M |
3300018013|Ga0187873_1188507 | Not Available | 776 | Open in IMG/M |
3300018019|Ga0187874_10379084 | Not Available | 571 | Open in IMG/M |
3300018037|Ga0187883_10458788 | Not Available | 655 | Open in IMG/M |
3300018043|Ga0187887_10798873 | Not Available | 558 | Open in IMG/M |
3300018088|Ga0187771_10333907 | Not Available | 1273 | Open in IMG/M |
3300018431|Ga0066655_11348281 | Not Available | 515 | Open in IMG/M |
3300019275|Ga0187798_1442125 | Not Available | 534 | Open in IMG/M |
3300019361|Ga0173482_10771156 | Not Available | 506 | Open in IMG/M |
3300019786|Ga0182025_1294736 | Not Available | 2080 | Open in IMG/M |
3300019881|Ga0193707_1153625 | Not Available | 639 | Open in IMG/M |
3300019999|Ga0193718_1080650 | Not Available | 688 | Open in IMG/M |
3300020018|Ga0193721_1162964 | Not Available | 528 | Open in IMG/M |
3300020021|Ga0193726_1043434 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2171 | Open in IMG/M |
3300020579|Ga0210407_10784671 | Not Available | 735 | Open in IMG/M |
3300020581|Ga0210399_10250838 | Not Available | 1475 | Open in IMG/M |
3300020583|Ga0210401_11230230 | Not Available | 607 | Open in IMG/M |
3300021088|Ga0210404_10636523 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 607 | Open in IMG/M |
3300021088|Ga0210404_10708702 | Not Available | 574 | Open in IMG/M |
3300021170|Ga0210400_10366803 | Not Available | 1186 | Open in IMG/M |
3300021171|Ga0210405_10877528 | Not Available | 683 | Open in IMG/M |
3300021180|Ga0210396_10100203 | All Organisms → cellular organisms → Bacteria | 2621 | Open in IMG/M |
3300021180|Ga0210396_10255564 | Not Available | 1557 | Open in IMG/M |
3300021180|Ga0210396_10255720 | Not Available | 1557 | Open in IMG/M |
3300021362|Ga0213882_10505111 | Not Available | 518 | Open in IMG/M |
3300021401|Ga0210393_10816741 | Not Available | 758 | Open in IMG/M |
3300021402|Ga0210385_10396687 | Not Available | 1036 | Open in IMG/M |
3300021402|Ga0210385_10526953 | Not Available | 897 | Open in IMG/M |
3300021403|Ga0210397_10958238 | Not Available | 663 | Open in IMG/M |
3300021404|Ga0210389_11192242 | Not Available | 586 | Open in IMG/M |
3300021405|Ga0210387_10118826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2231 | Open in IMG/M |
3300021405|Ga0210387_10386865 | Not Available | 1239 | Open in IMG/M |
3300021406|Ga0210386_10379077 | Not Available | 1218 | Open in IMG/M |
3300021407|Ga0210383_10161245 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1909 | Open in IMG/M |
3300021420|Ga0210394_10363160 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1273 | Open in IMG/M |
3300021420|Ga0210394_10563858 | Not Available | 1001 | Open in IMG/M |
3300021432|Ga0210384_10724574 | Not Available | 889 | Open in IMG/M |
3300021432|Ga0210384_11049992 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 717 | Open in IMG/M |
3300021433|Ga0210391_10048542 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3378 | Open in IMG/M |
3300021474|Ga0210390_10864106 | Not Available | 746 | Open in IMG/M |
3300021474|Ga0210390_10964611 | Not Available | 698 | Open in IMG/M |
3300021475|Ga0210392_10732109 | Not Available | 737 | Open in IMG/M |
3300021478|Ga0210402_11664568 | Not Available | 565 | Open in IMG/M |
3300021479|Ga0210410_10188785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1844 | Open in IMG/M |
3300021560|Ga0126371_11241008 | Not Available | 881 | Open in IMG/M |
3300022509|Ga0242649_1029565 | Not Available | 697 | Open in IMG/M |
3300022532|Ga0242655_10041879 | Not Available | 1095 | Open in IMG/M |
3300022724|Ga0242665_10133855 | Not Available | 769 | Open in IMG/M |
3300022724|Ga0242665_10166690 | Not Available | 706 | Open in IMG/M |
3300022734|Ga0224571_113662 | Not Available | 576 | Open in IMG/M |
3300023019|Ga0224560_111407 | Not Available | 553 | Open in IMG/M |
3300024330|Ga0137417_1062321 | Not Available | 1297 | Open in IMG/M |
3300024330|Ga0137417_1314509 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2542 | Open in IMG/M |
3300025434|Ga0208690_1080889 | Not Available | 504 | Open in IMG/M |
3300025494|Ga0207928_1080261 | Not Available | 606 | Open in IMG/M |
3300025913|Ga0207695_10375253 | Not Available | 1308 | Open in IMG/M |
3300025916|Ga0207663_10710039 | Not Available | 796 | Open in IMG/M |
3300025916|Ga0207663_10941121 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 692 | Open in IMG/M |
3300025916|Ga0207663_11138338 | Not Available | 628 | Open in IMG/M |
3300025922|Ga0207646_10970693 | Not Available | 752 | Open in IMG/M |
3300025925|Ga0207650_10000340 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 45198 | Open in IMG/M |
3300025927|Ga0207687_10577163 | Not Available | 946 | Open in IMG/M |
3300025928|Ga0207700_10940488 | Not Available | 773 | Open in IMG/M |
3300025929|Ga0207664_11305647 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 645 | Open in IMG/M |
3300025931|Ga0207644_11450246 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 576 | Open in IMG/M |
3300025931|Ga0207644_11538290 | Not Available | 558 | Open in IMG/M |
3300025961|Ga0207712_10828583 | Not Available | 814 | Open in IMG/M |
3300025972|Ga0207668_10149452 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1806 | Open in IMG/M |
3300026067|Ga0207678_11418625 | Not Available | 614 | Open in IMG/M |
3300026116|Ga0207674_10268314 | Not Available | 1654 | Open in IMG/M |
3300026294|Ga0209839_10159761 | Not Available | 740 | Open in IMG/M |
3300026298|Ga0209236_1173170 | Not Available | 870 | Open in IMG/M |
3300026310|Ga0209239_1213414 | Not Available | 682 | Open in IMG/M |
3300026322|Ga0209687_1314081 | Not Available | 501 | Open in IMG/M |
3300026325|Ga0209152_10008161 | All Organisms → cellular organisms → Bacteria | 3701 | Open in IMG/M |
3300026330|Ga0209473_1002913 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 9305 | Open in IMG/M |
3300026342|Ga0209057_1138315 | Not Available | 843 | Open in IMG/M |
3300026342|Ga0209057_1138450 | Not Available | 842 | Open in IMG/M |
3300026351|Ga0257170_1058580 | Not Available | 539 | Open in IMG/M |
3300026482|Ga0257172_1032769 | Not Available | 939 | Open in IMG/M |
3300026551|Ga0209648_10154899 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1805 | Open in IMG/M |
3300026552|Ga0209577_10009805 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8734 | Open in IMG/M |
3300026557|Ga0179587_10459179 | Not Available | 834 | Open in IMG/M |
3300026959|Ga0207852_1030581 | Not Available | 550 | Open in IMG/M |
3300027334|Ga0209529_1041656 | Not Available | 782 | Open in IMG/M |
3300027497|Ga0208199_1038932 | Not Available | 1028 | Open in IMG/M |
3300027505|Ga0209218_1022605 | Not Available | 1186 | Open in IMG/M |
3300027575|Ga0209525_1047648 | Not Available | 1046 | Open in IMG/M |
3300027648|Ga0209420_1138879 | Not Available | 671 | Open in IMG/M |
3300027696|Ga0208696_1272920 | Not Available | 521 | Open in IMG/M |
3300027738|Ga0208989_10182122 | Not Available | 699 | Open in IMG/M |
3300027738|Ga0208989_10232680 | Not Available | 604 | Open in IMG/M |
3300027842|Ga0209580_10016051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 3281 | Open in IMG/M |
3300027842|Ga0209580_10363296 | Not Available | 721 | Open in IMG/M |
3300027842|Ga0209580_10593425 | Not Available | 549 | Open in IMG/M |
3300027853|Ga0209274_10643327 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 548 | Open in IMG/M |
3300027875|Ga0209283_10212519 | Not Available | 1285 | Open in IMG/M |
3300027875|Ga0209283_10819312 | Not Available | 570 | Open in IMG/M |
3300027884|Ga0209275_10084784 | Not Available | 1594 | Open in IMG/M |
3300027884|Ga0209275_10219747 | Not Available | 1033 | Open in IMG/M |
3300027889|Ga0209380_10194681 | All Organisms → cellular organisms → Bacteria | 1190 | Open in IMG/M |
3300027889|Ga0209380_10296899 | Not Available | 949 | Open in IMG/M |
3300027895|Ga0209624_11066203 | Not Available | 521 | Open in IMG/M |
3300027898|Ga0209067_10236353 | Not Available | 990 | Open in IMG/M |
3300027908|Ga0209006_10162694 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1954 | Open in IMG/M |
3300028013|Ga0265350_100252 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1780 | Open in IMG/M |
3300028020|Ga0265351_1000620 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2053 | Open in IMG/M |
3300028036|Ga0265355_1001916 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1408 | Open in IMG/M |
3300028047|Ga0209526_10816681 | Not Available | 576 | Open in IMG/M |
3300028381|Ga0268264_10525537 | Not Available | 1157 | Open in IMG/M |
3300028536|Ga0137415_10128422 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2379 | Open in IMG/M |
3300028552|Ga0302149_1191618 | Not Available | 534 | Open in IMG/M |
3300028731|Ga0302301_1041230 | All Organisms → cellular organisms → Bacteria | 1287 | Open in IMG/M |
3300028766|Ga0302269_1207833 | Not Available | 548 | Open in IMG/M |
3300028800|Ga0265338_10220171 | Not Available | 1418 | Open in IMG/M |
3300028874|Ga0302155_10132171 | Not Available | 1104 | Open in IMG/M |
3300028882|Ga0302154_10544518 | Not Available | 549 | Open in IMG/M |
3300028906|Ga0308309_10698798 | Not Available | 881 | Open in IMG/M |
3300028906|Ga0308309_11722951 | Not Available | 531 | Open in IMG/M |
3300028906|Ga0308309_11878347 | Not Available | 505 | Open in IMG/M |
3300029882|Ga0311368_10215439 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1510 | Open in IMG/M |
3300029954|Ga0311331_10017376 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 11237 | Open in IMG/M |
3300029999|Ga0311339_11366301 | Not Available | 638 | Open in IMG/M |
3300030045|Ga0302282_1361644 | Not Available | 516 | Open in IMG/M |
3300030054|Ga0302182_10329985 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 642 | Open in IMG/M |
3300030056|Ga0302181_10472602 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 532 | Open in IMG/M |
3300030114|Ga0311333_10014191 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5325 | Open in IMG/M |
3300030399|Ga0311353_11235954 | Not Available | 615 | Open in IMG/M |
3300030494|Ga0310037_10005713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6143 | Open in IMG/M |
3300030618|Ga0311354_10507955 | Not Available | 1190 | Open in IMG/M |
3300030706|Ga0310039_10283135 | Not Available | 632 | Open in IMG/M |
3300030706|Ga0310039_10305112 | Not Available | 602 | Open in IMG/M |
3300030707|Ga0310038_10156946 | Not Available | 1125 | Open in IMG/M |
3300030743|Ga0265461_11772818 | Not Available | 689 | Open in IMG/M |
3300030743|Ga0265461_13604119 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 525 | Open in IMG/M |
3300030813|Ga0265750_1087377 | Not Available | 527 | Open in IMG/M |
3300031040|Ga0265754_1030289 | Not Available | 553 | Open in IMG/M |
3300031057|Ga0170834_104138223 | Not Available | 539 | Open in IMG/M |
3300031057|Ga0170834_111968888 | Not Available | 710 | Open in IMG/M |
3300031090|Ga0265760_10025265 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1734 | Open in IMG/M |
3300031090|Ga0265760_10357391 | Not Available | 523 | Open in IMG/M |
3300031231|Ga0170824_112748122 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 531 | Open in IMG/M |
3300031231|Ga0170824_118181053 | Not Available | 761 | Open in IMG/M |
3300031236|Ga0302324_100038766 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8825 | Open in IMG/M |
3300031247|Ga0265340_10192040 | Not Available | 920 | Open in IMG/M |
3300031344|Ga0265316_10302754 | Not Available | 1164 | Open in IMG/M |
3300031525|Ga0302326_12611055 | Not Available | 630 | Open in IMG/M |
3300031573|Ga0310915_10867880 | Not Available | 633 | Open in IMG/M |
3300031708|Ga0310686_101817746 | Not Available | 790 | Open in IMG/M |
3300031708|Ga0310686_117194350 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 846 | Open in IMG/M |
3300031718|Ga0307474_10296774 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1244 | Open in IMG/M |
3300031740|Ga0307468_100008825 | All Organisms → cellular organisms → Bacteria | 3796 | Open in IMG/M |
3300031740|Ga0307468_100407691 | Not Available | 1040 | Open in IMG/M |
3300031740|Ga0307468_102541406 | Not Available | 502 | Open in IMG/M |
3300031753|Ga0307477_10205351 | Not Available | 1370 | Open in IMG/M |
3300031754|Ga0307475_10050830 | All Organisms → cellular organisms → Bacteria | 3111 | Open in IMG/M |
3300031754|Ga0307475_10957713 | Not Available | 674 | Open in IMG/M |
3300031788|Ga0302319_10489602 | Not Available | 1326 | Open in IMG/M |
3300031823|Ga0307478_11275157 | Not Available | 611 | Open in IMG/M |
3300031910|Ga0306923_11532777 | Not Available | 696 | Open in IMG/M |
3300031959|Ga0318530_10382366 | Not Available | 583 | Open in IMG/M |
3300031996|Ga0308176_11986835 | Not Available | 621 | Open in IMG/M |
3300032091|Ga0318577_10057852 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1753 | Open in IMG/M |
3300032180|Ga0307471_100107360 | All Organisms → cellular organisms → Bacteria | 2556 | Open in IMG/M |
3300032180|Ga0307471_100957275 | Not Available | 1023 | Open in IMG/M |
3300032205|Ga0307472_100390227 | Not Available | 1160 | Open in IMG/M |
3300032205|Ga0307472_101857338 | Not Available | 600 | Open in IMG/M |
3300032261|Ga0306920_102737072 | Not Available | 673 | Open in IMG/M |
3300032782|Ga0335082_10000450 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 42452 | Open in IMG/M |
3300032783|Ga0335079_10156809 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2550 | Open in IMG/M |
3300032783|Ga0335079_10366716 | Not Available | 1559 | Open in IMG/M |
3300032783|Ga0335079_10600887 | Not Available | 1161 | Open in IMG/M |
3300032783|Ga0335079_11276964 | Not Available | 734 | Open in IMG/M |
3300032805|Ga0335078_12547168 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 526 | Open in IMG/M |
3300032828|Ga0335080_11421731 | Not Available | 689 | Open in IMG/M |
3300032892|Ga0335081_10448309 | Not Available | 1642 | Open in IMG/M |
3300032892|Ga0335081_11379703 | Not Available | 789 | Open in IMG/M |
3300032892|Ga0335081_12398600 | Not Available | 548 | Open in IMG/M |
3300032893|Ga0335069_10888977 | Not Available | 997 | Open in IMG/M |
3300032893|Ga0335069_11703127 | Not Available | 672 | Open in IMG/M |
3300032898|Ga0335072_11066346 | Not Available | 733 | Open in IMG/M |
3300033134|Ga0335073_11053026 | Not Available | 835 | Open in IMG/M |
3300033412|Ga0310810_10767006 | Not Available | 880 | Open in IMG/M |
3300033475|Ga0310811_10288101 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1904 | Open in IMG/M |
3300033547|Ga0316212_1064629 | Not Available | 529 | Open in IMG/M |
3300034124|Ga0370483_0028976 | Not Available | 1675 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.59% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.54% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.80% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.22% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.93% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.06% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.06% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.77% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.48% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.48% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.19% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.90% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.61% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.61% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.32% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.03% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.03% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.74% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.74% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.74% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.45% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.45% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.16% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.16% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.16% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.16% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.87% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.87% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.87% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.87% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.87% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.87% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.58% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.58% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.58% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.58% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.58% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.58% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.58% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.58% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.29% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.29% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.29% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.29% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.29% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.29% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.29% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.29% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.29% |
Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.29% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.29% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.29% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.29% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.29% |
Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.29% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.29% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.29% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.29% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.29% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.29% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908009 | Soil microbial communities from sample at FACE Site Metagenome WIR_Amb2 | Environmental | Open in IMG/M |
2189573000 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms) | Environmental | Open in IMG/M |
3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005607 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010859 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011081 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 60 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300014160 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaG | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Host-Associated | Open in IMG/M |
3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300017998 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150 | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300019275 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
3300019999 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1 | Environmental | Open in IMG/M |
3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022509 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU3 | Host-Associated | Open in IMG/M |
3300023019 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU1 | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025434 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 (SPAdes) | Environmental | Open in IMG/M |
3300025494 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
3300026351 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-B | Environmental | Open in IMG/M |
3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300026959 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 3 (SPAdes) | Environmental | Open in IMG/M |
3300027334 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027505 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300028013 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE2 | Environmental | Open in IMG/M |
3300028020 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE4 | Environmental | Open in IMG/M |
3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Host-Associated | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028552 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_1 | Environmental | Open in IMG/M |
3300028731 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_2 | Environmental | Open in IMG/M |
3300028766 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_2 | Environmental | Open in IMG/M |
3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
3300028874 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_1 | Environmental | Open in IMG/M |
3300028882 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300029954 | I_Bog_N3 coassembly | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030045 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_3 | Environmental | Open in IMG/M |
3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
3300030813 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031040 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Host-Associated | Open in IMG/M |
3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FWIRA_04817210 | 2124908009 | Soil | AMELLRSAPQTPPLMLELEGDEKVNPLEKFQATFEKLETA |
N55_05113040 | 2189573000 | Grass Soil | AMELLQAAPNTPPLLLEIEADEKVNPVEKMTEAFRALEST |
AF_2010_repII_A100DRAFT_10907231 | 3300000655 | Forest Soil | LWRSAPQVPPLLLEVEGEEKVSPVEGMKEAFDKLAIN* |
JGI1027J12803_1063273371 | 3300000955 | Soil | WPGAGSIDWKKSIELLRSAPNTPPLLLEIEADEKVKPEEKMRETFEKLGSY* |
JGI1027J12803_1078868582 | 3300000955 | Soil | LRSAPQKPPLLLELGEDEKVNPLEKLGETFDKLETIS* |
JGI26341J46601_101835182 | 3300003219 | Bog Forest Soil | LWPGNGTVNWKEAMELLRSAPQAPPLLLELAEDEKVNPLEKLGETFEKLETA* |
Ga0062385_110616151 | 3300004080 | Bog Forest Soil | KQAMELLRSAPHTPPLLLEIEGDEKINPVEKMSEVFEKLEAI* |
Ga0062384_1013394251 | 3300004082 | Bog Forest Soil | DWKETMELLRSAPQTPALLLELEGDEKMNPLEKLSEAFEKLDAA* |
Ga0062592_1025616451 | 3300004480 | Soil | WKEAMELLRSAPNTPPLLLEIESDEKNNPLDKMGETFDKLESA* |
Ga0062388_1003163512 | 3300004635 | Bog Forest Soil | TIDWKEAMELLRSAPQTPPVLLEVAEDEKVNPLEKLEEIFEKLETA* |
Ga0066672_102563342 | 3300005167 | Soil | SINWKEAVALLRAAPHTPPMLLEIESDDKVNPIEKMGAVFDKLETA* |
Ga0066683_106558281 | 3300005172 | Soil | GKGSIDWKQTMELLRSAPQTPPLLLEIEADEKVNPVEKMGETFRDLEAN* |
Ga0066688_108709561 | 3300005178 | Soil | KGSIDWKQAMELLRAEPHTPPLLLEIEADEKVNAVEKMGETFTELEKA* |
Ga0066678_109547941 | 3300005181 | Soil | TMDLLRSAPQTPPLLLEIEGEEKVPLEKIEQTFAKLDAA* |
Ga0066388_1068647562 | 3300005332 | Tropical Forest Soil | TIDWKASVELLRSAPQRPPLLLELGEDEKVNPLEKLTETFDKLETT* |
Ga0070671_1004905202 | 3300005355 | Switchgrass Rhizosphere | NKDRDAHWWPGAGSIDWKKSLELLRSAPNTPPLLLEIEGDDKLKPEQKMREVFDRMERE* |
Ga0070709_103424841 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | AIELLRSAPQTPPLLLEIGDDEKGNSVERLGEVFAKLEES* |
Ga0070709_105218881 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | GQGTIDWKQAIELLRSAPQKPPLLLELGEDEKVNPLEKLGETFDKLETIS* |
Ga0070714_1019918071 | 3300005435 | Agricultural Soil | GQGTINWKEAIELLRSAPQTPPLLLEIGDDEKGNPVERLGEVFAKLEES* |
Ga0070714_1020719211 | 3300005435 | Agricultural Soil | SGSIDWKEAMELLRSAPHTPPLLLEIEHDDKINPVEKMGPAFDQLEKA* |
Ga0070714_1023558492 | 3300005435 | Agricultural Soil | GQGTINWKEAIELLRSAPQTPLLLEIGDDEKGNPVDRLGEVFAKLEES* |
Ga0070711_1002639421 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | AMELLRSAPQTPPLLLELGEDEKVNPLEKLRETFDKLEGN* |
Ga0070705_1011386011 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | WKEAMELLRSAPHTPPLLLEVEPDEKVNPVEKMGEAFRNLVIE* |
Ga0066689_109582902 | 3300005447 | Soil | QTMELLRSAPNAPPLLLEIEADEKVNPIEKMGETFRQLAAE* |
Ga0070698_1003096131 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | LWPGQGTIDWKEAVELLRSAPQTPPLLLEIGEDEKVNALEKLGPTFEKLEGA* |
Ga0070699_1000166781 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | SIDWKQAMELMRAAPHTPPLLLEIEADEKVNPIEKMGETFATLEKA* |
Ga0070731_108746131 | 3300005538 | Surface Soil | WKQAMELLRSAPHTPPLLLEVEADEKINLVDKMRTTFEEFSQ* |
Ga0066697_103587501 | 3300005540 | Soil | GSIDWKQTMELLRSAPNAPPLLLEIEADEKVNPIEKMGETFRQLAAE* |
Ga0070733_100901181 | 3300005541 | Surface Soil | WPGQGTIDWKESMELLRSAPQTPPLLLELAEDEKVNALEKLPELFDKLEST* |
Ga0070732_101776461 | 3300005542 | Surface Soil | GSIDWKEAVELLRTAPQTPPLLLEIGEDEKVNPLEKLGQAFAKLESE* |
Ga0070732_104279451 | 3300005542 | Surface Soil | DWKEAMELLRSAPHTPPLLLEIEHDDKINPVEKMGPAFDKLETAQ* |
Ga0066700_104815592 | 3300005559 | Soil | LWPGKGSIDWKQAVELMRTAPHTPPLLLEIEADEKINPVEKMGETFTELEKA* |
Ga0066705_107066811 | 3300005569 | Soil | LRSAPNTPPLLLEIEEDEKANPVDSMGEAFRKLETA* |
Ga0068854_1001154461 | 3300005578 | Corn Rhizosphere | GNIDWKEAMELLRSAPNTPPLLLEIESDEKNNPLDKMGETFDKLEAA* |
Ga0070761_110134252 | 3300005591 | Soil | PGQGTIDWKEAMELLRSAPQTPPMLLELGEDEKVNSLEKLAETFDKLETA* |
Ga0070762_112978102 | 3300005602 | Soil | VDWKEAIQLLRSAPHKPPLLLELGEDEKVNALEKLGETFDKLENN* |
Ga0070740_103246121 | 3300005607 | Surface Soil | WPGEGTIDWKQAMELLRSAPQTPPLLLELGEDEKVNSLEKLQRTFDKLETA* |
Ga0070763_106186792 | 3300005610 | Soil | ELLRSAPQTPPLLLEIAEDEKVNPLEKIGETFDKLEGN* |
Ga0070764_100661603 | 3300005712 | Soil | SAPHTPALLLEVENDEKINLVEKMGETFKKLEAS* |
Ga0070764_108517501 | 3300005712 | Soil | RSAPQTPPLLLELAEDEKVNPLEKLAETFEKLETA* |
Ga0066903_1036970332 | 3300005764 | Tropical Forest Soil | PGKGSINWKETMELLRSARHKPPLLLEIEGDEKVNVPEQMDAAFQKLEA* |
Ga0070766_101929161 | 3300005921 | Soil | DWKESMELLRSAPQTPALLLELAEDQKVNPLEKLKETFEKLETA* |
Ga0070766_104402842 | 3300005921 | Soil | LLRSAPQTPPLLLELAEDEKVNPLEKLPEIFEKLETA* |
Ga0081540_11700402 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MELMRSAPQTPPLLLEIEADEKVNPLDKIGQTFDKLEAA* |
Ga0066656_103456132 | 3300006034 | Soil | PGQGSINWKEAMELLRSAPNTPPLLLEIEENEKINPVDNMGGTFQKLEAA* |
Ga0066656_110351971 | 3300006034 | Soil | ELMRAAPHTPPLLLEIEADEKINPVEKMGETFAELEKA* |
Ga0075028_1002995591 | 3300006050 | Watersheds | SAPHTPPLLLEIEGDEKVNPGEKMGKAFGKLEAA* |
Ga0075017_1010577222 | 3300006059 | Watersheds | WKEAMELLRSAPNTPPLLLEIEHDDKVNPIEKMGPAFDQLETA* |
Ga0075017_1015721741 | 3300006059 | Watersheds | LWPGQGTIDWKEAIELLRSAPQTPPLLLELGEDEKINPLEKLGETFDKLEGIV* |
Ga0075017_1016415201 | 3300006059 | Watersheds | RSAPQTPPLLLELNEDEKVNPLEKLPETFEKLEAA* |
Ga0075030_1010635352 | 3300006162 | Watersheds | TIDWKEAMELLRSAPQTPPLLLELNEDEKVNALEKLGETFEKLEAA* |
Ga0070765_1006332791 | 3300006176 | Soil | WPGQGTIDWKEAVELLRSAPQRPPLLLELGENEKVNAFEKLGETFDKLETA* |
Ga0070765_1022650511 | 3300006176 | Soil | DWKQAMELLRSAPHTPPLLLEIEGDEKINPVEKMRQAFEKLETS* |
Ga0075021_108372692 | 3300006354 | Watersheds | WKEAMELLRSAPQTPPLLLELAEDEKVNPLEKLAETFEKLETIG* |
Ga0068871_1002266122 | 3300006358 | Miscanthus Rhizosphere | AMELLRSAPNTPPLLLETETDEKVDPVAKMSEVFRKLESA* |
Ga0068871_1003990342 | 3300006358 | Miscanthus Rhizosphere | SAPHTPPLLLEVEADEKVNPAEKMKEAFNKLESEL* |
Ga0066658_106588842 | 3300006794 | Soil | GDRDSHFWPGKGSIDWKQAMELLRAAPHTPPLLLEIEADEKVNAVEKMGETFTELEKA* |
Ga0066660_111472012 | 3300006800 | Soil | SAPQTPPLLLEIEADEKVNPVEKMGETFRDLEAN* |
Ga0075433_100349765 | 3300006852 | Populus Rhizosphere | VHDNAKDRDSHLVPGQGSINWEEAIDLLRSAPNTPPLLLEIESDEKVNPLDKIGEAFEKLEKH* |
Ga0075433_110994942 | 3300006852 | Populus Rhizosphere | AGSIDWKEAMEVLRSAPQTPPLLLEIEADERVNPVEKMGEAFRNLAIE* |
Ga0075425_1003998111 | 3300006854 | Populus Rhizosphere | WPGAGSIDWKEAMELLRSAPQTPPLVLEIEADEKVNPVEKMGEVFRNLVIE* |
Ga0068865_1002573551 | 3300006881 | Miscanthus Rhizosphere | ELLRSAPNTPPLLLEIESDEKNNPLDKMGETFDKLEAA* |
Ga0073928_102739052 | 3300006893 | Iron-Sulfur Acid Spring | MELLRSAPHTPPLLLEIEADEKVNPTEKMQEVFDKLETL* |
Ga0073928_103929041 | 3300006893 | Iron-Sulfur Acid Spring | AMELLRSAPQTPALLLELEGDEKVNALEKLGPTFEKLETA* |
Ga0073928_108235521 | 3300006893 | Iron-Sulfur Acid Spring | ELLRSAPQTPPLTLELEENGKVNPLEKLGATFDKLEGI* |
Ga0099795_105431212 | 3300007788 | Vadose Zone Soil | TIDWKEAMELLRTAPQAPPLMLELEGDEKVNPLPKLGETFEKLETA* |
Ga0066710_1017265342 | 3300009012 | Grasslands Soil | QGSINWKEAMELLRSAPNTPPLLLEIEENEKINPVDNMGGIFQKLEAT |
Ga0099829_104509162 | 3300009038 | Vadose Zone Soil | GAGSIDWKEATELLRSAPHTPPLLLEVEADEKVNPVEKMGEAFRNLVIE* |
Ga0099829_115101392 | 3300009038 | Vadose Zone Soil | IDWKEAMELLRSAPQTPPLLLELAEDEKVNPLEKLGETFEKLET* |
Ga0099828_113081071 | 3300009089 | Vadose Zone Soil | DWKEAMELLRSAPQTPALMLELEGDDKVNPLEKLGQTFEKLETA* |
Ga0099827_101699223 | 3300009090 | Vadose Zone Soil | GKGTIDWKEAMELLRSAPQTPALMLELEGDEKLNPLDKLGQTFEKLEGI* |
Ga0099827_103023121 | 3300009090 | Vadose Zone Soil | ELMRAAPHTPPLLLEIEADEKVNPIEKMGETFATLEKA* |
Ga0105245_107683572 | 3300009098 | Miscanthus Rhizosphere | WPGAGNIDWKEAMELLRSAPNTPPLLLEIEADEKVNPVEKMREVFEKLEAE* |
Ga0066709_1008229002 | 3300009137 | Grasslands Soil | ELLRSAPHTPPLLLEIEADEKVNPVEKMKETFEKLGN* |
Ga0066709_1029993612 | 3300009137 | Grasslands Soil | QGSINWKEAMELLRSAPNTPPLLLEIEENEKINPVDNMGGIFQKLEAT* |
Ga0099792_102773311 | 3300009143 | Vadose Zone Soil | EAMELLRTAPQTPALMLELEGDEKVNPLEKLAQTFEKLEMA* |
Ga0116225_13565722 | 3300009524 | Peatlands Soil | LRSAPQTPPLLLEIAEDEKMNPLEKMRETFDKLEAA* |
Ga0116225_15200401 | 3300009524 | Peatlands Soil | GQGTIDWKEAIELLRSAPQTPPLLLELGEDEKVNPLEKLGQTFAKLEGS* |
Ga0105237_116885522 | 3300009545 | Corn Rhizosphere | WKEAMELLRSAPNTPPLLLEIETDEKVNPVEKMREVFEKLEAE* |
Ga0105249_117727692 | 3300009553 | Switchgrass Rhizosphere | GAGTIDWQVAMELLRSAPNTPPLLLETETDEKVDPVAKMSEVFRKLESA* |
Ga0116125_10890812 | 3300009628 | Peatland | RSAPQTPPLLLELAEDEKVNALEKLPELFDKLESE* |
Ga0116135_12338002 | 3300009665 | Peatland | DWKEAMELLRSAPQTPPLLLELAEDEKVNPLEKLEEAFDKLETA* |
Ga0116216_101168141 | 3300009698 | Peatlands Soil | AMELLRSAPQTPPLMLELADDEKVNPLEKFEAAFEKLEGA* |
Ga0116219_105415402 | 3300009824 | Peatlands Soil | WPGQGTIDWKEAMALLRSAPQTPPLMLELGENEKVNPLEKLRETFEKLETA* |
Ga0116223_100988413 | 3300009839 | Peatlands Soil | LWPGQGTIDWKEAIELLRSAPQTPPLLLELGEDEKVNPLEKLGQTFAKLEGS* |
Ga0126380_106235901 | 3300010043 | Tropical Forest Soil | GAGSIDWKKSIELLRSAPSTPPLLLEIEADEKVKPEEKMRETFEKLGSY* |
Ga0126382_100366541 | 3300010047 | Tropical Forest Soil | DSHLVPGQGSIDWKEAMELLRSAPNTPPLLLEIENDEKANPLEKIGEAFQKLEKN* |
Ga0134063_104891701 | 3300010335 | Grasslands Soil | QTMELLRSAPQTPPLLLEIEADEKVNPVEKMGETFRQLGAT* |
Ga0134071_103823002 | 3300010336 | Grasslands Soil | IDWKQTMELLRSAPQTPPLLLEIEADEKVNPVEKMGETFRQLGAA* |
Ga0134062_103982272 | 3300010337 | Grasslands Soil | LLRSAPQTPPLLLEIEADEKVNPVEKMGETFRDLEAN* |
Ga0074044_110168672 | 3300010343 | Bog Forest Soil | EAMELLRSSPQKPPLLLELNEDEKINPLEKFAETFDKLEGA* |
Ga0126378_114853632 | 3300010361 | Tropical Forest Soil | QGTIDWKEAMELLRSAPQRPPMLLELGEDEKVNPLEKLGETFDRLEAS* |
Ga0126378_122298292 | 3300010361 | Tropical Forest Soil | LWPGEGSIDWTQAMQLLRSAPHRPPLLLEIEGQEKLKPAEKMADTFRVLDSR* |
Ga0126377_132073801 | 3300010362 | Tropical Forest Soil | NTVELLRSAPQVPPLLLEVEGEEKVSPVEGMKEAFDKLAIN* |
Ga0126379_103202482 | 3300010366 | Tropical Forest Soil | ELLRTAPQRPPLLMELGEDEKVNPLEKLGEAFDKLVGI* |
Ga0126379_125845111 | 3300010366 | Tropical Forest Soil | LWPGQGSIDWKEAMDLLRSAPNTPPLLLEIEHDDKLNPLEKIGPTFDKLESA* |
Ga0105239_119372752 | 3300010375 | Corn Rhizosphere | LRSAPNTPPLLLEIEADEKVNPVEKMRETFEKLEAE* |
Ga0105239_129147801 | 3300010375 | Corn Rhizosphere | NWKEAIELLRSAPQTPPLLLEIGDDEKGNPVDRLGGVFAKLEES* |
Ga0126381_1047200541 | 3300010376 | Tropical Forest Soil | WPGQGTIDWKQAVDLLRSAPQRPPLLLELGEDEKVNPLEKLGETFDRLESA* |
Ga0136449_1026362881 | 3300010379 | Peatlands Soil | RSAPQTPPLLLELAEDEKVNALEKLGETFEKLEGIG* |
Ga0126352_12970092 | 3300010859 | Boreal Forest Soil | WKEAMELLRSAPQTPALMLELEGDEKVNPLEKLGETFEKLEGI* |
Ga0138575_11364932 | 3300011081 | Peatlands Soil | QGTIDWKEAIELLRSAPQTPPLLLELGEDEKVNPLEKLGETFAKLEGN* |
Ga0150983_115846502 | 3300011120 | Forest Soil | TIDWKEAMELLRSAPQKPPVMLELAEDPKVNPMEKFGEAFEKLEEI* |
Ga0150983_126179192 | 3300011120 | Forest Soil | QGTIDWKEAMELLRSAPQTPPLMLELAEDEKVNPLEKFGETFEKLETA* |
Ga0150983_147893491 | 3300011120 | Forest Soil | EAVELRRSAPQTPALLLELEGDEKVKPLEKLAATFEKLDAA* |
Ga0137392_102838772 | 3300011269 | Vadose Zone Soil | LPIGEGSIDWKEAIELLRSAPHTPPLLLEIEGNDKTNPADGMGEAFRKLQAAD* |
Ga0137392_106095052 | 3300011269 | Vadose Zone Soil | WPGLGTIDWKEAMELLRSAPQTPPLLLELEHDEKVNPQEKFGATFEKLETS* |
Ga0137389_114014481 | 3300012096 | Vadose Zone Soil | ALKAAMELLRSAPHTPPLLLEVEADEKVNPVEKMSETFGKLGAA* |
Ga0137376_108975621 | 3300012208 | Vadose Zone Soil | QAMELMRAAPHTPPLMLEIEADEKINPVERMAETFTELEKA* |
Ga0137378_105812692 | 3300012210 | Vadose Zone Soil | SAPNTPPLLLEIEENEKINPVDNMGGIFQKLEAT* |
Ga0150985_1163891383 | 3300012212 | Avena Fatua Rhizosphere | LRSAPNTPPLLLEIEGDDKPKPEQKMREVFDRMERE* |
Ga0150985_1197852091 | 3300012212 | Avena Fatua Rhizosphere | PGQGTIDWKEAIELLRSAPQTPPLLLELAEDEKVNSLEKLAETLDKLETT* |
Ga0137387_104716662 | 3300012349 | Vadose Zone Soil | GAGSINWKEAMELLRSAPQTPPLLLEIEHDDKVNPIEKMGPVFDKLETA* |
Ga0137366_100445874 | 3300012354 | Vadose Zone Soil | DWKEAVELLRSAPQTPPLLLELAEDEKVNALEKLPETFEKLEGA* |
Ga0137390_108163782 | 3300012363 | Vadose Zone Soil | TIDWKEAMELLRSAPQTPPLLLELEHDEKVNPLEKFGATFEKLETA* |
Ga0137395_104263462 | 3300012917 | Vadose Zone Soil | MELLRSAPQTPPLLLELEHDEKVNPLEKFGETFEKLEGI* |
Ga0137395_107321772 | 3300012917 | Vadose Zone Soil | LLSSAPNTPPLLLEIEADEKVNLVERMSETFADLVVE* |
Ga0137413_109645922 | 3300012924 | Vadose Zone Soil | MELLRSAPQTPPLMLELEGDEKVNPLQKLAETFEKLETS* |
Ga0137413_116723032 | 3300012924 | Vadose Zone Soil | SAPQTPPLMLELEGDEKVNPLEKLAETFEKLETS* |
Ga0137407_104094991 | 3300012930 | Vadose Zone Soil | AMELMRAAPHTPPLLLEIEADEKVNPIEKMGETFATLEKA* |
Ga0164302_107147292 | 3300012961 | Soil | DWAEAVPLLRSAPNTPPMLLEIEADEKINPVAAMSETYDRLEKN* |
Ga0164307_114684992 | 3300012987 | Soil | RSAPNTPPLLLEIEADEKVNPVEKMREVFEKLEAE* |
Ga0157378_104448041 | 3300013297 | Miscanthus Rhizosphere | IDWKEAMELLRSAPHTPPLLLEIEADEKVNPVEKMKEAFGKLESA* |
Ga0181517_101768402 | 3300014160 | Bog | RSAPQTPALLLELAEDQKVNPLEKLKEAFDKLENA* |
Ga0163163_118029771 | 3300014325 | Switchgrass Rhizosphere | KDRDAHWWPGAGSIDWKKSLELLRSAPNTPPLLLEIEGDDKLKPEQKMREVFDRMERE* |
Ga0182024_125034861 | 3300014501 | Permafrost | WKEAMELLRSAPQTPPLMLELGEDEKLNPLERLRETFEKLETA* |
Ga0181525_101176062 | 3300014654 | Bog | KEAMELLRSAPQKPPLMLELAEDPKVNPMEKFGETFEKLEGIGD* |
Ga0181525_106945901 | 3300014654 | Bog | EVMELLRSAPLIPPLMLELGEEEHVNPLEKLRETFDKLEEI* |
Ga0182005_12187081 | 3300015265 | Rhizosphere | TINWKEAIELLRSAPQTPPLLLEIGDDEKGNPVERLGEVFAKLEES* |
Ga0134073_100564682 | 3300015356 | Grasslands Soil | MELLRSAPQTPPLLLEIEADEKVNPVEKMGETFRDLEAN* |
Ga0134089_100991311 | 3300015358 | Grasslands Soil | KQTMELLRSAPQTPPLLLEIEADEKVNPVEKMGETFRQLGAA* |
Ga0132255_1049457551 | 3300015374 | Arabidopsis Rhizosphere | WKEAMELLRSAPHTPPLLLEVEADEKVNPAEKMKEAFNKLESEL* |
Ga0132255_1059720291 | 3300015374 | Arabidopsis Rhizosphere | NIDWKEAMGLFRSAPHTPPLLLEIEADEKVNPLEKMPAAFDKLEAM* |
Ga0182040_111119071 | 3300016387 | Soil | NWKEAMELLRSAPNTPPLLLEIEHDAKVNPIDKVQPTFDKLETA |
Ga0134069_11064851 | 3300017654 | Grasslands Soil | NGSIDWKQTMELLRSAPHTPPLLFEIEADEKVNPVEKMKETFEKFGN |
Ga0187802_103092022 | 3300017822 | Freshwater Sediment | LRSAPQTPPLLLELAEDQNVNPLEKLAGAFEKLEGI |
Ga0187818_100445423 | 3300017823 | Freshwater Sediment | LRSAPQTPPLLFELEGDEKVNPLEKLGEAFGKLEKIG |
Ga0187820_10511811 | 3300017924 | Freshwater Sediment | QAMELLRSAPHTPPLLLEVEGDEKINPVEKMGETFEKLETV |
Ga0187820_10723852 | 3300017924 | Freshwater Sediment | AIDWKQAVELLRSAPHTPPLLLEIEADEKVNPVEKMAEAFGKLEAD |
Ga0187856_10721892 | 3300017925 | Peatland | GTIDWKEAMELLRSAPQTPPLMLELGESEKVNPLDKLRETFEKLETA |
Ga0187824_103014001 | 3300017927 | Freshwater Sediment | RSAPQTPPLLLEIEHDDKVNPIEKMQPTFDKLEGID |
Ga0187806_12260111 | 3300017928 | Freshwater Sediment | LRAARHAPPLLLEIEENEKINPAEKMPETFEKLDAA |
Ga0187825_100867153 | 3300017930 | Freshwater Sediment | LRSAPNTPPLLLEIEHDDKVNPIEKLQPAFDKLEEA |
Ga0187821_102563811 | 3300017936 | Freshwater Sediment | NGSIDWKQTMELLRSAPHTPPLLLEIEHDNKVNLVDKMKETFEKLAAE |
Ga0187821_103567341 | 3300017936 | Freshwater Sediment | GTIDWKEAIELLRSAPQTPPLLLEVGEDEKVNALDKLGETFDKLESA |
Ga0187809_103417092 | 3300017937 | Freshwater Sediment | GSGNIDWKEAMELLRSAPQTPPLLLELESDEKVNPLEKLPTAFDKLETA |
Ga0187808_102683031 | 3300017942 | Freshwater Sediment | TINWKEAMELLRSAPQTPPLLLELGEDEKVNPLEKLGETFDKLESS |
Ga0187819_103918222 | 3300017943 | Freshwater Sediment | DWKQAMQLLRSAPHTPPLLLEIEEDEKISPPEKMGETFRKFESI |
Ga0187779_100721801 | 3300017959 | Tropical Peatland | LWPGQGNIDWKEAMELLRSAPQTPPLLLELEGDEKVNPLEKLGETFGKLEGA |
Ga0187779_109954732 | 3300017959 | Tropical Peatland | LLRSAPQTPPLLLELEGDEKVNPLEKLGETFGKLEGA |
Ga0187783_100966373 | 3300017970 | Tropical Peatland | QGTIDWKEAVELLRSAPQTPPLLLEVGDDEKGSLFDRLAGVFDELEAN |
Ga0187781_100692051 | 3300017972 | Tropical Peatland | PGSGSIDWKQAMGLLRLSPHTPPMLLEIEGDEKVNPAEKMGEAFQRLEAN |
Ga0187781_102888271 | 3300017972 | Tropical Peatland | DLLRAAPQVPPVLLELEENEKVNALEKLREMFEKLEGA |
Ga0187781_108968101 | 3300017972 | Tropical Peatland | LLRSAPQTPPLLLELEGDEKVNPLEKLGEAFGKLEKIG |
Ga0187780_107825072 | 3300017973 | Tropical Peatland | WPGQGTIDWKEAVELLRSAPQRPPLLLELNEDEKVNPLEKLGETFDKLEAN |
Ga0187777_114055921 | 3300017974 | Tropical Peatland | GSIDWKQTMELLRSAPHTPPLLLEIEHDEKLNAVEKIRPAFDKLEAA |
Ga0187782_106823532 | 3300017975 | Tropical Peatland | GTIDWKEAVELLRSAPQTPPLLLELEGDEKMNPLEKLGETFGKLEKIG |
Ga0187816_103610342 | 3300017995 | Freshwater Sediment | WKEAVELLRSAPQTPPLLLELGEDEKVNPLEKLAETFQKLETMS |
Ga0187870_11677711 | 3300017998 | Peatland | QGTIDWKQAMELLRSAPQTPPLMLELGEDEKLNPLEKLSATFEKLETA |
Ga0187805_105634501 | 3300018007 | Freshwater Sediment | LRSAPHTPPLLLEIEEDEKVNPSEKMREVFEKLEGT |
Ga0187873_11885072 | 3300018013 | Peatland | IDWKEGVELLRSAPQTPPLLLEIAEDEKVNPLEKIGETFDKLEGLQ |
Ga0187874_103790841 | 3300018019 | Peatland | RSAPQTPPLLLELAEDEKVNALEKLGETFEKLEGIG |
Ga0187883_104587881 | 3300018037 | Peatland | KEAVELLRSAPQTPPLLLEIAEDEKVNPLEKIGETFDKLEGLQ |
Ga0187887_107988731 | 3300018043 | Peatland | QWPGQGTIDWKESMELLRSAPQTPALLLELAEDQKVNPLEKLKETFEKLETA |
Ga0187771_103339072 | 3300018088 | Tropical Peatland | WKEAMELLRSAPQTPPLMLELAEDEKVNPLEKLGEAFEKLETA |
Ga0066655_113482811 | 3300018431 | Grasslands Soil | KQTMELLRSAPHTPPLLFEIEADEKVNPVEKMKETFEKFGN |
Ga0187798_14421251 | 3300019275 | Peatland | LLRSAPQTPPLMLELAEDEKVNPLEKLGEAFEKLETA |
Ga0173482_107711561 | 3300019361 | Soil | EAMELLRSAPHTPPLLLEVEADEKVNPVEKMKEAFNKLESEL |
Ga0182025_12947361 | 3300019786 | Permafrost | KEPSTGKEAMALLRSAPQTPPLMLELGENEKVNPLEKLGATFDKLEAA |
Ga0193707_11536252 | 3300019881 | Soil | ELLRSAPHTPALLLEIEDDEKINPIEKMGETFEKLEEQ |
Ga0193718_10806501 | 3300019999 | Soil | GSINWKEAMELLRSAPHTPPLLLEVEHDDKVNPIEKMGSAFDKLETA |
Ga0193721_11629642 | 3300020018 | Soil | MELLRSAPHTPPLLLEVEHDDKVNPIEKMGSAFDKLETA |
Ga0193726_10434341 | 3300020021 | Soil | IDWKQAMELLRAAPHTPPLLLEVEEDEKVNPLEKMGQTYETLEST |
Ga0210407_107846712 | 3300020579 | Soil | GDGTVDWKEAVELLRSAPQTPALLLELESDEKVNPLEKLAATFEKLDAA |
Ga0210399_102508381 | 3300020581 | Soil | KETMELLRSAPQTPPMLLELGEDEKVNSLEKLAETFDKLETA |
Ga0210401_112302302 | 3300020583 | Soil | GSGSIDWKQAMELLRSEPQTPALLLEVEGDEKINPTEKMGEVFDKLEAA |
Ga0210404_106365232 | 3300021088 | Soil | WPGEGSINWKEAMELLRSAPHTPPLLLEIEHDDKVNPIEKMGPAFDKLETA |
Ga0210404_107087021 | 3300021088 | Soil | LRSAPQRPPLLLELGEDEKVNALEKLGETFDKLEATA |
Ga0210400_103668032 | 3300021170 | Soil | LWPGKGTIDWKEAMELLRSAPQTPALMLELDWDEKVNPLEKLGETFEKLETAGN |
Ga0210405_108775281 | 3300021171 | Soil | KEAVELLRSAPQRPPLLLELGENEKVNALDKLGETFDKLETTA |
Ga0210396_101002031 | 3300021180 | Soil | EAVELLRSAPQRPPLLLELGENEKVNAFEKLGETFDKLETA |
Ga0210396_102555642 | 3300021180 | Soil | MELLRSAPHTPPLLLEIEGDEKLNPVEKMSETFEKLEATD |
Ga0210396_102557201 | 3300021180 | Soil | ELLRSAPQKPPLLLELEENEKVNPLEKLSETFDKLEAA |
Ga0213882_105051111 | 3300021362 | Exposed Rock | KEAMELLRSAPNTPPLLLEIEHDDKVNPLEKIGPAFDQLESA |
Ga0210393_108167412 | 3300021401 | Soil | LRSAPQTPPLLLELAEDEKVNPLEKLPELFEKLEGSS |
Ga0210385_103966872 | 3300021402 | Soil | MDLLRSAPQTPPLLLELAEDEKVNPLEKLPELFEKLEGSS |
Ga0210385_105269532 | 3300021402 | Soil | GTINWKEAMELLRSAPQTPPLLVELAEDEKVNSLEKLPELFDELESH |
Ga0210397_109582383 | 3300021403 | Soil | LELLQSAPHTPPLLLEVEGDEKINPVEKMTEAFEKLEDV |
Ga0210389_111922422 | 3300021404 | Soil | QGSINWREAMELLRSAPNTPPLLLEIEHDDKVNPLEKIGLAFDKLESA |
Ga0210387_101188261 | 3300021405 | Soil | AMELLRSAPHTPALLLEIEADEKINPAEKMAEAFEKLETS |
Ga0210387_103868651 | 3300021405 | Soil | LRSAPQTPPLLLELESDEKINPLEKLGPTFDKLETA |
Ga0210386_103790771 | 3300021406 | Soil | DWKQAMELLRAAPQTPALMLELEGDEKVNPLEKLQETFEKLDTA |
Ga0210383_101612453 | 3300021407 | Soil | IDWKEAMELLRSAPQTPPLMLELADDEKVNPLEKFEATFDKLETA |
Ga0210394_103631601 | 3300021420 | Soil | WPGEGTIDWKEAMELLRRAPQTPPLMLELAENEKVNPLERFGESFEKLEGI |
Ga0210394_105638582 | 3300021420 | Soil | AMELLRSAPQTPPLMLELADDEKVNPLEKFEATFEKLEGI |
Ga0210384_107245741 | 3300021432 | Soil | LRSAPHTPPLLLEIEGDEKINPVEKMGETFEKLETV |
Ga0210384_110499922 | 3300021432 | Soil | PGDGTIDWKEAMELLRSAPQTPPLLLELAEDEKVNPLEKLAETFEKLEAVS |
Ga0210391_100485421 | 3300021433 | Soil | AMELLRSEPQTPALLLEVEGDEKINPTEKMGEVFDKLEAA |
Ga0210390_108641061 | 3300021474 | Soil | RSAPNTPPLLLEIEADEKVNPTEKMRETFDKLENL |
Ga0210390_109646112 | 3300021474 | Soil | EAIELLRSAPQTPPLLLELAEDEKVNPLEKLPELFEKLEGSS |
Ga0210392_107321092 | 3300021475 | Soil | MELLRSAPQTPPLMLELGENEKVNPLEKLRNAFDKLETA |
Ga0210402_116645682 | 3300021478 | Soil | RSAPQKPPLLLELGEDEKVNPLERFGETFDKLEAN |
Ga0210410_101887851 | 3300021479 | Soil | RSAPHTPPLLLEIEGNEKLNPVDKMAEAFEKLEASA |
Ga0126371_112410081 | 3300021560 | Tropical Forest Soil | IDWSNTVELLRSAPQVPPLLLEVEGEEKVSPVEGMKEAFDKLAIN |
Ga0242649_10295651 | 3300022509 | Soil | WKEAVELLRSAPQTPALLLELESDEKVNPLEKLAATFEKLDAA |
Ga0242655_100418793 | 3300022532 | Soil | DWKEAVELLRSAPQRPPLLLELGENEKVNALDKLGETFDKLETTA |
Ga0242665_101338552 | 3300022724 | Soil | ELLRSAPHTPPLLLEIEGDEKINPVDKMAEAFRKLETL |
Ga0242665_101666901 | 3300022724 | Soil | GTIDWKEAVELLRSAPQRPPLLLELGENEKVNALDKLGETFDKLETTA |
Ga0224571_1136622 | 3300022734 | Rhizosphere | AMELLRSAPQTPALLLELGEDEKVNPLEKFEATFEKLETA |
Ga0224560_1114072 | 3300023019 | Soil | RSAPQTPALLLELGEDEKVNPLEKFEATFEKLETA |
Ga0137417_10623212 | 3300024330 | Vadose Zone Soil | NWKEVMDLLRTAPQTPPLLLEIESDEKVNPLEKIGPAFGKLETA |
Ga0137417_13145096 | 3300024330 | Vadose Zone Soil | VPGQGSIDWKQAMELLRSAPETPALLLELEGDEKVNPLEKLGQTFEKLETA |
Ga0208690_10808891 | 3300025434 | Peatland | RSAPQTPPLLLELAEDEKVNALEKLPELFDKLESE |
Ga0207928_10802611 | 3300025494 | Arctic Peat Soil | EAMELLRNAPHTPPLLLEIEGDEKIGVVEGMTEAFRKLEES |
Ga0207695_103752531 | 3300025913 | Corn Rhizosphere | AMELLRSAPNTPPLLLEIESDEKNNPLDKMGETFDKLEAA |
Ga0207663_107100392 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | LRSAPHTPPLLLEVEADEKINLVDKMRTTFEEFSQ |
Ga0207663_109411211 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | WPGQGTINWKEAIELLRSAPQTPPLLLEIGDDEKGNPVERLGEVFAKLEES |
Ga0207663_111383382 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | WKEAMELLRSAPNTPPLLLEIEADEKVNPVEKMREVFEKLEAE |
Ga0207646_109706932 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | QTMELLRSAPQTPPLLLEIEHDERVNPVEKMGETFRELETT |
Ga0207650_100003401 | 3300025925 | Switchgrass Rhizosphere | DWKEAMELLRSAPNTPPLLLEIESDEKNNPLDKMGETFDKLESA |
Ga0207687_105771632 | 3300025927 | Miscanthus Rhizosphere | DWKEAMELLRSAPNTPPLLLEIESDEKNNPLDKMGETFDKLEAA |
Ga0207700_109404882 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | LWPGQGTIDWKQAIELLRSAPQKPPLLLELGEDEKVNPLEKLGETFDKLETIS |
Ga0207664_113056472 | 3300025929 | Agricultural Soil | PGQGTINWKEAIELLRSAPQTPPLLLEIGDDEKGNPVERLGEVFAKLEES |
Ga0207644_114502461 | 3300025931 | Switchgrass Rhizosphere | NNKDRDAHWWPGAGSIDWKKSLELLRSAPNTPPLLLEIEGDDKLKPEQKMREVFDRMERE |
Ga0207644_115382901 | 3300025931 | Switchgrass Rhizosphere | KEAMELLRSAPHTPPLLLEVEADEKVNPVEKMKEAFNKLESEL |
Ga0207712_108285831 | 3300025961 | Switchgrass Rhizosphere | GAGTIDWQVAMELLRSAPNTPPLLLETETDEKVDPVAKMSEVFRKLESA |
Ga0207668_101494523 | 3300025972 | Switchgrass Rhizosphere | NIDWKEAMELLRSAPNTPPLLLEIESDEKNNPLDKMGETFDKLEAA |
Ga0207678_114186252 | 3300026067 | Corn Rhizosphere | RSAPNTPPLLLEIEADEKVNPLEKMPEAFDKLEAM |
Ga0207674_102683142 | 3300026116 | Corn Rhizosphere | WKEAMELLRSAPHTPPLLLEVEADEKVNPVEKMKEAFNKLESEL |
Ga0209839_101597611 | 3300026294 | Soil | RSAPQTPPMLLELGEDEKVNSLEKLAETFDKLETA |
Ga0209236_11731702 | 3300026298 | Grasslands Soil | WPGKGSIDWKQTMELLRSAPQTPPLLLEIEADEKVNPVEKMGETFRQLGAA |
Ga0209239_12134142 | 3300026310 | Grasslands Soil | DWKQTMELLRSAPQTPPLLLEIEADEKVNPVEKMGETFRQLGAA |
Ga0209687_13140811 | 3300026322 | Soil | GQGTINWKEAIELLRSAPQTPPLLLEIGDDEKGNPVERLGEIFAKLEES |
Ga0209152_100081611 | 3300026325 | Soil | WKQTMELLRSAPQTPPLLLETEADEKVNPVEKMGETFRQLGAA |
Ga0209473_10029131 | 3300026330 | Soil | DWKQTMELLRSAPQTPPLLLEIEADEKVNPVEKMGETFRQLGAT |
Ga0209057_11383152 | 3300026342 | Soil | WKQTMELLRSAPQTPPLLLEIEADEKVNPVEKMGETFRQLGAT |
Ga0209057_11384502 | 3300026342 | Soil | WKQTMELLRSAPQTPPLLLEIEADEKVNPVEKMGETFRQLGAA |
Ga0257170_10585802 | 3300026351 | Soil | PGAGSIDWKEATELLRSAPHTPPLLLEVEADEKVNPVEKMGEAFRNLVIE |
Ga0257172_10327691 | 3300026482 | Soil | LRTAPQTPPLLLEIESDEKVNPLEKIGPAFGKLETA |
Ga0209648_101548991 | 3300026551 | Grasslands Soil | RSAPQTPALMLELEGDEKLNPLDKLGQTFEKLETA |
Ga0209577_100098051 | 3300026552 | Soil | WPGEGSINWKEAIELLSSAPHTPPLLLEIEGNDKTNPVDGMGEAFRKLRVAE |
Ga0179587_104591791 | 3300026557 | Vadose Zone Soil | GQGSIDWKQAMELLRSAPETPALLLELEGDEKVNPLEKLGPTFEKLETA |
Ga0207852_10305812 | 3300026959 | Tropical Forest Soil | WPGQGSIDWKGAVELLRSAPQRPPLLLELGEDEKVNPLEKLGETFDKLEGI |
Ga0209529_10416562 | 3300027334 | Forest Soil | MELLRSAPHTPALLLEVENDEKINLVEKMGETFKKLEAS |
Ga0208199_10389322 | 3300027497 | Peatlands Soil | REAMELLRSAPQMPALMLELEGDEKVNPLEKLGATFEKLERE |
Ga0209218_10226052 | 3300027505 | Forest Soil | WKEAMELLRSAPQTPALLLELEGDEKMNPLEKLAETFEKLDAA |
Ga0209525_10476482 | 3300027575 | Forest Soil | WKETVELLRSAPQKPPLLLELEENEKVNPLEKLSETFDKLEAA |
Ga0209420_11388791 | 3300027648 | Forest Soil | RSAPQTPALLLELEENEKVNPLEKFGETFEKLEAA |
Ga0208696_12729201 | 3300027696 | Peatlands Soil | KLLRSARHTPPLLLEIEENEKINPAEKMPETFEKLDAA |
Ga0208989_101821222 | 3300027738 | Forest Soil | GTIDWKAAMELLRSAPQTPPLLLELEADDKVNPLEKFEETFEKLETA |
Ga0208989_102326801 | 3300027738 | Forest Soil | GQGTIDWKAAMELLRSAPQTPPLLLELEADDKVNPLEKLGPTFEKLETA |
Ga0209580_100160515 | 3300027842 | Surface Soil | LRSAPQTPPLLLELGEDEKVNPLEKLPETFGKLEQS |
Ga0209580_103632961 | 3300027842 | Surface Soil | GSIDWKEAVELLRTAPQTPPLLLEIGEDEKVNPLEKLGQAFAKLESE |
Ga0209580_105934252 | 3300027842 | Surface Soil | RSAPNTPPLLLEVEHDDKVNPLEKIGPTFDKLESA |
Ga0209274_106433271 | 3300027853 | Soil | PGQGTIDWKEAMELLRSAPQTPPMLLELGEDEKVNSLEKLAETFDKLETA |
Ga0209283_102125192 | 3300027875 | Vadose Zone Soil | EGSINWKEAIELLRSAPHTPPLLLEIEGNDKTNPVDGMGEAFRKLRAAE |
Ga0209283_108193121 | 3300027875 | Vadose Zone Soil | DWKEAMELLRSAPQTPALMLELEGDDKVNPLEKLGQTFEKLETA |
Ga0209275_100847842 | 3300027884 | Soil | LRSAPQTPALLLELEGDEKVNPLEKLAATFEKLDAA |
Ga0209275_102197471 | 3300027884 | Soil | WKEAMELLRSAPQTPPLMLELGENEKVNPLEKLRNAFDKLETA |
Ga0209380_101946812 | 3300027889 | Soil | MTVLRTLLRSAPQKPALLLELEGDEKVNPLERLQATFDKLETA |
Ga0209380_102968992 | 3300027889 | Soil | ELLRSAPQTPPLLLELAEDEKVNPLEKLPEIFEKLETA |
Ga0209624_110662032 | 3300027895 | Forest Soil | KQAMELLRSAPHTPALLLEIESDEKINPVEKMSEAFDKLEAA |
Ga0209067_102363532 | 3300027898 | Watersheds | AMELLRSAPQTPPLLLELGEDEKVNPLEKLGETFEKLEGTA |
Ga0209006_101626943 | 3300027908 | Forest Soil | WPGQGTIDWKEAMELLRAAPQAPPVLLELAEDEKVNPLEKLGEAFEKLEA |
Ga0265350_1002521 | 3300028013 | Soil | MELLRSAPQTPALLLELEGDEKMNPLEKFAETFQKLDAM |
Ga0265351_10006203 | 3300028020 | Soil | AVELLRSAPQTPALLLELEGDEKVNPLEKLAATFEKLDAA |
Ga0265355_10019161 | 3300028036 | Rhizosphere | SIDWNQAMELLRSAPHTPPLLLEVEGDEKINPVEKMGETFEKLETV |
Ga0209526_108166812 | 3300028047 | Forest Soil | WKEAMELLLSAPNTPPLLLEIQEDDKVNPAEKMKETFDRLRN |
Ga0268264_105255372 | 3300028381 | Switchgrass Rhizosphere | KEAMELFRSAPNTPPLLLEIEADEKVNPLEKMPEAFDKLEAM |
Ga0137415_101284221 | 3300028536 | Vadose Zone Soil | KAATELLSSAPNTPPLLLEIEADEKVNPVERMSETFADLVVE |
Ga0302149_11916181 | 3300028552 | Bog | IDWKEVMELLRSAPLTPPLMLELGEEEHVNPLEKLRETFDKLEEI |
Ga0302301_10412303 | 3300028731 | Palsa | LLRSAPQVPPLMLELAEDPKVNPLEKFGETFEKLERFGN |
Ga0302269_12078331 | 3300028766 | Bog | GQGTVDWKEAMELLRSAPQTPALLLELEENEKVNPLEKLGETFDKLEEI |
Ga0265338_102201711 | 3300028800 | Rhizosphere | RSAPQTPPLLLELGEDEKVNPLEKLGETFDKLEGA |
Ga0302155_101321711 | 3300028874 | Bog | AMALLRAAPQKPPVMLELAENEKVNPLEKFEETFEKLEEV |
Ga0302154_105445182 | 3300028882 | Bog | VMELLRSAPLTPPLMLELGEEEHVNPLEKLRETFDKLEEI |
Ga0308309_106987981 | 3300028906 | Soil | LRSAPQKPPLMLELADDEKVNPLEKFAATFEKLEGN |
Ga0308309_117229511 | 3300028906 | Soil | QVMELLRSAPHTPALLLEIESDEKINPVEKMSEAFDKLEAA |
Ga0308309_118783472 | 3300028906 | Soil | SIGGEEAMELLRSAPHTPPLLLEIEEDEKINPIEKMGETFQKLETT |
Ga0311368_102154392 | 3300029882 | Palsa | PGQGTIDWKEAMELLRSAPQTPPLMLELAEDEKVNPLDKLAETFEKLEGS |
Ga0311331_100173761 | 3300029954 | Bog | RSAPQTPPLLLELEANEKVNPLEKLGATFEKLQTD |
Ga0311339_113663011 | 3300029999 | Palsa | DWKETMELLRSAPHTPPLLLELEGDDKVNPLEKMRATFDKLEAA |
Ga0302282_13616442 | 3300030045 | Fen | LRSAPQTPALLLELEENEKVNPLEKLGETFDKLEEI |
Ga0302182_103299852 | 3300030054 | Palsa | GQGTIDWKEAMELLRSAPQVPPLMLELAEDPKVNPLEKFGETFEKLERFGN |
Ga0302181_104726022 | 3300030056 | Palsa | GTIDWKEAMELLRSAPQVPPLMLELAEDPKVNPLEKFGETFEKLERFGN |
Ga0311333_100141911 | 3300030114 | Fen | ELLRSAPHKPPLLLEIEDDKAPLGERMSEAFEKLEAA |
Ga0311353_112359542 | 3300030399 | Palsa | KEAMELLRSAPQTPPLLLELAEDEKVNPLEKLAEAFEKLEEN |
Ga0310037_100057131 | 3300030494 | Peatlands Soil | WPGSGSIDWKQAVELIRSAPHTPPLLLEIEADEKVNPVEKMAEAFEKLEAL |
Ga0311354_105079552 | 3300030618 | Palsa | KEAMTLLRSAPQTPPLLLELETDDKINPLNHFEEAFEKLETA |
Ga0310039_102831352 | 3300030706 | Peatlands Soil | MDLLRSAPHTPPLLLEIEGDEKVNAAEKMGEAFQKLSNFVIG |
Ga0310039_103051122 | 3300030706 | Peatlands Soil | WKQAVELLRSAPHTPPLLLEIEGDEKVNPVEKMAEAFGKLEAD |
Ga0310038_101569462 | 3300030707 | Peatlands Soil | SAPHTPPLLLEIEGDEKVNAAEKMGEAFQKLSNFVIG |
Ga0265461_117728182 | 3300030743 | Soil | DGTVDWKEAVELLRSAPQTPALLLELEGDEKVNPLEKLAATFEKLDAA |
Ga0265461_136041192 | 3300030743 | Soil | PGDGTVDWKEAVELLRSAPQTPALLLELESDEKVNPLEKLAATFEKLDAA |
Ga0265750_10873771 | 3300030813 | Soil | GQGTIDWKESMELLRSAPQTPALLLELAEDQKVNPLEKLKETFEKLETA |
Ga0265754_10302892 | 3300031040 | Soil | PGSGSIDWKQAMELLRSAPHTPPLLLEVEGDEKINPVEKMGETFEKLETV |
Ga0170834_1041382231 | 3300031057 | Forest Soil | IDWKEAMELMRSAPHTPPLLLEVKDDEKVNALDKIGPTFEKLESA |
Ga0170834_1119688882 | 3300031057 | Forest Soil | GQGTINWKEAMELLRTAPQTPPLLLELAEDEKINPLDKLAETFEKLETMS |
Ga0265760_100252653 | 3300031090 | Soil | ELLRSAPQTPPLMLELGENEKVNPLEKLRNAFDKLETA |
Ga0265760_103573911 | 3300031090 | Soil | QGTIDWKEAMELLRSAPQTPPLMLELMDDEKVNPLEKFQGTFEKLETA |
Ga0170824_1127481222 | 3300031231 | Forest Soil | LWPGQGTIDWKEAMELLRSAPQTPPLLLELAEDEKVNPLEKLGETFEKLETA |
Ga0170824_1181810532 | 3300031231 | Forest Soil | GSIDWKEAMELMRSAPHTPPLLLEVKDDEKVNALDKIGPTFEKLESA |
Ga0302324_10003876611 | 3300031236 | Palsa | WPGEGTIDWKEAMELMRSAPQAPPLMLELAENEKVNPLEKFGATFEKLETA |
Ga0265340_101920402 | 3300031247 | Rhizosphere | AIELLRSAPQTPPLLLELGEDEKVNPLEKLGETFDKLEGA |
Ga0265316_103027541 | 3300031344 | Rhizosphere | GTIDWKQAIELLRSVPQKPPLLLELGEDEKVNPLEKLGETFEKLETA |
Ga0302326_126110551 | 3300031525 | Palsa | VNWKEAMELLRSAPQTPPLMLELAENEKVNPLEKLKQTFEKLEAA |
Ga0310915_108678801 | 3300031573 | Soil | IDLLREAPHKPPLMLEVEENEKINPTEKMGEAFKKLDRA |
Ga0310686_1018177462 | 3300031708 | Soil | IDWKQAMELLRSAPHTPPLLLEIEGDEKLNPADKMGEVFEKLEAD |
Ga0310686_1171943502 | 3300031708 | Soil | MELLRSAPQTPPLMLELADDEKVNPLEKFEATFEKLETA |
Ga0307474_102967741 | 3300031718 | Hardwood Forest Soil | ELLRSAPQTPPLLLELGEDEKVNPLEKLGETFEKLDTA |
Ga0307468_1000088251 | 3300031740 | Hardwood Forest Soil | GSIDWKEAMELLRSAPNTPPLLLEIESDEKVNPVDKMGEAFEKLEKIV |
Ga0307468_1004076911 | 3300031740 | Hardwood Forest Soil | SINWKEAMELMRAAPHTPPLLLEIEADEKINPVERMSETFATLERT |
Ga0307468_1025414061 | 3300031740 | Hardwood Forest Soil | GAGNIDWKEAMELLRSAPNTPPLLLEVEGDEKVNPVEKMREAFEKLDAE |
Ga0307477_102053511 | 3300031753 | Hardwood Forest Soil | WKPAVELLRSAPHTPPLLLEIEGDEKINPVEKMREAFEKLEAD |
Ga0307475_100508301 | 3300031754 | Hardwood Forest Soil | AVELLRSAPQRPPLLLELGENEKVNALEKLGETFDKLETTASLN |
Ga0307475_109577131 | 3300031754 | Hardwood Forest Soil | WKEAMELLRSAPQTPPLMLELAEDERVNPLEKFGATFEKLEGI |
Ga0302319_104896022 | 3300031788 | Bog | WKEAMELLRSAPQTPPLLLELAEDEKVNPLEKLEEAFDKLETA |
Ga0307478_112751572 | 3300031823 | Hardwood Forest Soil | QAMELLRSAPHTPPLLLEIEGDEKVNPVEKMAEAFEKLETD |
Ga0306923_115327772 | 3300031910 | Soil | IDWKEAMELLKSAPHTPPLLLEIEHDEKVNPLDKISPTFDKLETA |
Ga0318530_103823662 | 3300031959 | Soil | AMELLRSAPNTPPLLLEIEHDDKVNPIEKMQPTFDKLETA |
Ga0308176_119868352 | 3300031996 | Soil | SIDWKEAVSLLRSAPNTPPFLLEVEGDEKSNVVQHMEETFRALEPA |
Ga0318577_100578522 | 3300032091 | Soil | MELLRSAPNTPPLLLEIEHDDKVNPIEKMQPTFDKLETA |
Ga0307471_1001073601 | 3300032180 | Hardwood Forest Soil | PGKGSIDWKQAMELMRAAPHTPPLLLEIEADEKINPVEIMGETFTELEKA |
Ga0307471_1009572752 | 3300032180 | Hardwood Forest Soil | AMEVLRSAPQTPPLLLEIEADERVNPVEKMGEAFRNLAIE |
Ga0307472_1003902272 | 3300032205 | Hardwood Forest Soil | PGAGNIDWKEAMELLRSAPNTPLLLLEIESDEKNNPLDKMGETFDKLEAA |
Ga0307472_1018573382 | 3300032205 | Hardwood Forest Soil | LRSAPNTPPLLLETETDEKVDPVAKMSEVFRKLESA |
Ga0306920_1027370722 | 3300032261 | Soil | LLRSAPHTPPLLLEIEHDDKINPVEKMGSAFDKLETA |
Ga0335082_1000045034 | 3300032782 | Soil | QGTIDWKQAIELLRSAPQKPPLLLELGEDEKVNPLEKLGETFNKLETA |
Ga0335079_101568091 | 3300032783 | Soil | VELLRSAPQTPPLLLELAEDEKVNPLEKLAETFEKLEGN |
Ga0335079_103667162 | 3300032783 | Soil | RSAPQKPPLLLELGEDEKVNPLEKLGETFDKLETA |
Ga0335079_106008871 | 3300032783 | Soil | HGTIDWKEAMQLLRSAPQTPPLLFELEHDDKVNPLEKLGDAFGKLETIGD |
Ga0335079_112769641 | 3300032783 | Soil | MELLRSAPNTPPLLLEIEGDEKVNAAEKMGEAFRKLDAA |
Ga0335078_125471682 | 3300032805 | Soil | PGQGSIDWKQAIELLRSAPQTPPLLLEVGEDEKVNSFEKLGETLERLGN |
Ga0335080_114217311 | 3300032828 | Soil | EAMELLRSAPQTPPLLLEIEGDEKLSPLEKITQAFGKLETA |
Ga0335081_104483091 | 3300032892 | Soil | IDLLREAPHKPPLMLEVEENEKINPAERMGETFKKLDRA |
Ga0335081_113797031 | 3300032892 | Soil | APQTPPLLFELEHDDKVNPLEKLGDAFGKLETIGD |
Ga0335081_123986002 | 3300032892 | Soil | AITLLRSSSHKPPLLLEIEGEEKVNPAEKMVNAFQKLEAS |
Ga0335069_108889771 | 3300032893 | Soil | GQGTIDWKQAMELLRSAPQKPPLLLELGEDEKVNPLEKLGETFDKLETA |
Ga0335069_117031272 | 3300032893 | Soil | LRSAPHRPPLLLEVEHDDKVNPLQKIGETFKKLDPA |
Ga0335072_110663461 | 3300032898 | Soil | LRSAPQTPPMLLEIAEDEKVNPLERLGEMFDKLEAN |
Ga0335073_110530261 | 3300033134 | Soil | WPGQGTIDWKESIDLLRSAPQTPPMLLEIAEDEKVNPLERLGEMFDKLEAN |
Ga0310810_107670062 | 3300033412 | Soil | LRSAPNTPPLLLEVEGDEKVNPAERMQETFDKLEAL |
Ga0310811_102881013 | 3300033475 | Soil | TINWKEAIELLRSAPQTPPLLLEIGDDEKGNPVDRLGEVFAKLEES |
Ga0316212_10646292 | 3300033547 | Roots | EAMELLRSAPQTPPLMLELADDEKVNPLEKFEATFEKLEGI |
Ga0370483_0028976_1563_1673 | 3300034124 | Untreated Peat Soil | LRSAPQTPPLMLELAENEKINPLERLKQTFEKLEEI |
⦗Top⦘ |