| Basic Information | |
|---|---|
| Family ID | F007633 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 347 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MARWTASAKWAAGPALDGQRDMPLALRLSEGLGLSA |
| Number of Associated Samples | 25 |
| Number of Associated Scaffolds | 347 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 7.49 % |
| % of genes near scaffold ends (potentially truncated) | 92.80 % |
| % of genes from short scaffolds (< 2000 bps) | 90.78 % |
| Associated GOLD sequencing projects | 18 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.25 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (63.689 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater (86.167 % of family members) |
| Environment Ontology (ENVO) | Unclassified (92.507 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (87.032 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 14.06% β-sheet: 0.00% Coil/Unstructured: 85.94% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.25 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 347 Family Scaffolds |
|---|---|---|
| PF00583 | Acetyltransf_1 | 2.59 |
| PF00903 | Glyoxalase | 1.73 |
| PF13676 | TIR_2 | 1.73 |
| PF13302 | Acetyltransf_3 | 1.44 |
| PF13091 | PLDc_2 | 1.15 |
| PF06094 | GGACT | 0.86 |
| PF13391 | HNH_2 | 0.86 |
| PF04828 | GFA | 0.86 |
| PF07883 | Cupin_2 | 0.86 |
| PF11185 | DUF2971 | 0.86 |
| PF00069 | Pkinase | 0.58 |
| PF01844 | HNH | 0.58 |
| PF09851 | SHOCT | 0.58 |
| PF04326 | AlbA_2 | 0.58 |
| PF13175 | AAA_15 | 0.58 |
| PF13619 | KTSC | 0.58 |
| PF09509 | Hypoth_Ymh | 0.58 |
| PF04471 | Mrr_cat | 0.58 |
| PF03887 | YfbU | 0.58 |
| PF13643 | DUF4145 | 0.58 |
| PF14337 | Abi_alpha | 0.29 |
| PF13424 | TPR_12 | 0.29 |
| PF14534 | DUF4440 | 0.29 |
| PF14234 | DUF4336 | 0.29 |
| PF02517 | Rce1-like | 0.29 |
| PF09720 | Unstab_antitox | 0.29 |
| PF13673 | Acetyltransf_10 | 0.29 |
| PF13304 | AAA_21 | 0.29 |
| PF10137 | TIR-like | 0.29 |
| PF08867 | FRG | 0.29 |
| PF01926 | MMR_HSR1 | 0.29 |
| PF13555 | AAA_29 | 0.29 |
| PF08000 | bPH_1 | 0.29 |
| PF11969 | DcpS_C | 0.29 |
| PF13683 | rve_3 | 0.29 |
| PF07087 | DUF1353 | 0.29 |
| PF07603 | DUF1566 | 0.29 |
| PF08937 | DUF1863 | 0.29 |
| PF08241 | Methyltransf_11 | 0.29 |
| PF02810 | SEC-C | 0.29 |
| PF05973 | Gp49 | 0.29 |
| PF10592 | AIPR | 0.29 |
| PF07714 | PK_Tyr_Ser-Thr | 0.29 |
| PF14015 | DUF4231 | 0.29 |
| PF01047 | MarR | 0.29 |
| PF13590 | DUF4136 | 0.29 |
| PF12680 | SnoaL_2 | 0.29 |
| PF01124 | MAPEG | 0.29 |
| PF07617 | DUF1579 | 0.29 |
| PF10861 | DUF2784 | 0.29 |
| PF10544 | T5orf172 | 0.29 |
| PF06906 | DUF1272 | 0.29 |
| PF06877 | RraB | 0.29 |
| PF04365 | BrnT_toxin | 0.29 |
| PF13432 | TPR_16 | 0.29 |
| PF00795 | CN_hydrolase | 0.29 |
| PF04273 | BLH_phosphatase | 0.29 |
| PF00078 | RVT_1 | 0.29 |
| PF13523 | Acetyltransf_8 | 0.29 |
| PF03235 | DUF262 | 0.29 |
| PF01042 | Ribonuc_L-PSP | 0.29 |
| PF15919 | HicB_lk_antitox | 0.29 |
| PF07799 | DUF1643 | 0.29 |
| PF14355 | Abi_C | 0.29 |
| PF14491 | DUF4435 | 0.29 |
| PF05168 | HEPN | 0.29 |
| PF14338 | Mrr_N | 0.29 |
| PF01909 | NTP_transf_2 | 0.29 |
| PF13006 | Nterm_IS4 | 0.29 |
| PF07931 | CPT | 0.29 |
| PF14470 | bPH_3 | 0.29 |
| PF13744 | HTH_37 | 0.29 |
| COG ID | Name | Functional Category | % Frequency in 347 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.46 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.86 |
| COG2865 | Predicted transcriptional regulator, contains HTH domain | Transcription [K] | 0.58 |
| COG4679 | Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system | Defense mechanisms [V] | 0.29 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.29 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.29 |
| COG4333 | Uncharacterized conserved protein, DUF1643 domain | Function unknown [S] | 0.29 |
| COG3896 | Chloramphenicol 3-O-phosphotransferase | Defense mechanisms [V] | 0.29 |
| COG3813 | Uncharacterized conserved protein, DUF1272 domain | Function unknown [S] | 0.29 |
| COG3657 | Putative component of the toxin-antitoxin plasmid stabilization module | Defense mechanisms [V] | 0.29 |
| COG3453 | Predicted phosphohydrolase, protein tyrosine phosphatase (PTP) superfamily, DUF442 family | General function prediction only [R] | 0.29 |
| COG3076 | Regulator of RNase E activity RraB | Translation, ribosomal structure and biogenesis [J] | 0.29 |
| COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 0.29 |
| COG2250 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.29 |
| COG1895 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.29 |
| COG1479 | DNAse/DNA nickase specific for phosphorothioated or glycosylated phage DNA, GmrSD/DndB/SspE family, contains DUF262 and HNH nuclease domains | Defense mechanisms [V] | 0.29 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.29 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 63.69 % |
| Unclassified | root | N/A | 36.31 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300007517|Ga0105045_10090515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2677 | Open in IMG/M |
| 3300007517|Ga0105045_10124694 | Not Available | 2206 | Open in IMG/M |
| 3300007517|Ga0105045_10147426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Undibacterium → Undibacterium fentianense | 1989 | Open in IMG/M |
| 3300007517|Ga0105045_10150852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae | 1960 | Open in IMG/M |
| 3300007517|Ga0105045_10177814 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1763 | Open in IMG/M |
| 3300007517|Ga0105045_10185821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → Hydrogenophaga aromaticivorans | 1712 | Open in IMG/M |
| 3300007517|Ga0105045_10196295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1652 | Open in IMG/M |
| 3300007517|Ga0105045_10213385 | Not Available | 1564 | Open in IMG/M |
| 3300007517|Ga0105045_10222578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1521 | Open in IMG/M |
| 3300007517|Ga0105045_10233541 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1474 | Open in IMG/M |
| 3300007517|Ga0105045_10304830 | All Organisms → cellular organisms → Bacteria | 1233 | Open in IMG/M |
| 3300007517|Ga0105045_10325145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sterolibacteriaceae → Denitratisoma → unclassified Denitratisoma → Denitratisoma sp. DHT3 | 1179 | Open in IMG/M |
| 3300007517|Ga0105045_10338188 | Not Available | 1148 | Open in IMG/M |
| 3300007517|Ga0105045_10364779 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300007517|Ga0105045_10379181 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1062 | Open in IMG/M |
| 3300007517|Ga0105045_10398600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1026 | Open in IMG/M |
| 3300007517|Ga0105045_10399136 | Not Available | 1025 | Open in IMG/M |
| 3300007517|Ga0105045_10419347 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 990 | Open in IMG/M |
| 3300007517|Ga0105045_10453467 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 938 | Open in IMG/M |
| 3300007517|Ga0105045_10489861 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
| 3300007517|Ga0105045_10491243 | Not Available | 888 | Open in IMG/M |
| 3300007517|Ga0105045_10494921 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium BCCC1 | 883 | Open in IMG/M |
| 3300007517|Ga0105045_10505494 | Not Available | 870 | Open in IMG/M |
| 3300007517|Ga0105045_10519310 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 855 | Open in IMG/M |
| 3300007517|Ga0105045_10526789 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300007517|Ga0105045_10528373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 845 | Open in IMG/M |
| 3300007517|Ga0105045_10533044 | Not Available | 839 | Open in IMG/M |
| 3300007517|Ga0105045_10583652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 788 | Open in IMG/M |
| 3300007517|Ga0105045_10611891 | Not Available | 763 | Open in IMG/M |
| 3300007517|Ga0105045_10637692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. dw_954 | 742 | Open in IMG/M |
| 3300007517|Ga0105045_10638958 | Not Available | 741 | Open in IMG/M |
| 3300007517|Ga0105045_10663988 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 721 | Open in IMG/M |
| 3300007517|Ga0105045_10669113 | Not Available | 718 | Open in IMG/M |
| 3300007517|Ga0105045_10672440 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 715 | Open in IMG/M |
| 3300007517|Ga0105045_10675766 | Not Available | 713 | Open in IMG/M |
| 3300007517|Ga0105045_10681264 | Not Available | 709 | Open in IMG/M |
| 3300007517|Ga0105045_10715948 | Not Available | 685 | Open in IMG/M |
| 3300007517|Ga0105045_10731877 | Not Available | 675 | Open in IMG/M |
| 3300007517|Ga0105045_10771444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 651 | Open in IMG/M |
| 3300007517|Ga0105045_10774535 | Not Available | 650 | Open in IMG/M |
| 3300007517|Ga0105045_10819258 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300007517|Ga0105045_10824326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Brevundimonas → Brevundimonas fluminis | 623 | Open in IMG/M |
| 3300007517|Ga0105045_10905440 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 585 | Open in IMG/M |
| 3300007517|Ga0105045_10966265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter → Piscinibacter aquaticus | 561 | Open in IMG/M |
| 3300007517|Ga0105045_11091515 | Not Available | 519 | Open in IMG/M |
| 3300007517|Ga0105045_11107193 | Not Available | 514 | Open in IMG/M |
| 3300007517|Ga0105045_11145085 | Not Available | 503 | Open in IMG/M |
| 3300007521|Ga0105044_10176392 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2209 | Open in IMG/M |
| 3300007521|Ga0105044_10230768 | Not Available | 1831 | Open in IMG/M |
| 3300007521|Ga0105044_10341884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 1385 | Open in IMG/M |
| 3300007521|Ga0105044_10414254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1206 | Open in IMG/M |
| 3300007521|Ga0105044_10437461 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1159 | Open in IMG/M |
| 3300007521|Ga0105044_10469960 | Not Available | 1101 | Open in IMG/M |
| 3300007521|Ga0105044_10526877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFOXYD12_FULL_55_16 | 1014 | Open in IMG/M |
| 3300007521|Ga0105044_10559774 | Not Available | 970 | Open in IMG/M |
| 3300007521|Ga0105044_10572501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → unclassified Massilia → Massilia sp. erpn | 954 | Open in IMG/M |
| 3300007521|Ga0105044_10628752 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300007521|Ga0105044_10652825 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300007521|Ga0105044_10697335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → unclassified Massilia → Massilia sp. UMI-21 | 827 | Open in IMG/M |
| 3300007521|Ga0105044_10745049 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 789 | Open in IMG/M |
| 3300007521|Ga0105044_10760745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax | 777 | Open in IMG/M |
| 3300007521|Ga0105044_10877397 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 701 | Open in IMG/M |
| 3300007521|Ga0105044_11031147 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 626 | Open in IMG/M |
| 3300007521|Ga0105044_11325900 | Not Available | 526 | Open in IMG/M |
| 3300007799|Ga0105049_10155544 | Not Available | 2034 | Open in IMG/M |
| 3300007799|Ga0105049_10344324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rhizobacter → Rhizobacter gummiphilus | 1179 | Open in IMG/M |
| 3300007799|Ga0105049_10387446 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
| 3300007799|Ga0105049_10388299 | Not Available | 1084 | Open in IMG/M |
| 3300007799|Ga0105049_10442605 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 988 | Open in IMG/M |
| 3300007799|Ga0105049_10486125 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 925 | Open in IMG/M |
| 3300007799|Ga0105049_10511399 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300007799|Ga0105049_10544848 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 853 | Open in IMG/M |
| 3300007799|Ga0105049_10559267 | Not Available | 838 | Open in IMG/M |
| 3300007799|Ga0105049_10559643 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300007799|Ga0105049_10567297 | Not Available | 829 | Open in IMG/M |
| 3300007799|Ga0105049_10635805 | Not Available | 765 | Open in IMG/M |
| 3300007799|Ga0105049_10640744 | Not Available | 761 | Open in IMG/M |
| 3300007799|Ga0105049_10746610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Curvibacter → unclassified Curvibacter → Curvibacter sp. PD_MW3 | 683 | Open in IMG/M |
| 3300007799|Ga0105049_10782760 | Not Available | 661 | Open in IMG/M |
| 3300007799|Ga0105049_10802482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → Methylomonas koyamae | 650 | Open in IMG/M |
| 3300007799|Ga0105049_10841974 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 629 | Open in IMG/M |
| 3300007799|Ga0105049_10846307 | Not Available | 626 | Open in IMG/M |
| 3300007799|Ga0105049_10859537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocystis → Thiocystis violascens | 620 | Open in IMG/M |
| 3300007799|Ga0105049_10860622 | Not Available | 619 | Open in IMG/M |
| 3300007799|Ga0105049_10880600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 609 | Open in IMG/M |
| 3300007799|Ga0105049_10913384 | Not Available | 594 | Open in IMG/M |
| 3300007799|Ga0105049_11040315 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 543 | Open in IMG/M |
| 3300007799|Ga0105049_11087382 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 527 | Open in IMG/M |
| 3300009032|Ga0105048_10216486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → Methylophilus → unclassified Methylophilus → Methylophilus sp. 5 | 2265 | Open in IMG/M |
| 3300009032|Ga0105048_10229303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2175 | Open in IMG/M |
| 3300009032|Ga0105048_10234577 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2140 | Open in IMG/M |
| 3300009032|Ga0105048_10239659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2108 | Open in IMG/M |
| 3300009032|Ga0105048_10296572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Ralstonia → unclassified Ralstonia → Ralstonia sp. | 1807 | Open in IMG/M |
| 3300009032|Ga0105048_10320497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Quisquiliibacterium → Quisquiliibacterium transsilvanicum | 1708 | Open in IMG/M |
| 3300009032|Ga0105048_10363202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas frederiksbergensis | 1558 | Open in IMG/M |
| 3300009032|Ga0105048_10391797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Rugamonas → unclassified Rugamonas → Rugamonas sp. CCM 8940 | 1472 | Open in IMG/M |
| 3300009032|Ga0105048_10462347 | Not Available | 1300 | Open in IMG/M |
| 3300009032|Ga0105048_10462408 | Not Available | 1299 | Open in IMG/M |
| 3300009032|Ga0105048_10559828 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1122 | Open in IMG/M |
| 3300009032|Ga0105048_10563309 | Not Available | 1116 | Open in IMG/M |
| 3300009032|Ga0105048_10658567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → unclassified Massilia → Massilia sp. UMI-21 | 989 | Open in IMG/M |
| 3300009032|Ga0105048_10718314 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 924 | Open in IMG/M |
| 3300009032|Ga0105048_10743683 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300009032|Ga0105048_10785881 | Not Available | 861 | Open in IMG/M |
| 3300009032|Ga0105048_10825814 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300009032|Ga0105048_10830958 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 825 | Open in IMG/M |
| 3300009032|Ga0105048_10835761 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300009032|Ga0105048_10860365 | Not Available | 802 | Open in IMG/M |
| 3300009032|Ga0105048_10860403 | Not Available | 802 | Open in IMG/M |
| 3300009032|Ga0105048_10876357 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300009032|Ga0105048_10926521 | Not Available | 757 | Open in IMG/M |
| 3300009032|Ga0105048_10952832 | Not Available | 741 | Open in IMG/M |
| 3300009032|Ga0105048_11180212 | Not Available | 629 | Open in IMG/M |
| 3300009032|Ga0105048_11317779 | Not Available | 578 | Open in IMG/M |
| 3300009032|Ga0105048_11331970 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300009032|Ga0105048_11333439 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300009032|Ga0105048_11404595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 552 | Open in IMG/M |
| 3300009032|Ga0105048_11569160 | Not Available | 508 | Open in IMG/M |
| 3300009083|Ga0105047_10123909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Candidatus Magnetoglobus → Candidatus Magnetoglobus multicellularis → Candidatus Magnetoglobus multicellularis str. Araruama | 3165 | Open in IMG/M |
| 3300009083|Ga0105047_10216716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → unclassified Massilia → Massilia sp. UMI-21 | 2132 | Open in IMG/M |
| 3300009083|Ga0105047_10269103 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1824 | Open in IMG/M |
| 3300009083|Ga0105047_10283526 | All Organisms → cellular organisms → Bacteria | 1755 | Open in IMG/M |
| 3300009083|Ga0105047_10283612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Quisquiliibacterium → Quisquiliibacterium transsilvanicum | 1755 | Open in IMG/M |
| 3300009083|Ga0105047_10291793 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales → Leptospiraceae → Leptospira → Leptospira kmetyi | 1718 | Open in IMG/M |
| 3300009083|Ga0105047_10390275 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1386 | Open in IMG/M |
| 3300009083|Ga0105047_10424699 | Not Available | 1301 | Open in IMG/M |
| 3300009083|Ga0105047_10479725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 1187 | Open in IMG/M |
| 3300009083|Ga0105047_10507299 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
| 3300009083|Ga0105047_10527103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia | 1105 | Open in IMG/M |
| 3300009083|Ga0105047_10573534 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1036 | Open in IMG/M |
| 3300009083|Ga0105047_10621783 | Not Available | 974 | Open in IMG/M |
| 3300009083|Ga0105047_10646970 | Not Available | 945 | Open in IMG/M |
| 3300009083|Ga0105047_10671482 | Not Available | 918 | Open in IMG/M |
| 3300009083|Ga0105047_10674596 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 915 | Open in IMG/M |
| 3300009083|Ga0105047_10723844 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300009083|Ga0105047_10762801 | Not Available | 833 | Open in IMG/M |
| 3300009083|Ga0105047_10892515 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300009083|Ga0105047_10955557 | Not Available | 702 | Open in IMG/M |
| 3300009083|Ga0105047_11011860 | Not Available | 672 | Open in IMG/M |
| 3300009083|Ga0105047_11014729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 671 | Open in IMG/M |
| 3300009083|Ga0105047_11016656 | Not Available | 670 | Open in IMG/M |
| 3300009083|Ga0105047_11141131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 614 | Open in IMG/M |
| 3300009083|Ga0105047_11344417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Luteibacter → unclassified Luteibacter → Luteibacter sp. SG786 | 545 | Open in IMG/M |
| 3300009083|Ga0105047_11466726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → unclassified Rubrivivax → Rubrivivax sp. | 512 | Open in IMG/M |
| 3300009083|Ga0105047_11492655 | Not Available | 506 | Open in IMG/M |
| 3300009083|Ga0105047_11502440 | Not Available | 503 | Open in IMG/M |
| 3300009084|Ga0105046_10262923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → unclassified Acidovorax → Acidovorax sp. SD340 | 1890 | Open in IMG/M |
| 3300009084|Ga0105046_10326227 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. | 1614 | Open in IMG/M |
| 3300009084|Ga0105046_10351685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1526 | Open in IMG/M |
| 3300009084|Ga0105046_10403940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1376 | Open in IMG/M |
| 3300009084|Ga0105046_10467733 | Not Available | 1231 | Open in IMG/M |
| 3300009084|Ga0105046_10518238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1138 | Open in IMG/M |
| 3300009084|Ga0105046_10545202 | All Organisms → cellular organisms → Bacteria | 1094 | Open in IMG/M |
| 3300009084|Ga0105046_10628236 | Not Available | 981 | Open in IMG/M |
| 3300009084|Ga0105046_10668337 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 935 | Open in IMG/M |
| 3300009084|Ga0105046_10668587 | Not Available | 935 | Open in IMG/M |
| 3300009084|Ga0105046_10697638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Acidithiobacillia → Acidithiobacillales → Acidithiobacillaceae → Acidithiobacillus → Acidithiobacillus ferrivorans | 904 | Open in IMG/M |
| 3300009084|Ga0105046_10813626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Comamonas → unclassified Comamonas → Comamonas sp. BIGb0152 | 803 | Open in IMG/M |
| 3300009084|Ga0105046_10875243 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 758 | Open in IMG/M |
| 3300009084|Ga0105046_10899849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Aquincola → Aquincola rivuli | 742 | Open in IMG/M |
| 3300009084|Ga0105046_10924872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → Variovorax terrae | 727 | Open in IMG/M |
| 3300009084|Ga0105046_10960703 | Not Available | 706 | Open in IMG/M |
| 3300009084|Ga0105046_10966750 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 702 | Open in IMG/M |
| 3300009084|Ga0105046_11076241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 647 | Open in IMG/M |
| 3300009084|Ga0105046_11109836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Roseateles → Roseateles depolymerans | 632 | Open in IMG/M |
| 3300009084|Ga0105046_11312342 | Not Available | 558 | Open in IMG/M |
| 3300009084|Ga0105046_11354626 | Not Available | 545 | Open in IMG/M |
| 3300009084|Ga0105046_11517841 | Not Available | 502 | Open in IMG/M |
| 3300009686|Ga0123338_10112601 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1379 | Open in IMG/M |
| 3300009686|Ga0123338_10338405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Microcoleaceae → Symploca | 648 | Open in IMG/M |
| 3300012044|Ga0136636_10080470 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1577 | Open in IMG/M |
| 3300012044|Ga0136636_10147053 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300012044|Ga0136636_10216677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Ideonella → Ideonella azotifigens | 856 | Open in IMG/M |
| 3300012044|Ga0136636_10225662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. H7 | 835 | Open in IMG/M |
| 3300012044|Ga0136636_10254556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Paucibacter → unclassified Paucibacter → Paucibacter sp. KBW04 | 775 | Open in IMG/M |
| 3300012044|Ga0136636_10257678 | Not Available | 769 | Open in IMG/M |
| 3300012044|Ga0136636_10264457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Polaromonas → unclassified Polaromonas → Polaromonas sp. 35-63-35 | 756 | Open in IMG/M |
| 3300012044|Ga0136636_10278351 | Not Available | 732 | Open in IMG/M |
| 3300012044|Ga0136636_10281834 | Not Available | 727 | Open in IMG/M |
| 3300012044|Ga0136636_10286029 | Not Available | 720 | Open in IMG/M |
| 3300012044|Ga0136636_10294865 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300012044|Ga0136636_10304579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum | 693 | Open in IMG/M |
| 3300012044|Ga0136636_10324409 | Not Available | 666 | Open in IMG/M |
| 3300012044|Ga0136636_10340130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 647 | Open in IMG/M |
| 3300012044|Ga0136636_10363662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Polaromonas | 621 | Open in IMG/M |
| 3300012044|Ga0136636_10364617 | Not Available | 620 | Open in IMG/M |
| 3300012044|Ga0136636_10382480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter → unclassified Ramlibacter → Ramlibacter sp. USB13 | 602 | Open in IMG/M |
| 3300012044|Ga0136636_10418985 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300012044|Ga0136636_10424708 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 565 | Open in IMG/M |
| 3300012044|Ga0136636_10439427 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300012044|Ga0136636_10469721 | Not Available | 531 | Open in IMG/M |
| 3300012044|Ga0136636_10509274 | Not Available | 506 | Open in IMG/M |
| 3300012761|Ga0138288_1056832 | Not Available | 508 | Open in IMG/M |
| 3300013097|Ga0136639_10298341 | Not Available | 628 | Open in IMG/M |
| 3300015360|Ga0163144_10389611 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1673 | Open in IMG/M |
| 3300015360|Ga0163144_10439408 | All Organisms → cellular organisms → Bacteria | 1524 | Open in IMG/M |
| 3300015360|Ga0163144_10949140 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 833 | Open in IMG/M |
| 3300015360|Ga0163144_11455927 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300015360|Ga0163144_11469452 | Not Available | 601 | Open in IMG/M |
| 3300020057|Ga0163151_10277896 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300020180|Ga0163155_10204706 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300020192|Ga0163147_10570530 | Not Available | 516 | Open in IMG/M |
| 3300020201|Ga0163154_10138294 | Not Available | 1393 | Open in IMG/M |
| 3300020201|Ga0163154_10213267 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300020201|Ga0163154_10342834 | Not Available | 699 | Open in IMG/M |
| 3300020201|Ga0163154_10443669 | Not Available | 575 | Open in IMG/M |
| 3300020203|Ga0163148_10321002 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300020203|Ga0163148_10354717 | Not Available | 728 | Open in IMG/M |
| 3300020203|Ga0163148_10395727 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300020219|Ga0163146_10391153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Chromobacterium group → Iodobacter → Iodobacter fluviatilis | 771 | Open in IMG/M |
| 3300020219|Ga0163146_10423706 | Not Available | 726 | Open in IMG/M |
| 3300020219|Ga0163146_10560224 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300020219|Ga0163146_10602042 | Not Available | 554 | Open in IMG/M |
| 3300020596|Ga0163149_10456000 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300020596|Ga0163149_10557998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 552 | Open in IMG/M |
| 3300022222|Ga0226658_10518571 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 528 | Open in IMG/M |
| 3300027823|Ga0209490_10140460 | All Organisms → cellular organisms → Bacteria | 1690 | Open in IMG/M |
| 3300027823|Ga0209490_10163742 | All Organisms → cellular organisms → Bacteria | 1522 | Open in IMG/M |
| 3300027823|Ga0209490_10234459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rhizobacter → Rhizobacter gummiphilus | 1181 | Open in IMG/M |
| 3300027823|Ga0209490_10262687 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
| 3300027823|Ga0209490_10302228 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 981 | Open in IMG/M |
| 3300027823|Ga0209490_10354630 | Not Available | 871 | Open in IMG/M |
| 3300027850|Ga0209591_10035105 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4941 | Open in IMG/M |
| 3300027850|Ga0209591_10098167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2592 | Open in IMG/M |
| 3300027850|Ga0209591_10257782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio | 1331 | Open in IMG/M |
| 3300027850|Ga0209591_10284257 | All Organisms → cellular organisms → Bacteria | 1238 | Open in IMG/M |
| 3300027850|Ga0209591_10356445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1042 | Open in IMG/M |
| 3300027850|Ga0209591_10361399 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
| 3300027850|Ga0209591_10412687 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 930 | Open in IMG/M |
| 3300027850|Ga0209591_10427880 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 904 | Open in IMG/M |
| 3300027850|Ga0209591_10504587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus → unclassified Synechococcus → Synechococcus sp. Lug-A | 793 | Open in IMG/M |
| 3300027850|Ga0209591_10516252 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 779 | Open in IMG/M |
| 3300027850|Ga0209591_10575328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rhizobacter → Rhizobacter gummiphilus | 714 | Open in IMG/M |
| 3300027850|Ga0209591_10612958 | Not Available | 678 | Open in IMG/M |
| 3300027850|Ga0209591_10641859 | Not Available | 653 | Open in IMG/M |
| 3300027850|Ga0209591_10659450 | Not Available | 639 | Open in IMG/M |
| 3300027850|Ga0209591_10716646 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 596 | Open in IMG/M |
| 3300027850|Ga0209591_10805714 | Not Available | 540 | Open in IMG/M |
| 3300027878|Ga0209181_10125140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → unclassified Acidovorax → Acidovorax sp. SD340 | 2452 | Open in IMG/M |
| 3300027878|Ga0209181_10133514 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2350 | Open in IMG/M |
| 3300027878|Ga0209181_10156098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosomonas → Nitrosomonas eutropha | 2120 | Open in IMG/M |
| 3300027878|Ga0209181_10231370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rhizobacter → unclassified Rhizobacter → Rhizobacter sp. Root1221 | 1629 | Open in IMG/M |
| 3300027878|Ga0209181_10258293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1510 | Open in IMG/M |
| 3300027878|Ga0209181_10379493 | Not Available | 1150 | Open in IMG/M |
| 3300027878|Ga0209181_10429122 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
| 3300027878|Ga0209181_10479421 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 967 | Open in IMG/M |
| 3300027878|Ga0209181_10491903 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300027878|Ga0209181_10518094 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300027878|Ga0209181_10610065 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300027878|Ga0209181_11054510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya → unclassified Leptolyngbya → Leptolyngbya sp. PCC 7375 | 517 | Open in IMG/M |
| 3300032420|Ga0335397_10048229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 4699 | Open in IMG/M |
| 3300032420|Ga0335397_10189878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → Geobacter argillaceus | 1963 | Open in IMG/M |
| 3300032420|Ga0335397_10266724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → Hydrogenophaga aromaticivorans | 1552 | Open in IMG/M |
| 3300032420|Ga0335397_10314599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Halomonadaceae → Halomonas → Halomonas desiderata → Halomonas desiderata SP1 | 1379 | Open in IMG/M |
| 3300032420|Ga0335397_10378534 | Not Available | 1204 | Open in IMG/M |
| 3300032420|Ga0335397_10427098 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
| 3300032420|Ga0335397_10436728 | Not Available | 1082 | Open in IMG/M |
| 3300032420|Ga0335397_10451480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1055 | Open in IMG/M |
| 3300032420|Ga0335397_10499986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sterolibacteriaceae → Sulfuritalea → Sulfuritalea hydrogenivorans | 975 | Open in IMG/M |
| 3300032420|Ga0335397_10503167 | Not Available | 970 | Open in IMG/M |
| 3300032420|Ga0335397_10548215 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300032420|Ga0335397_10579815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 868 | Open in IMG/M |
| 3300032420|Ga0335397_10583443 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300032420|Ga0335397_10606229 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 838 | Open in IMG/M |
| 3300032420|Ga0335397_10641149 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300032420|Ga0335397_10645196 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 797 | Open in IMG/M |
| 3300032420|Ga0335397_10662637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas | 780 | Open in IMG/M |
| 3300032420|Ga0335397_10685574 | Not Available | 759 | Open in IMG/M |
| 3300032420|Ga0335397_10696390 | Not Available | 750 | Open in IMG/M |
| 3300032420|Ga0335397_10699264 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300032420|Ga0335397_10769554 | Not Available | 692 | Open in IMG/M |
| 3300032420|Ga0335397_10822537 | Not Available | 655 | Open in IMG/M |
| 3300032420|Ga0335397_10869210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae → unclassified Gallionellaceae → Gallionellaceae bacterium | 626 | Open in IMG/M |
| 3300032420|Ga0335397_10919508 | Not Available | 598 | Open in IMG/M |
| 3300032420|Ga0335397_10949353 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300032420|Ga0335397_11054868 | Not Available | 534 | Open in IMG/M |
| 3300032431|Ga0335395_10012536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 5447 | Open in IMG/M |
| 3300032431|Ga0335395_10027315 | All Organisms → cellular organisms → Bacteria | 3834 | Open in IMG/M |
| 3300032431|Ga0335395_10117731 | All Organisms → cellular organisms → Bacteria | 1899 | Open in IMG/M |
| 3300032431|Ga0335395_10127112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas reinekei | 1824 | Open in IMG/M |
| 3300032431|Ga0335395_10150338 | Not Available | 1668 | Open in IMG/M |
| 3300032431|Ga0335395_10157529 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1625 | Open in IMG/M |
| 3300032431|Ga0335395_10187615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1474 | Open in IMG/M |
| 3300032431|Ga0335395_10216367 | Not Available | 1355 | Open in IMG/M |
| 3300032431|Ga0335395_10239630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 1275 | Open in IMG/M |
| 3300032431|Ga0335395_10311917 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300032431|Ga0335395_10313648 | Not Available | 1078 | Open in IMG/M |
| 3300032431|Ga0335395_10338845 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1026 | Open in IMG/M |
| 3300032431|Ga0335395_10368472 | Not Available | 971 | Open in IMG/M |
| 3300032431|Ga0335395_10408485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Halomonadaceae → Halomonas → Halomonas desiderata → Halomonas desiderata SP1 | 905 | Open in IMG/M |
| 3300032431|Ga0335395_10432139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Paucibacter → Paucibacter toxinivorans | 870 | Open in IMG/M |
| 3300032431|Ga0335395_10471607 | Not Available | 818 | Open in IMG/M |
| 3300032431|Ga0335395_10473977 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300032431|Ga0335395_10534364 | Not Available | 748 | Open in IMG/M |
| 3300032431|Ga0335395_10541863 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300032431|Ga0335395_10565370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 717 | Open in IMG/M |
| 3300032431|Ga0335395_10568392 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300032431|Ga0335395_10577419 | Not Available | 706 | Open in IMG/M |
| 3300032431|Ga0335395_10594052 | Not Available | 691 | Open in IMG/M |
| 3300032431|Ga0335395_10627366 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300032431|Ga0335395_10636311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Halopseudomonas → Halopseudomonas oceani | 657 | Open in IMG/M |
| 3300032431|Ga0335395_10674593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 628 | Open in IMG/M |
| 3300032431|Ga0335395_10684573 | Not Available | 621 | Open in IMG/M |
| 3300032431|Ga0335395_10696179 | Not Available | 613 | Open in IMG/M |
| 3300032431|Ga0335395_10747180 | Not Available | 580 | Open in IMG/M |
| 3300032431|Ga0335395_10762598 | Not Available | 570 | Open in IMG/M |
| 3300032431|Ga0335395_10801378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 548 | Open in IMG/M |
| 3300032431|Ga0335395_10833634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 531 | Open in IMG/M |
| 3300032431|Ga0335395_10899986 | Not Available | 500 | Open in IMG/M |
| 3300032456|Ga0335394_10079307 | All Organisms → cellular organisms → Bacteria | 3468 | Open in IMG/M |
| 3300032456|Ga0335394_10235114 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1723 | Open in IMG/M |
| 3300032456|Ga0335394_10266698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1577 | Open in IMG/M |
| 3300032456|Ga0335394_10274218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Ideonella → unclassified Ideonella → Ideonella sp. A 288 | 1546 | Open in IMG/M |
| 3300032456|Ga0335394_10337058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae → Candidatus Nitrotoga → unclassified Candidatus Nitrotoga → Candidatus Nitrotoga sp. M5 | 1335 | Open in IMG/M |
| 3300032456|Ga0335394_10402799 | Not Available | 1170 | Open in IMG/M |
| 3300032456|Ga0335394_10420668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1132 | Open in IMG/M |
| 3300032456|Ga0335394_10455186 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1067 | Open in IMG/M |
| 3300032456|Ga0335394_10476177 | Not Available | 1031 | Open in IMG/M |
| 3300032456|Ga0335394_10509174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 979 | Open in IMG/M |
| 3300032456|Ga0335394_10553062 | Not Available | 917 | Open in IMG/M |
| 3300032456|Ga0335394_10576791 | Not Available | 886 | Open in IMG/M |
| 3300032456|Ga0335394_10670242 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300032456|Ga0335394_10711007 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300032456|Ga0335394_10738406 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300032456|Ga0335394_10748647 | Not Available | 717 | Open in IMG/M |
| 3300032456|Ga0335394_10770688 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300032456|Ga0335394_10818929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter → unclassified Ramlibacter → Ramlibacter sp. WS9 | 666 | Open in IMG/M |
| 3300032456|Ga0335394_10827743 | Not Available | 660 | Open in IMG/M |
| 3300032456|Ga0335394_10846607 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 648 | Open in IMG/M |
| 3300032456|Ga0335394_10984324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 571 | Open in IMG/M |
| 3300032456|Ga0335394_11021957 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 553 | Open in IMG/M |
| 3300032456|Ga0335394_11065965 | Not Available | 534 | Open in IMG/M |
| 3300032456|Ga0335394_11113333 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 515 | Open in IMG/M |
| 3300032456|Ga0335394_11132200 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 86.17% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 6.63% |
| Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 6.34% |
| Glacier Valley | Environmental → Aquatic → Freshwater → Ice → Glacier → Glacier Valley | 0.58% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.29% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300007517 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-02 (megahit assembly) | Environmental | Open in IMG/M |
| 3300007521 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01 | Environmental | Open in IMG/M |
| 3300007799 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-06 | Environmental | Open in IMG/M |
| 3300009032 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-05 | Environmental | Open in IMG/M |
| 3300009083 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-04 (megahit assembly) | Environmental | Open in IMG/M |
| 3300009084 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-03 (megahit assembly) | Environmental | Open in IMG/M |
| 3300009686 | Glacier valley bacterial and archeal communities from Borup Fiord, Nunavut, Canada, to study Microbial Dark Matter (Phase II) - groundupSSSS metaG | Environmental | Open in IMG/M |
| 3300012044 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ852 (21.06) | Environmental | Open in IMG/M |
| 3300012761 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130826_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013097 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ859 (21.06) | Environmental | Open in IMG/M |
| 3300015360 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1 | Environmental | Open in IMG/M |
| 3300020057 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP5.IB-2 | Environmental | Open in IMG/M |
| 3300020180 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.SP4.G1 | Environmental | Open in IMG/M |
| 3300020192 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica- Oligotrophic Lake LV.19.MP6.G1 | Environmental | Open in IMG/M |
| 3300020201 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP9.P1 | Environmental | Open in IMG/M |
| 3300020203 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica- Oligotrophic Lake LV.19.MP7.P2 | Environmental | Open in IMG/M |
| 3300020219 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP7.G1 | Environmental | Open in IMG/M |
| 3300020596 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP5.G1 | Environmental | Open in IMG/M |
| 3300022222 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1 (v2) | Environmental | Open in IMG/M |
| 3300027823 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-06 (SPAdes) | Environmental | Open in IMG/M |
| 3300027850 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01 (SPAdes) | Environmental | Open in IMG/M |
| 3300027878 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-05 (SPAdes) | Environmental | Open in IMG/M |
| 3300032420 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-04 (spades assembly) | Environmental | Open in IMG/M |
| 3300032431 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-02 (spades assembly) | Environmental | Open in IMG/M |
| 3300032456 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-03 (spades assembly) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0105045_100905154 | 3300007517 | Freshwater | MARWTASAKWAEGPALDGQRDMPLALRLSEGLGLGFRNTN* |
| Ga0105045_101246941 | 3300007517 | Freshwater | DGVARWTASAKWGEAPALDGQRDMPLALRLSEGLGRTSKRHR* |
| Ga0105045_101474264 | 3300007517 | Freshwater | RWTASAKWAEGPALDGLRGLPLALRLSEGLGLAY* |
| Ga0105045_101508521 | 3300007517 | Freshwater | AGDDGMARWTASAKWAAGPALDGQRDMPLALRLSEGLGLIGAAERTSCHSL* |
| Ga0105045_101778144 | 3300007517 | Freshwater | MACWTASAKWAAGPALDGQRDMPSSLRLSEGLGLSGVLDDLKL |
| Ga0105045_101858211 | 3300007517 | Freshwater | MARWTASAKWAAGPALDGQCAMPLLLRLSEGLGLT |
| Ga0105045_101962953 | 3300007517 | Freshwater | MARWTASAKWAAGPALDGQRDMPLALRLSEGLGVTGMGR* |
| Ga0105045_102133853 | 3300007517 | Freshwater | MARWTASAKWAAGPALDGRRGLPLALRLSEGLGSTGGMAMAWL |
| Ga0105045_102225781 | 3300007517 | Freshwater | MARWTASAKWAAGPALDGQRDMPLALRLSEGLGLSGPL |
| Ga0105045_102335411 | 3300007517 | Freshwater | AGDDGMARWTASAKWAAGPALDGQRDMPLALRLSEGLGVTLWSPA* |
| Ga0105045_102557861 | 3300007517 | Freshwater | NGMARWTASAKWAAGPALDGQRDMPLALRLSEGLGLITI* |
| Ga0105045_103048302 | 3300007517 | Freshwater | ARWTASAKWAAGPALDGQRDMPLALRLSEGLGITC* |
| Ga0105045_103251453 | 3300007517 | Freshwater | MARWTASAKWAEGPALDGQCDMPLALRLSEGLGSTAAGSIGLRGVAK |
| Ga0105045_103381882 | 3300007517 | Freshwater | AGDDGVARWTASAKWAEGPALDGQRDMPLALRLSEGLGLAGRRPTLRSV* |
| Ga0105045_103516481 | 3300007517 | Freshwater | DDGMARWTASAKWAAGPALDGQRDMPLALRLSEGLGSSGTYSIS* |
| Ga0105045_103647791 | 3300007517 | Freshwater | GMARWTASAKWAAGPALDGQRDMPLALRLSEGLGVFGS* |
| Ga0105045_103791811 | 3300007517 | Freshwater | MARWTASAKWAEGPALDGRRDMPLALRLSEGLGLTALRNFELL |
| Ga0105045_103986002 | 3300007517 | Freshwater | TASAKWAAGPALDGQRDMPLALRLSEGLGLTACVGG* |
| Ga0105045_103991362 | 3300007517 | Freshwater | VARWTASAKWAAGPALDGQRDMPLALRLSEGLGVAGGK |
| Ga0105045_104193471 | 3300007517 | Freshwater | RWTASAKWAAGPALDGQRDMPLALRLSEGLGIRALRL* |
| Ga0105045_104534672 | 3300007517 | Freshwater | GANGMARWTASAKWAAGPALDGQRAMPLALRLSEVLGPARATA* |
| Ga0105045_104898613 | 3300007517 | Freshwater | MARWTASAKWAAGPALDGQRDMPLALRLSEGLGLTG |
| Ga0105045_104912431 | 3300007517 | Freshwater | RWTASAKWAAGPALDGQRDMPLALRLSEGLGLSGTG* |
| Ga0105045_104949212 | 3300007517 | Freshwater | ARWTASAKWGAAPALDGQRDMPLALRLSEGLGVAG* |
| Ga0105045_105054942 | 3300007517 | Freshwater | ARWTASAKWAAGPALDGQRDMPLALRLSEGLGSTGLSLG* |
| Ga0105045_105193101 | 3300007517 | Freshwater | MARWTASAKWAAGPALDGQRDMPLALRLSEGLGLSGIG |
| Ga0105045_105267891 | 3300007517 | Freshwater | MARWTASAKWAAGPAIDGQCAMPLALRLSEGLGRTLAEQAD |
| Ga0105045_105283731 | 3300007517 | Freshwater | MARWTASAKWAEGPALDGQRDMPLALRLSEGLGLACATNM |
| Ga0105045_105330442 | 3300007517 | Freshwater | GMARWTASAKWAEGSALDGQCDMPLALRLSEGLGVTHD* |
| Ga0105045_105836522 | 3300007517 | Freshwater | MARWTASAKWAAGPALDGQCGMPLALRLSEGLGRSARIE |
| Ga0105045_106118911 | 3300007517 | Freshwater | AGDDGMARWTASAKWAAGPALDGQRDMPLALRLSEGLGVTAKIVGSLCG* |
| Ga0105045_106376922 | 3300007517 | Freshwater | MARWTASAKWGEAPALDGRRDMPLALRLSEGLGVARVAL |
| Ga0105045_106389581 | 3300007517 | Freshwater | AGDDGMARWTASAKWAAGPALDGQRDMPLALRLSEGLGLTVNH* |
| Ga0105045_106639881 | 3300007517 | Freshwater | RWTASAKWAEGPALDGQRDLPLALRLSEGLGLSFTVNCA* |
| Ga0105045_106691132 | 3300007517 | Freshwater | ASAKWAAGPALDGWRDMPLALRLSEGLGVAVGIEE* |
| Ga0105045_106724403 | 3300007517 | Freshwater | TASAKWGEAPALDGQRDMPLALRLSEGLGISAGRRR* |
| Ga0105045_106757661 | 3300007517 | Freshwater | MARWTASAKWAAGPALDGQCDMPLALRLSEGLGLT |
| Ga0105045_106812641 | 3300007517 | Freshwater | GDDGVARWTASAKWAVGPALDGQRDMPLALRLSEGLGVALGQGLTT* |
| Ga0105045_107159481 | 3300007517 | Freshwater | DDGMARWTASAKWAAGPALDGQRDMPLALRLSEGLGLARQGIGS* |
| Ga0105045_107234461 | 3300007517 | Freshwater | GMARWTASAEWAEGPALDGQPDMPLALRLSEGLGVSCTILRAWLL* |
| Ga0105045_107318771 | 3300007517 | Freshwater | MARWTASAKWAAGPALDGQRDMPLALRLSEGLGIS |
| Ga0105045_107714441 | 3300007517 | Freshwater | ARWTASAKWAEGPALDGQRDMPLALRLSEGLGVARSSGSI* |
| Ga0105045_107745351 | 3300007517 | Freshwater | AGDDGMARWTASAKWAAGPALDGQRDMPLALRLSEGLGLTGDRT* |
| Ga0105045_108192581 | 3300007517 | Freshwater | MARWTASAKWAEGPALDGQRDMPLALRLSEGLGLTALADD |
| Ga0105045_108243261 | 3300007517 | Freshwater | MARWTASAKWAAGPALDGRCDMPLALRLSEGLGLNA |
| Ga0105045_109054401 | 3300007517 | Freshwater | MACWPASAKWAEGPALDGRRDMPLALRLSEGLGLTALRNFE |
| Ga0105045_109662651 | 3300007517 | Freshwater | MARWAVSAKWAEGPALAGQRDMPLALRLSEGLGVTADGLNLS |
| Ga0105045_110915151 | 3300007517 | Freshwater | MSRWTASAKWAAGPALDGQRDMPLALRLSEGLGISEFTAFF |
| Ga0105045_111071932 | 3300007517 | Freshwater | MARWTASAKWAAGPALDGQRDMPLALRLSEGLGVTGCP |
| Ga0105045_111450851 | 3300007517 | Freshwater | MARRTASAKWAAGPALDGQRDMPLALRLSEGLGISEFTAFFRPS |
| Ga0105044_101763923 | 3300007521 | Freshwater | MARWTASAKWAEGPALDGQCDMPLALRLSEGLGLSEPLD |
| Ga0105044_102307683 | 3300007521 | Freshwater | MARWTASAKWAAGPALDGQRDMPLALRLSEGLGLSA |
| Ga0105044_103418843 | 3300007521 | Freshwater | MACWTASAKWAAGPALDGQRDMPLALRLSEGLGSTALFLGL |
| Ga0105044_104142543 | 3300007521 | Freshwater | MARWTASAKWAEGPAFDGQRDMPLALRLSEGLGVDTHAI |
| Ga0105044_104374611 | 3300007521 | Freshwater | VGDDGRARWAASAKWAEGPALDGQRDLPLALRLSE |
| Ga0105044_104699601 | 3300007521 | Freshwater | MARWTAIAKWAAGPALDGQRDRPLALRLSEGLVRIACRCECESV |
| Ga0105044_105268772 | 3300007521 | Freshwater | MARWTASAKWAEGPALDGQRDMPLALRLSEGLGRI |
| Ga0105044_105597742 | 3300007521 | Freshwater | MARWTASAKWAEGPALDGQCDMPLALRLSEGLGLSEPLDDL |
| Ga0105044_105725011 | 3300007521 | Freshwater | MARWTASARWAAGLALDGQRGMPLALRLSGGLGLSGHK |
| Ga0105044_106287521 | 3300007521 | Freshwater | MARWTASAKWAAGPALDGQCAMPLALRLSEGLGLDV |
| Ga0105044_106528252 | 3300007521 | Freshwater | MARWTASAKWAAGPALDGQRAMPLALRLSEGLGICG |
| Ga0105044_106973351 | 3300007521 | Freshwater | MARWTASAKWAAGPALDGQRDMPLALRLSEGLGLTAHHVR* |
| Ga0105044_107148601 | 3300007521 | Freshwater | DDGVARWTASAKWAEGPALDGQCAMPLALRLNEGLDLTRDLS* |
| Ga0105044_107450491 | 3300007521 | Freshwater | MARWTASAKWAAGPALDGQCAMPLALRLSEGLGLAAVR* |
| Ga0105044_107607451 | 3300007521 | Freshwater | MARWTASAKWAAGPALDGQRDMPLALRLSEGLGLSARI |
| Ga0105044_108773971 | 3300007521 | Freshwater | AGDDGMARWTASAKWAAGPALDGQRDMPLALRLSEGLGLS* |
| Ga0105044_109353641 | 3300007521 | Freshwater | AGDDGMARWKASAKWAAGPALDGQRDMPLALRLSEGLGISARDV* |
| Ga0105044_110311471 | 3300007521 | Freshwater | DGVARWTASAEWAEGPALDGQRDMPLALRLSEGLGIAERWR* |
| Ga0105044_113259001 | 3300007521 | Freshwater | GMARWTASAKWAAGPALDGQRGMPLALRLSEGLGLAAAIATMH* |
| Ga0105049_101555441 | 3300007799 | Freshwater | MARWTASAKWAAGPALDGQRDMPLALRLSEGLGLSALPMMTTG |
| Ga0105049_103443241 | 3300007799 | Freshwater | AGDDGMARWTASAKWAEGPALDGQRDMPLALRLSEGLGLAALG* |
| Ga0105049_103874461 | 3300007799 | Freshwater | AGDDGVARWTASAKWAAGPALDGQRDMPLALRLSEGLGVTAH* |
| Ga0105049_103882993 | 3300007799 | Freshwater | ARWTASAKWAAGPALDGQRDMPLALRLSEGLGLTAR* |
| Ga0105049_104426052 | 3300007799 | Freshwater | MARWTASAKWAEGPALDGQRDMPLALRLSEGLGVA |
| Ga0105049_104861251 | 3300007799 | Freshwater | MARWTASAKWAEGPALDGQRDMPLALRLSEGLGLNATIRMLP* |
| Ga0105049_105113991 | 3300007799 | Freshwater | MARWTASAKWAAGPALDGQRAMPLALRLSEGLGVSR |
| Ga0105049_105448482 | 3300007799 | Freshwater | DGVARWTASAKWAAGPALDGQRDMPLALRLSEGLGVTA* |
| Ga0105049_105592671 | 3300007799 | Freshwater | MSRWTASAKWAEGPALDGRRGLPLALRLSEGLGVTV |
| Ga0105049_105596433 | 3300007799 | Freshwater | MARWTASAKWAYGPARVGKRDMPLALRLSEGLGVTGHALA* |
| Ga0105049_105672971 | 3300007799 | Freshwater | SAKWAEGPALDGQRDMPLSLRLSEGLGGVAMRRG* |
| Ga0105049_106358051 | 3300007799 | Freshwater | MARWTASAKWAAGPALDGQRDMPLVLRLSEGLGRTFSA |
| Ga0105049_106407442 | 3300007799 | Freshwater | MARCTASAKWAAGPALDGQRDMPLALRLSEGLGVAHHG |
| Ga0105049_106685862 | 3300007799 | Freshwater | MACWTASAKWAAGPALDGQRDMPLALRLSEGLGSTALFLGLET |
| Ga0105049_107466101 | 3300007799 | Freshwater | MARWTASAKWGEAPALDGQRDMPLALRLSEGLGVTVR* |
| Ga0105049_107827601 | 3300007799 | Freshwater | AGDDGMARWTASAKWAAGPALDGQRDMPLALRLSEGLGVTAR* |
| Ga0105049_108024821 | 3300007799 | Freshwater | MARWTASAKWAEGPALDGQRAMPLALRLSEGLGLAA |
| Ga0105049_108419742 | 3300007799 | Freshwater | RWTASAKWAAGPALDGQRDMPLALRLSEGLGVTALCF* |
| Ga0105049_108463071 | 3300007799 | Freshwater | MARWTASAKWAAGPALDGQCDMPLALRLSEGLGLTC |
| Ga0105049_108595371 | 3300007799 | Freshwater | RWTASAKWAAGPALDGQRDMPLALRLSEGLGIRASLQLSDV* |
| Ga0105049_108606221 | 3300007799 | Freshwater | MTRWTASAKWAEGPALDGQRAMPLALRLSEGLGLAAA |
| Ga0105049_108806002 | 3300007799 | Freshwater | WTASAKWAAGPALDGQCDMPLALRLSEGLGLGLLNYAN* |
| Ga0105049_109133841 | 3300007799 | Freshwater | GMARWTASAKWAAGPALDGQRDMPLALRLSEGLGVAG* |
| Ga0105049_110403151 | 3300007799 | Freshwater | MARWTASAKWAEGPALDGQCDMPLALRLSDWLGHTAWIS |
| Ga0105049_110873822 | 3300007799 | Freshwater | MSRWTASAKWAAGPALDGQRDMPLAHRLSQGLGRIRRGPYRV |
| Ga0105048_102164861 | 3300009032 | Freshwater | AGDDGMARWTASAKWAAGPALDGQRDMPLALRLSEGLGVTCTP* |
| Ga0105048_102293031 | 3300009032 | Freshwater | MARWTASAKWAEGPALDARRDMPLALRLSEGLGSTASGAQVT |
| Ga0105048_102345773 | 3300009032 | Freshwater | MARWIASAKWAAGPALDGQRAMPLALRLSEGLGLRARNFQERHYL |
| Ga0105048_102396591 | 3300009032 | Freshwater | GMARWTASAKWGAAPALDGQCDMPLALRLSEGLGLTL* |
| Ga0105048_102965723 | 3300009032 | Freshwater | ARWTASAKWAAGPALDGQRAMPLALRLSEGLGVISD* |
| Ga0105048_103204973 | 3300009032 | Freshwater | WTASAKWAAGPALDGQRAMPLALRLSEGLGLALGR* |
| Ga0105048_103632023 | 3300009032 | Freshwater | AGDDGMARWTASAKWAAGPALDGQRDMPLALRLSEGLGVTALCF* |
| Ga0105048_103917971 | 3300009032 | Freshwater | MARWTASAKWAEGPALDGQCDMPLALRLSEGLGISARDRRLS* |
| Ga0105048_104623473 | 3300009032 | Freshwater | GDDGMARWTASAKWAAGPALDGQRDMPLALRLSEGLGLSARTM* |
| Ga0105048_104624082 | 3300009032 | Freshwater | GDDGMARWTASAKWAAGPALDGQRDMPLALRLSEGLGLTAPDISKLI* |
| Ga0105048_105598283 | 3300009032 | Freshwater | MARWIASAKWAEGPALDGQRDMPLALRLSEGLGVAFVDD |
| Ga0105048_105633092 | 3300009032 | Freshwater | ARWTASAKWAAGPALDGQRDMPLALRLSEGLGVT* |
| Ga0105048_106585671 | 3300009032 | Freshwater | AGDDGMARWTASAKWAAGPALDGQRDMPLALRLSEGLGLTAHHVR* |
| Ga0105048_107183141 | 3300009032 | Freshwater | GMARWTASAKWAEGPALDGQRDMPLALRLSEGLGLNATIRMLP* |
| Ga0105048_107436831 | 3300009032 | Freshwater | MARWTASAKWAAGPALDGQRAMPLALRLSEGLGLNCWQLGNDM |
| Ga0105048_107858812 | 3300009032 | Freshwater | MARWTASAKWAAGPALEGQRDMPLALRLSEGLGRIPAEE |
| Ga0105048_108258141 | 3300009032 | Freshwater | GDDGMARWTASAKWAAGPALDGQRDMPLALRLSEGLGVMWDGAAWF* |
| Ga0105048_108309581 | 3300009032 | Freshwater | MASWTASAKWAAGPALDGQRAMPLALRLSEGLGLTA |
| Ga0105048_108349271 | 3300009032 | Freshwater | MARWTASAKWAVGPALDGQRDMPLALRLSEGLGLCGQVLRE* |
| Ga0105048_108357612 | 3300009032 | Freshwater | MARWTASAKWAAGPALDGQRGMPLALRLSEGLGVSPAAIGP |
| Ga0105048_108603653 | 3300009032 | Freshwater | SAKWAAGPALDGQRDMPLALRLREGLGVNAVETA* |
| Ga0105048_108604031 | 3300009032 | Freshwater | MARWTASAKWAAGPALDGQCDMPLALRLSEGLGLAR* |
| Ga0105048_108763571 | 3300009032 | Freshwater | AGDDGMARWTASAKWAAGPALDGQRDMPLALRLSEGLGLTAWAG* |
| Ga0105048_109265211 | 3300009032 | Freshwater | AGDDGMARWTASAKWAAGPALDGQRDMPLALRLSEGLGLARSNQRL* |
| Ga0105048_109528321 | 3300009032 | Freshwater | MLRWTASAKWAAGPALDGQRDMPLALRLSEGLGRIACRCECE |
| Ga0105048_111802121 | 3300009032 | Freshwater | VARWTASAKWAAGPALDGQRATPLALRLSEGLGIS |
| Ga0105048_113177791 | 3300009032 | Freshwater | GDDGMARWTASAKWAAGPALDGQRDMPLALRLSDWLGLARKCTD* |
| Ga0105048_113319701 | 3300009032 | Freshwater | GMARWTASAKWAAGPALDGWRDMPLALRLSEGLGRNCTCSL* |
| Ga0105048_113334391 | 3300009032 | Freshwater | MARWTASVKWAEGPALDGRRGLPLALRLSEGLGVTS |
| Ga0105048_114045952 | 3300009032 | Freshwater | MARWTASAKWAAGPALDGQRDMPLALRLSEGLGVTGAT |
| Ga0105048_115691601 | 3300009032 | Freshwater | ASAKWAAGPALAGRRDMPLALRLSEGLGLARQGIGS* |
| Ga0105047_101239093 | 3300009083 | Freshwater | MARWTESAKWAAGPALDGQRDMPLALRLSEGLGLSGHR* |
| Ga0105047_102167161 | 3300009083 | Freshwater | GDDGMARWTASAKWAAGPALDGQRDMPLALRLSEGLGLTAHHVR* |
| Ga0105047_102691031 | 3300009083 | Freshwater | AGDDGMARWTASAKWAAGPALDGQRDMPLALRLSEGLGLA* |
| Ga0105047_102835261 | 3300009083 | Freshwater | MARWTASAKWAAGPALDGQRDMPLALRLSEGLGVTARAA |
| Ga0105047_102836121 | 3300009083 | Freshwater | MARWTASAKWAAGPALDGQRAMPLALRLSEGLGLALGR* |
| Ga0105047_102917931 | 3300009083 | Freshwater | MARWTASAKWAAGPALDGQCAMPLALRLSEGLGLAPRWWLS |
| Ga0105047_103902751 | 3300009083 | Freshwater | GMARWTASAKWAEGPALDGQCDMPLALRLSEGLGLNGA* |
| Ga0105047_104246991 | 3300009083 | Freshwater | AGDDGMARWTASAKWAAGPALDGQRDMPLALRLSEGLGLTAPDISKLI* |
| Ga0105047_104797252 | 3300009083 | Freshwater | GMARWTASAKWGEAPALDGRRDMPLALRLSEGLGSTAFLLG* |
| Ga0105047_105072992 | 3300009083 | Freshwater | AGDDGVARWTASAKWAEGPALDGQRDMPLALRLSEGLGVAFNGTK* |
| Ga0105047_105271031 | 3300009083 | Freshwater | DDGMARWTTSAKWAAGPALDGQRDMPLALRLSEGLGVTRW* |
| Ga0105047_105735342 | 3300009083 | Freshwater | MARWTASAKWAAGPALDGQRGMPLALRLSEGLGLTGRY |
| Ga0105047_106217831 | 3300009083 | Freshwater | MARWTESAKWAAGTALDSQRDMPLALRLSEGLGLTRTF |
| Ga0105047_106469701 | 3300009083 | Freshwater | MARWTASAKWAEGPALDGQRDMPLALRLSEGLGLSGPLDDL |
| Ga0105047_106714823 | 3300009083 | Freshwater | MSRWTASAKWAEGPALDGQRDMPLALRLSEGLGSTRGNAKLR |
| Ga0105047_106745962 | 3300009083 | Freshwater | GMARWTASAKWAAGPALDGQRAMPLSLRLSEGLGRTSD* |
| Ga0105047_107238441 | 3300009083 | Freshwater | MARWTASAKWAAGPALDGQRDMPLALRLSEGLGRIACR |
| Ga0105047_107628011 | 3300009083 | Freshwater | MVRWTASAKWAAGPALDGQCDMPLALRLSEGLGLTEHYFERA |
| Ga0105047_108925151 | 3300009083 | Freshwater | GMARWTASAKWAAGPALDGQRDMPLALRLSEGLGLTAWAG* |
| Ga0105047_109555571 | 3300009083 | Freshwater | MAHWTASAKWAEGPALDGQRDMPLALRLSEGLGISAIGERV |
| Ga0105047_110118601 | 3300009083 | Freshwater | MARWTASAKWAAGPALDGQRDMPLALRLSEGLGISEFTAF |
| Ga0105047_110147292 | 3300009083 | Freshwater | WTASAKWAEGPALDGQRAMPLALRLSEGLGLAAAIATMH* |
| Ga0105047_110166561 | 3300009083 | Freshwater | MACWTASAKWAEGPALDGQRDMPLALRLSEGLGISEFTAF |
| Ga0105047_111411311 | 3300009083 | Freshwater | DGMARWTASAKWAAGPALDGQCDMPLALRLSEGLGLGLLNYAN* |
| Ga0105047_113444171 | 3300009083 | Freshwater | TVSAKWAEGPALDGQRGLPLALRLSEGLGLTAAGQVIT* |
| Ga0105047_114667262 | 3300009083 | Freshwater | MARWTASAKWGEAPALYGQRDMAFALRLSEGLGVNGGNLRRV |
| Ga0105047_114926551 | 3300009083 | Freshwater | AGDDGMARWTASAKWAAGPALDGQRDMPLALRLSEGLGITAVCLR* |
| Ga0105047_115024402 | 3300009083 | Freshwater | RWTASAKWAAGPALDGQRDMPLALRLSEGLGLSAAA* |
| Ga0105046_102629231 | 3300009084 | Freshwater | GMARWTASAKWAEGPALDGQCDMPLALRLSEGLGISSP* |
| Ga0105046_103262271 | 3300009084 | Freshwater | AGDDGMARWTASAKWAAGPALDGQRDMPLARRLSEWLGITCAAVT* |
| Ga0105046_103516851 | 3300009084 | Freshwater | DGRTRQTASAKWGEAPALDGWRGLPSALRLSEGLGLTARGRPNFYV* |
| Ga0105046_104039402 | 3300009084 | Freshwater | MARWTASAKWAAGPALDGQRDMPLALRLSEGLGRIAC |
| Ga0105046_104677331 | 3300009084 | Freshwater | MSRWPASAKWAAGPALDGQRDMPLALRLSEGLGSTRGNAKLRTS |
| Ga0105046_105182383 | 3300009084 | Freshwater | MARWAASAKWAAGPALDGQRDMPLALRLSEGLGVTGLR |
| Ga0105046_105452021 | 3300009084 | Freshwater | MARWTASAKWAAGPALDGQRDMPLALRLSEGLGLT |
| Ga0105046_106282362 | 3300009084 | Freshwater | MARWTASAKWGEAPALDGQRDMPLALRLSEGLGRDVSI* |
| Ga0105046_106683371 | 3300009084 | Freshwater | RWTASAKWAAGPALDGQRDMPLALRLSEVLGPARATA* |
| Ga0105046_106685872 | 3300009084 | Freshwater | MARWTASAKWAEGPALDGQRDMPLALRLSEGLGRRRIA |
| Ga0105046_106976383 | 3300009084 | Freshwater | MARWTASAKWAAGPALDVQCDMPLALRLSEGLGLGLLNYAN |
| Ga0105046_108136262 | 3300009084 | Freshwater | LSEAGDDGVARWTASAKWAAGPALDGQRDMPLALRL |
| Ga0105046_108752431 | 3300009084 | Freshwater | MARWTASAKWAEGPALDGQCATPLGLSLSEGLGSTGWTLKAR |
| Ga0105046_108998492 | 3300009084 | Freshwater | MVRWTASAKWAAGPALDGQRDMPLALRLSEGLGLSAQEIEAA |
| Ga0105046_109248721 | 3300009084 | Freshwater | RWTASAKWAAGPALDGQRDMPLALRLSEGLGISAAQGT* |
| Ga0105046_109607031 | 3300009084 | Freshwater | MARWTASAKWGAAPALDGQCDMPLALRLSEGLGLN |
| Ga0105046_109667501 | 3300009084 | Freshwater | MARWTASAEWAAGPALDGQRDMPLALRLSEGLGLARR |
| Ga0105046_110762411 | 3300009084 | Freshwater | AGDDGMARWTASAKWAAGPALDGQRDMPLALRLSEGLGLSGMK* |
| Ga0105046_111098361 | 3300009084 | Freshwater | MARWTASAKWAEGPALDGQRDMPLALRLSEGLGVTAVPNTR |
| Ga0105046_111361501 | 3300009084 | Freshwater | DGMARWTASAKWAAGPALDGQRDMPLALRLSEGLGVSST* |
| Ga0105046_113123422 | 3300009084 | Freshwater | MARWTASAKWAEGPALDGQRAMPLALRLSEGLGLTCAT |
| Ga0105046_113546261 | 3300009084 | Freshwater | MARWTASAKWAEGPALDGQRDMPLALRLSEGLGHIARKSMKRVL* |
| Ga0105046_115178411 | 3300009084 | Freshwater | AGDDGVARWTASAKWAAGPALDGQRATPLALSLSEVLGHAP* |
| Ga0123338_101126012 | 3300009686 | Glacier Valley | VARWTASAKWAAGPALDGQRATPLGLGLNEGLGVIAV |
| Ga0123338_103384052 | 3300009686 | Glacier Valley | GTDGVARWTASAKWAAGPALDGQRATPLGLGLNEGLGVIAV* |
| Ga0136636_100804701 | 3300012044 | Polar Desert Sand | DGMARWTTSAKWAAGPALDGQRDMPLALRLSEGLGISVPLLCT* |
| Ga0136636_101470534 | 3300012044 | Polar Desert Sand | MARWTASAKWAGGPALDGRRDMPLALRLSEGLGVDE |
| Ga0136636_102166771 | 3300012044 | Polar Desert Sand | WTASAKWAEGPALDGQRAMPLALRLSEGLGLTRFAAQ* |
| Ga0136636_102256622 | 3300012044 | Polar Desert Sand | RWAASAKWAAGPALDDRRVLPLALRLSEGLGLAGLK* |
| Ga0136636_102545561 | 3300012044 | Polar Desert Sand | MARWTASAKWAEGPALDGRRGLPLALRLSEGLGVTATSRTDG |
| Ga0136636_102576781 | 3300012044 | Polar Desert Sand | MARWTACAKWAAGPALDGQRDMPLALRLSEGLGISF |
| Ga0136636_102644571 | 3300012044 | Polar Desert Sand | MARWTASAKWAAGPALDGQRDMPLALRLSEGLGISEFT |
| Ga0136636_102783512 | 3300012044 | Polar Desert Sand | MARWTASAKWAAGPALDGQRDMPLALRLSEGLGSTRR |
| Ga0136636_102818341 | 3300012044 | Polar Desert Sand | DGMARWPASAKWAAGPALAGQRDMPLALRLSEGLGRNA* |
| Ga0136636_102860292 | 3300012044 | Polar Desert Sand | WTASAKWAAGPALDGQRGMPLALRLSEGLGLAAAIATMH* |
| Ga0136636_102948652 | 3300012044 | Polar Desert Sand | MARWTASAKWAAGPALDGQRDMPLALRLSEGLGVNARG |
| Ga0136636_103045791 | 3300012044 | Polar Desert Sand | MSRWTASAKWGAAPALDGQCDMPLALRLSEGLGLNAELARWN |
| Ga0136636_103244091 | 3300012044 | Polar Desert Sand | MARWKASAKCAAGPALDGQRDIPLALRLSEGLGSTF |
| Ga0136636_103401302 | 3300012044 | Polar Desert Sand | MARWTGSAKWAAGPALDGQRDMPLALRLSEGLGISARG |
| Ga0136636_103636622 | 3300012044 | Polar Desert Sand | ARWTASAKWAVGPALDGQRDVPLALRLSEGLGVTVLC* |
| Ga0136636_103646171 | 3300012044 | Polar Desert Sand | MARWTASAKWAVGPALDGERDMPLALRLSEGLGLSSRSHHCEQCFA |
| Ga0136636_103824802 | 3300012044 | Polar Desert Sand | GNDGMARWAASAKWATGPALDGQRAMPLALRLSEW* |
| Ga0136636_104189851 | 3300012044 | Polar Desert Sand | WAASAKWAKGPALDGQRDLPLALRLSEGLGRAGGAAT* |
| Ga0136636_104247082 | 3300012044 | Polar Desert Sand | MARWTASAKWAAGPALDGQRDMPLALRLSEGLGRI |
| Ga0136636_104394271 | 3300012044 | Polar Desert Sand | GMSRWTASAKWAAGPALDGQRDMPLALRLSEGLGIVTAMRA* |
| Ga0136636_104697212 | 3300012044 | Polar Desert Sand | DGMARWTASAKWAAGPALDGQRDMPLARRLSEGLGLTVNH* |
| Ga0136636_105092742 | 3300012044 | Polar Desert Sand | VARWTASAKWAAGPALDGQRDMPLALRLSEGLGISLGA |
| Ga0138288_10568321 | 3300012761 | Freshwater Lake | VARWAASAKWAAGPALDDQCATPLGLSLSEGLGIAL |
| Ga0136639_102983411 | 3300013097 | Polar Desert Sand | MARWTASAKWAEGPALDGQRDMPLALRLSEGLGIS |
| Ga0163144_103896112 | 3300015360 | Freshwater Microbial Mat | MARWKASAKWAAGPALDGQRDMPLALRLSEGLGISARDV* |
| Ga0163144_104394081 | 3300015360 | Freshwater Microbial Mat | GVARWTASAKWAEGPALDGQRDTPLALSLSEVLGRTAAC* |
| Ga0163144_109491402 | 3300015360 | Freshwater Microbial Mat | MARWTASAKCAEGPALDGQRDMPLALRLSEGLGSTAH |
| Ga0163144_114559271 | 3300015360 | Freshwater Microbial Mat | VGDDGMARWTASAKWAAGPALDGQRDMPLALRLSE |
| Ga0163144_114694521 | 3300015360 | Freshwater Microbial Mat | MVRWTASAKWAAGPALDGQRDMPLALRLSEGLGLSARAARWF |
| Ga0163151_102778962 | 3300020057 | Freshwater Microbial Mat | MPRWPASAKWAEGPALDGQRGMLLSLRLSEGLGFNTV |
| Ga0163155_102047062 | 3300020180 | Freshwater Microbial Mat | MARWTASAKWAAGPALVGQRDMPLALRLSEGLGRCGIQ |
| Ga0163147_105705301 | 3300020192 | Freshwater Microbial Mat | SGMARWTASAKWAAGPALDGQRDMPLALRLSEVLGIAAPRPKKTI |
| Ga0163154_101382943 | 3300020201 | Freshwater Microbial Mat | TRRTASAKWGEAPALDGRRGLPLALRLSEGLGRTGVL |
| Ga0163154_102132671 | 3300020201 | Freshwater Microbial Mat | MSRWTASAEWAAGPALDGQRDMPLALRLSEGLGLN |
| Ga0163154_103428342 | 3300020201 | Freshwater Microbial Mat | MSRWTASAKWAEGPALDGQRDMPLALRLSEGLGSTAHC |
| Ga0163154_104436692 | 3300020201 | Freshwater Microbial Mat | MARWTASAKWAAGPALAVQRDMPLALRLSEGLGVT |
| Ga0163148_103210021 | 3300020203 | Freshwater Microbial Mat | MARWTASAKWAVGPALDGQRDMPLALRLSEGLGVTAGEACMKGTW |
| Ga0163148_103547171 | 3300020203 | Freshwater Microbial Mat | MARWTASAKWAEGPALDGQRDMPLALRLSEGLGLAQA |
| Ga0163148_103957272 | 3300020203 | Freshwater Microbial Mat | DGMARWTASAKWAAGPALDGQRDMPLALRLSEGLGLSGHR |
| Ga0163146_103911532 | 3300020219 | Freshwater Microbial Mat | VARWTASAKWAEGPALDGQRDMPLALRLSEGLGPTGHHST |
| Ga0163146_104237061 | 3300020219 | Freshwater Microbial Mat | NGMARWTASAKWAAGPALDGQRDMPLALRLSEGLDITALATVPE |
| Ga0163146_105602241 | 3300020219 | Freshwater Microbial Mat | GDDGMARWTASAKWAAGPALDGQRDMPLALRLSEGLGLSGHR |
| Ga0163146_106020421 | 3300020219 | Freshwater Microbial Mat | MARWTASAKWAEGPALDGQRDMPLALRLSKGLGRTAR |
| Ga0163149_104560002 | 3300020596 | Freshwater Microbial Mat | GMARWTASAKWAEGPALDGQRDMPLALRLSEGLGLSGHR |
| Ga0163149_105579982 | 3300020596 | Freshwater Microbial Mat | MARWTASAKWAEGPALDGQRAMPLALRLSEGLGLAAAIAKMH |
| Ga0226658_105185712 | 3300022222 | Freshwater Microbial Mat | MARWAASAKWAAGPALDDRCAMPLALRLSEGLGSTRGTATMLE |
| Ga0209490_101404601 | 3300027823 | Freshwater | ARWTASAKWAEGPALDGQRDMPLALRLSEGLGICARSFARRNDKE |
| Ga0209490_101637422 | 3300027823 | Freshwater | MARWTASAKWAAGPALDGQCDMPLALRLSEGLGLTCATNMS |
| Ga0209490_102344592 | 3300027823 | Freshwater | MARWTASAKWAEGPALDGQRDMPLALRLSEGLGLAALG |
| Ga0209490_102626871 | 3300027823 | Freshwater | RWAASAKWAAGPALDGQRDMPLALRLSEGLGRNLRSE |
| Ga0209490_103022282 | 3300027823 | Freshwater | DGMARWAASAKWAAGPALDGQRDMPLALRLSEGLGIAGAAGDV |
| Ga0209490_103546303 | 3300027823 | Freshwater | RWTASAKWAAGPALDGQRDMPLALRLSEGLGVTCDTATHL |
| Ga0209591_100351051 | 3300027850 | Freshwater | GMARWTASAKWAEGPALDGQRDMPLALRLSEGLGRSATAA |
| Ga0209591_100981672 | 3300027850 | Freshwater | MARWTASAKWAEGPALDGQRDMPLALRLSEGLGIRAALQLRDL |
| Ga0209591_102426303 | 3300027850 | Freshwater | MARWTASAKWAAGPALDGQRDMPLALRLSEGLGRTF |
| Ga0209591_102577821 | 3300027850 | Freshwater | MARWTASAKWAAGPALDGQRDMPLALRLSEGLGSTGLSLG |
| Ga0209591_102842572 | 3300027850 | Freshwater | MARWTVSAKWAAGPALDGQRDMPLALRLSEGLGVTVLC |
| Ga0209591_103564451 | 3300027850 | Freshwater | MARWTASAKWAEGPALDGQRAMPLALRLSEGLGLIRAA |
| Ga0209591_103613991 | 3300027850 | Freshwater | DGMARWTASAKWAAGPALDGQCDMPLALRLSEGLGLTEHYFERAFLRAP |
| Ga0209591_104126872 | 3300027850 | Freshwater | DGMARWTASAKWAAGPALDGQRDMPLALRLSEVLGPARATA |
| Ga0209591_104278802 | 3300027850 | Freshwater | MARWTASAKWAAGPALDGRRETPLALRLSEGLGLATLGPL |
| Ga0209591_105045872 | 3300027850 | Freshwater | GDNGMARWTASAKWAAGPALDGQRDMPLALRLSEGLGVTAR |
| Ga0209591_105162521 | 3300027850 | Freshwater | MACWTASAKWAAGPALDGQRDMPLALRLSEGLGSTALFLG |
| Ga0209591_105753282 | 3300027850 | Freshwater | AGDDGMARWTASAKWSEGPALDGQRDMPLALRLSEGLGLAALG |
| Ga0209591_106129582 | 3300027850 | Freshwater | MARWTASAKWAEGPALDGQRDMPLALRLSEGLGLSFTLL |
| Ga0209591_106418591 | 3300027850 | Freshwater | RWTASAKWAAGPALDGQRDMPLALRLSEGLGLTVNH |
| Ga0209591_106594502 | 3300027850 | Freshwater | WTASAKWAAGPALDGQRDMPLALRLSEGLGLSALRMVTTG |
| Ga0209591_107166461 | 3300027850 | Freshwater | DDGMSRWTASAKWAEGPALDGQRDMPLALRLSEGLGSTRGNAKLRTSSL |
| Ga0209591_108057142 | 3300027850 | Freshwater | DDGMARWTASAKWAAGPALDGQRDMPLALRLSEGLGSTALLLG |
| Ga0209591_108409331 | 3300027850 | Freshwater | DGMARWTASAKWAEGPALDGRRDMPLALRLSEGLGLFRGSKRPP |
| Ga0209181_101251401 | 3300027878 | Freshwater | DDGMARWTASAKWAEGPALDGQCDMPLALRLSEGLGISSP |
| Ga0209181_101335141 | 3300027878 | Freshwater | RWTASAKWAAGPALDGQRDMPLALRLSEGLGVTLWSPA |
| Ga0209181_101560982 | 3300027878 | Freshwater | MARWTASAKWAAGAALDGQRDMPLALRLSEGLGISAGGM |
| Ga0209181_102313701 | 3300027878 | Freshwater | DDGMARWTASAKWAAGPALDGQRDMPLALRLSEGLGISAF |
| Ga0209181_102582933 | 3300027878 | Freshwater | GMARWTASAKWGAAPALDGQCDMPLALRLSEGLGLTL |
| Ga0209181_103794931 | 3300027878 | Freshwater | WTASAKWAEGPALDGQCAMPLALRLSEGLGRSATAT |
| Ga0209181_104291221 | 3300027878 | Freshwater | ARWTASAKWAAGPALDGQRDMPLALRLSEGLGVFGS |
| Ga0209181_104794212 | 3300027878 | Freshwater | AGDDGMARWTASAKWAAGPALDGQCDMPLALRLSEGLGLRRAIG |
| Ga0209181_104919033 | 3300027878 | Freshwater | GDDGMARWTASAKWAEGPALDGRRDMPLALRLSEGLGVTAATAEFLCPLY |
| Ga0209181_105180941 | 3300027878 | Freshwater | ARWTASAKWAAGPALDGQRDMPLALRLSEGLGVTGHALA |
| Ga0209181_106100652 | 3300027878 | Freshwater | MARWPASAKWGEAPALDGQCDMPLALRLSEGLGLSA |
| Ga0209181_106895002 | 3300027878 | Freshwater | MARWTASAKWAAGPALDGQRDMPLALRLSEGLNQA |
| Ga0209181_110545102 | 3300027878 | Freshwater | TASAKWAAGPALDGQRDMPLALRLSEGLGVAVFTQDWI |
| Ga0209181_110644062 | 3300027878 | Freshwater | MARWTASAKWAAGPALDGQRDMPLALRLREGLGHAAQMLT |
| Ga0335397_100482294 | 3300032420 | Freshwater | MARWTESAKWAAGPALDGQRDMPLALRLSEGLGLSGHR |
| Ga0335397_101898781 | 3300032420 | Freshwater | MARWTASAKWAEGPALDGQRDIPLALRLSEGLGSTAHCG |
| Ga0335397_102667241 | 3300032420 | Freshwater | ARWTASAKWAAGPALDGQRDMPLALRLSEGLGVTAIATMTRR |
| Ga0335397_103145991 | 3300032420 | Freshwater | MARWTASAKWAAGPALDGQRDMPLALRLSEGLGVFE |
| Ga0335397_103785342 | 3300032420 | Freshwater | ASAKWAAGPALDGQRDMPLALRLSEGLGRTVAGVPA |
| Ga0335397_104270981 | 3300032420 | Freshwater | DDGMARWTASAKWAAGLALDGQRDMPLALRLSEGLGVFTRVGRLE |
| Ga0335397_104367281 | 3300032420 | Freshwater | MARWKASAKWAAGPALDGQCDMPLALRLSEGLGVTCANVAI |
| Ga0335397_104514803 | 3300032420 | Freshwater | MARWTASAKWDAGPALDGQRDMPLALRLSERLGIS |
| Ga0335397_104999862 | 3300032420 | Freshwater | GMARWTASAKWAEGPALDGQRDMPLALRLSEGLGRTGE |
| Ga0335397_105031672 | 3300032420 | Freshwater | RWTASAKWGEAPALDGQRDMPLALRLSEGLGRDVSI |
| Ga0335397_105482152 | 3300032420 | Freshwater | MARWPSSAKWAAGPALDGQRDMPLALRLSEGLGSTRRAQM |
| Ga0335397_105798152 | 3300032420 | Freshwater | AGDDGMARWTASAKWAAGPALDGQRDMPLALRLSEGLGLSGMK |
| Ga0335397_105834433 | 3300032420 | Freshwater | WTASAKWAAGPALDGQRDMPLALRLSEGLGVTGHALA |
| Ga0335397_106062292 | 3300032420 | Freshwater | MARWTASAKWAAGPALDGQCDMPLSLRLSEGLGVT |
| Ga0335397_106411491 | 3300032420 | Freshwater | ASAKWAAGPALDGQRDMPLALRLSEGLGRTAQYLQD |
| Ga0335397_106451961 | 3300032420 | Freshwater | ASAKWAEGPALDGQRDMPLALRLSEGLGLNATIRMLP |
| Ga0335397_106626372 | 3300032420 | Freshwater | GDDGMARWTASAKWAAGPALDGQRDMPLALRLSEGLGLTGLASRLG |
| Ga0335397_106855742 | 3300032420 | Freshwater | MARWTASAKWAEGPALDGQRDMPLALRLSEGLGSTASGAQVTA |
| Ga0335397_106963901 | 3300032420 | Freshwater | WTASAKWAAGPALDGQRDMPLALRLSEGLGRIGTLLPQLY |
| Ga0335397_106992641 | 3300032420 | Freshwater | AGDDGMARWTASAKWAAGPALDGQRDMPLALRLSEGLGLTAWAG |
| Ga0335397_107695541 | 3300032420 | Freshwater | GMARWTASAKWAAGPALDGQCDMPLVLRLSEGLGAT |
| Ga0335397_108225371 | 3300032420 | Freshwater | MVRWTASAKWGAAPALDGQCDMPLALRLSEGLGLNAELA |
| Ga0335397_108692101 | 3300032420 | Freshwater | DKGRARWTANAKWAAGPALDGQRAMPLSLRLSEGLGRTSD |
| Ga0335397_109195081 | 3300032420 | Freshwater | MARWTASAKWAAGPALDGQCDMPLALRLSEGLGVSAR |
| Ga0335397_109493532 | 3300032420 | Freshwater | RWTASAKWAEGPALDGQCAMPLALRLNEGLDLTRDLS |
| Ga0335397_110548681 | 3300032420 | Freshwater | RWTASAKWAAGPALDGQRDMPLALRLSEGLGVTAKIVGSLCG |
| Ga0335395_100125368 | 3300032431 | Freshwater | MARWTASAKWAAGPALDGQRDMPLALRLSEGLGLVKKQ |
| Ga0335395_100273158 | 3300032431 | Freshwater | MARWTASAKWAAGPALEGQRDMPLALRLSEGLGRIPAEEREFVDAY |
| Ga0335395_101177313 | 3300032431 | Freshwater | MARWTASAKWAEGPALDGQRDMPLALRLSEGLGICARSFARRNDKE |
| Ga0335395_101271123 | 3300032431 | Freshwater | MARWTASAKWAEGPALDGQRDMPLALRLSEGLGLGFRNTN |
| Ga0335395_101503381 | 3300032431 | Freshwater | MARWAASAKWAEGPALDGQRAMPLALRLSEGLGLAAAIAK |
| Ga0335395_101575294 | 3300032431 | Freshwater | SAKWAAGPALDGQRAMPLTLRLSEGLGISLARCCVCEI |
| Ga0335395_101876151 | 3300032431 | Freshwater | GLARWTASAKWVAGPALDGQRDMPLALRLSEGLGLS |
| Ga0335395_102163671 | 3300032431 | Freshwater | MARWTASAKWAAGPALDGQRDMPLALRLSEGLGISEFTA |
| Ga0335395_102396303 | 3300032431 | Freshwater | AGDDGMARWTASAKWAAGPALDGQRDMPLALRLSEGLGLTVNH |
| Ga0335395_103119171 | 3300032431 | Freshwater | GMARWTASAKWAAGPALDGQRDMPLALRLSEGLGVFTRVGRLE |
| Ga0335395_103136481 | 3300032431 | Freshwater | GDDGMARWTASAKWAAGPALDGQRDMPLALRLSEGLGLTAR |
| Ga0335395_103388451 | 3300032431 | Freshwater | GMARWAASAKWAAGPALDGQRDMPLALRLSEGLGIAGAAGDV |
| Ga0335395_103684723 | 3300032431 | Freshwater | MARWTASAKWAEGPALDGQCDMPLALRLSEGLGSTAAGS |
| Ga0335395_104084851 | 3300032431 | Freshwater | SGMARWTASAKWAAGPALDGQRDMPLALRLSEGLGVFE |
| Ga0335395_104321391 | 3300032431 | Freshwater | MARWTASAKWAEGPALDGQCDMPLALRLSEGLGLS |
| Ga0335395_104716072 | 3300032431 | Freshwater | MARWTASTKWAAGPALDGQRDMPLALRLSEGLGIRAALQL |
| Ga0335395_104739772 | 3300032431 | Freshwater | MARWTASAKWAEGSALDGQRDMPLALRLSEGLGLSGP |
| Ga0335395_105343641 | 3300032431 | Freshwater | ARWTASAKWAAGPALDGQCDVPLALRLSEGLGLIALLIRHGIVQACR |
| Ga0335395_105418631 | 3300032431 | Freshwater | MARWTASAKWAEGPALEGQRAMPLALRLSEGLGLTAQNG |
| Ga0335395_105653701 | 3300032431 | Freshwater | MARWTASAKWAAGPALDGQRGMPLALRLSEGLGVFAKP |
| Ga0335395_105683921 | 3300032431 | Freshwater | MARWTASAKWAEGPALDGQRDMPLALRLSEGLGRAGGAAT |
| Ga0335395_105774191 | 3300032431 | Freshwater | MARWTASARWAAGPALDGQRAMPLALRLSEGLGLAAAIATM |
| Ga0335395_105940521 | 3300032431 | Freshwater | ARWTASAKWAAGPALDGQRDMPLALRLSEGLGSTGWTLKARD |
| Ga0335395_106273661 | 3300032431 | Freshwater | MARWTARAKWAEGPALDGQRDMPLALRLSEGLGLAGY |
| Ga0335395_106363112 | 3300032431 | Freshwater | MAHWTASAKWAAGPALDGQCAMPLALRLSEGLGLAV |
| Ga0335395_106745933 | 3300032431 | Freshwater | MARWTSSAKWAAGPALDGQRDMPLALRLSEGLGISV |
| Ga0335395_106845731 | 3300032431 | Freshwater | RWAASAKWAAGPALDGQRDMPFALRLSEGLGVTGR |
| Ga0335395_106961792 | 3300032431 | Freshwater | MARWTASAKWAAGPALGGQRDMPLALRLSEGLGSTR |
| Ga0335395_107471801 | 3300032431 | Freshwater | MARWPASAKWAAGPALDGQRDMPLALRLSEGLGSTCGNAK |
| Ga0335395_107625981 | 3300032431 | Freshwater | MARWTASAKWAAGPALDGQRDMPLALRLSEGLGIRAALQL |
| Ga0335395_108013782 | 3300032431 | Freshwater | TRWTASAKWAAGPALDGRRGLPLALRLSEGLGLAAR |
| Ga0335395_108336341 | 3300032431 | Freshwater | ARWTASAKWAEGPALDGQRDMPLALRLSEGLGLAAR |
| Ga0335395_108999861 | 3300032431 | Freshwater | MARWTASAKWAEGPALDGRRDMPLALRLSEGLGLACATNMS |
| Ga0335394_100793076 | 3300032456 | Freshwater | MARWTASAKCAAGPALDGQRDMPLALRLSEGIGLSG |
| Ga0335394_102351143 | 3300032456 | Freshwater | MARWTASAKWGEAPALDGKRDMPLALRLSEGLGVTGHRRD |
| Ga0335394_102666981 | 3300032456 | Freshwater | MARWIASAKWAEGPALDGQRDMPLALRLSEGLGVAFV |
| Ga0335394_102742181 | 3300032456 | Freshwater | MARWTASAKWAVGPALDGQRDMPLALRLSEGLGLN |
| Ga0335394_103370582 | 3300032456 | Freshwater | MARWTASAKLAAGPALDGQRDMPLALRLSEGLGIRAAL |
| Ga0335394_104027993 | 3300032456 | Freshwater | RWTASAKWAEGPALDGQRDMPLALRLSEGLGVAVAQNPKC |
| Ga0335394_104206681 | 3300032456 | Freshwater | MARWAASAKWAAGPALDGQRDMPLALRLSEGLGVTGLRR |
| Ga0335394_104551861 | 3300032456 | Freshwater | RWTASAKWAAGPALDGQRDMPLALRLSEGLGIRALRL |
| Ga0335394_104761771 | 3300032456 | Freshwater | MARWTASAKWAAGPALDGQCAMPLALRLSEGLGVTGV |
| Ga0335394_105091742 | 3300032456 | Freshwater | MARWTESAKWAVGPALDGQRDMPLALRLSEGLGISF |
| Ga0335394_105530621 | 3300032456 | Freshwater | WTASAKWAAGPALDGQRDMPLALRLSEGLGVTCDTATHL |
| Ga0335394_105767912 | 3300032456 | Freshwater | ARWTASAKWAAGPALDGQRDMPLALRLSEGLGLSGIG |
| Ga0335394_106299852 | 3300032456 | Freshwater | ARWTASAKWAAGPALDGQRDMPLALRLSEGLGLCGQVLRE |
| Ga0335394_106702423 | 3300032456 | Freshwater | MARWTASARWAAGPALDGQRDMPLALRLSEGLGLTC |
| Ga0335394_107110072 | 3300032456 | Freshwater | MAHWTASAKWAAGPALDGQCDMPLALRLSEGLGLNCSA |
| Ga0335394_107384062 | 3300032456 | Freshwater | WTASAKWAAGPALDGQRDMPLALRLSEGLGVTVRVAMNELQISST |
| Ga0335394_107486471 | 3300032456 | Freshwater | DDGMARWTASAKWAAGPALDGQRDMPLALRLSEGLGVTRAH |
| Ga0335394_107706881 | 3300032456 | Freshwater | MARWTASAKWAAGPALDGQREMPLALRLSEGLGLMARALLRTNI |
| Ga0335394_108189292 | 3300032456 | Freshwater | MARWTASAKYAEGPAFGGERDMPLAQRLSDGLGLA |
| Ga0335394_108277432 | 3300032456 | Freshwater | RWTASAKWAEGPALDGQRDMPLALRLSEGLGLSCAEF |
| Ga0335394_108466072 | 3300032456 | Freshwater | MARWPSSAKWAAGPALDGQRAMPLALRLSEVLGPARATA |
| Ga0335394_109843242 | 3300032456 | Freshwater | WTARAKWAAGPALDGQRDMPLALRLSEGLGRSFRLGIR |
| Ga0335394_110219571 | 3300032456 | Freshwater | MARWTASAEWAAGPALDGQCDMPLALRLSEVLGLTRPGP |
| Ga0335394_110659651 | 3300032456 | Freshwater | MARWTASAKWAAGPALDGQCDMPLALRLSEGLGLGLLNYA |
| Ga0335394_111133331 | 3300032456 | Freshwater | DDGVARWAAGAKWAAGPAPDGQRDVPLALRLSEGLGVI |
| Ga0335394_111322002 | 3300032456 | Freshwater | MARWTASAKWAAGPALDGQRDMPLALRLSEGLGVA |
| ⦗Top⦘ |