| Basic Information | |
|---|---|
| Family ID | F007618 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 348 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MPLAPAITDLEQLKNHPAVARLLAWNPAAVQGVKFDREEM |
| Number of Associated Samples | 276 |
| Number of Associated Scaffolds | 348 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 93.88 % |
| % of genes near scaffold ends (potentially truncated) | 96.84 % |
| % of genes from short scaffolds (< 2000 bps) | 90.23 % |
| Associated GOLD sequencing projects | 263 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (52.299 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (9.770 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.126 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.161 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.00% β-sheet: 0.00% Coil/Unstructured: 75.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 348 Family Scaffolds |
|---|---|---|
| PF00507 | Oxidored_q4 | 91.38 |
| PF02597 | ThiS | 2.59 |
| PF13411 | MerR_1 | 1.44 |
| PF10502 | Peptidase_S26 | 0.57 |
| PF01541 | GIY-YIG | 0.29 |
| PF07690 | MFS_1 | 0.29 |
| PF00329 | Complex1_30kDa | 0.29 |
| PF02504 | FA_synthesis | 0.29 |
| PF09900 | DUF2127 | 0.29 |
| PF01435 | Peptidase_M48 | 0.29 |
| PF02515 | CoA_transf_3 | 0.29 |
| PF13360 | PQQ_2 | 0.29 |
| PF00926 | DHBP_synthase | 0.29 |
| PF00782 | DSPc | 0.29 |
| PF01618 | MotA_ExbB | 0.29 |
| PF12833 | HTH_18 | 0.29 |
| COG ID | Name | Functional Category | % Frequency in 348 Family Scaffolds |
|---|---|---|---|
| COG0838 | NADH:ubiquinone oxidoreductase subunit 3 (chain A) | Energy production and conversion [C] | 91.38 |
| COG1977 | Molybdopterin synthase sulfur carrier subunit MoaD | Coenzyme transport and metabolism [H] | 2.59 |
| COG2104 | Sulfur carrier protein ThiS (thiamine biosynthesis) | Coenzyme transport and metabolism [H] | 2.59 |
| COG0108 | 3,4-dihydroxy-2-butanone 4-phosphate synthase | Coenzyme transport and metabolism [H] | 0.29 |
| COG0416 | Acyl-ACP:phosphate acyltransferase (fatty acid/phospholipid biosynthesis) | Lipid transport and metabolism [I] | 0.29 |
| COG0852 | NADH:ubiquinone oxidoreductase 27 kD subunit (chain C) | Energy production and conversion [C] | 0.29 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.29 |
| COG3262 | Ni,Fe-hydrogenase III component G | Energy production and conversion [C] | 0.29 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 52.30 % |
| Unclassified | root | N/A | 47.70 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908006|FWIROz_GJ87FRN02IKR15 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 514 | Open in IMG/M |
| 2170459014|G1P06HT02HO601 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 662 | Open in IMG/M |
| 3300000579|AP72_2010_repI_A01DRAFT_1013720 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1258 | Open in IMG/M |
| 3300001991|JGI24743J22301_10005309 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2144 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100249057 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1665 | Open in IMG/M |
| 3300002909|JGI25388J43891_1044087 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 675 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10375761 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 577 | Open in IMG/M |
| 3300004080|Ga0062385_10413634 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 810 | Open in IMG/M |
| 3300004080|Ga0062385_11064366 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 546 | Open in IMG/M |
| 3300004092|Ga0062389_104296464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 536 | Open in IMG/M |
| 3300004092|Ga0062389_104870835 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 506 | Open in IMG/M |
| 3300004152|Ga0062386_100257001 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1385 | Open in IMG/M |
| 3300004156|Ga0062589_101539394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 656 | Open in IMG/M |
| 3300004633|Ga0066395_10172152 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1114 | Open in IMG/M |
| 3300004972|Ga0072325_1238444 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 509 | Open in IMG/M |
| 3300005167|Ga0066672_10953121 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 527 | Open in IMG/M |
| 3300005171|Ga0066677_10368600 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 822 | Open in IMG/M |
| 3300005171|Ga0066677_10709961 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 562 | Open in IMG/M |
| 3300005172|Ga0066683_10336434 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 938 | Open in IMG/M |
| 3300005174|Ga0066680_10087473 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1887 | Open in IMG/M |
| 3300005332|Ga0066388_102849107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 884 | Open in IMG/M |
| 3300005434|Ga0070709_10456094 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 964 | Open in IMG/M |
| 3300005436|Ga0070713_100756141 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 930 | Open in IMG/M |
| 3300005445|Ga0070708_101996827 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 537 | Open in IMG/M |
| 3300005468|Ga0070707_101995834 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 548 | Open in IMG/M |
| 3300005533|Ga0070734_10546035 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 660 | Open in IMG/M |
| 3300005534|Ga0070735_10872755 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 529 | Open in IMG/M |
| 3300005536|Ga0070697_100532200 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1030 | Open in IMG/M |
| 3300005537|Ga0070730_10316589 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1020 | Open in IMG/M |
| 3300005541|Ga0070733_10420363 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 890 | Open in IMG/M |
| 3300005541|Ga0070733_10538952 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 781 | Open in IMG/M |
| 3300005541|Ga0070733_10759657 | Not Available | 651 | Open in IMG/M |
| 3300005542|Ga0070732_10887617 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 545 | Open in IMG/M |
| 3300005542|Ga0070732_11003312 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 511 | Open in IMG/M |
| 3300005543|Ga0070672_100253684 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1482 | Open in IMG/M |
| 3300005552|Ga0066701_10314855 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 970 | Open in IMG/M |
| 3300005561|Ga0066699_10223560 | All Organisms → cellular organisms → Bacteria | 1320 | Open in IMG/M |
| 3300005563|Ga0068855_101892220 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 604 | Open in IMG/M |
| 3300005568|Ga0066703_10055353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2233 | Open in IMG/M |
| 3300005568|Ga0066703_10347029 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 892 | Open in IMG/M |
| 3300005569|Ga0066705_10890529 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 528 | Open in IMG/M |
| 3300005576|Ga0066708_10648060 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 673 | Open in IMG/M |
| 3300005578|Ga0068854_100421223 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1109 | Open in IMG/M |
| 3300005591|Ga0070761_10980760 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 536 | Open in IMG/M |
| 3300005712|Ga0070764_10150706 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1278 | Open in IMG/M |
| 3300005712|Ga0070764_10273018 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 969 | Open in IMG/M |
| 3300005921|Ga0070766_10313866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1010 | Open in IMG/M |
| 3300005950|Ga0066787_10046059 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 828 | Open in IMG/M |
| 3300006034|Ga0066656_11001764 | Not Available | 536 | Open in IMG/M |
| 3300006050|Ga0075028_100156516 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1207 | Open in IMG/M |
| 3300006052|Ga0075029_100788310 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 646 | Open in IMG/M |
| 3300006052|Ga0075029_101100762 | Not Available | 552 | Open in IMG/M |
| 3300006162|Ga0075030_101585852 | Not Available | 512 | Open in IMG/M |
| 3300006163|Ga0070715_10222029 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 972 | Open in IMG/M |
| 3300006172|Ga0075018_10413854 | Not Available | 688 | Open in IMG/M |
| 3300006175|Ga0070712_100854666 | Not Available | 783 | Open in IMG/M |
| 3300006175|Ga0070712_101849253 | Not Available | 529 | Open in IMG/M |
| 3300006176|Ga0070765_100980425 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 799 | Open in IMG/M |
| 3300006176|Ga0070765_100983539 | Not Available | 798 | Open in IMG/M |
| 3300006358|Ga0068871_102311619 | Not Available | 513 | Open in IMG/M |
| 3300006797|Ga0066659_11450764 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300006854|Ga0075425_101648279 | Not Available | 722 | Open in IMG/M |
| 3300006854|Ga0075425_103109136 | Not Available | 506 | Open in IMG/M |
| 3300006893|Ga0073928_10331090 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1134 | Open in IMG/M |
| 3300006893|Ga0073928_11016388 | Not Available | 564 | Open in IMG/M |
| 3300006914|Ga0075436_101328631 | Not Available | 544 | Open in IMG/M |
| 3300007004|Ga0079218_13335017 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300007076|Ga0075435_100984751 | Not Available | 736 | Open in IMG/M |
| 3300009012|Ga0066710_102394752 | Not Available | 766 | Open in IMG/M |
| 3300009038|Ga0099829_10114167 | All Organisms → cellular organisms → Bacteria | 2118 | Open in IMG/M |
| 3300009038|Ga0099829_11242244 | Not Available | 617 | Open in IMG/M |
| 3300009088|Ga0099830_10971084 | Not Available | 703 | Open in IMG/M |
| 3300009089|Ga0099828_10482408 | Not Available | 1118 | Open in IMG/M |
| 3300009093|Ga0105240_10148511 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2794 | Open in IMG/M |
| 3300009101|Ga0105247_10387730 | Not Available | 992 | Open in IMG/M |
| 3300009137|Ga0066709_100287886 | All Organisms → cellular organisms → Bacteria | 2224 | Open in IMG/M |
| 3300009177|Ga0105248_10915271 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
| 3300009521|Ga0116222_1308551 | Not Available | 684 | Open in IMG/M |
| 3300009521|Ga0116222_1331795 | Not Available | 659 | Open in IMG/M |
| 3300009524|Ga0116225_1117247 | Not Available | 1227 | Open in IMG/M |
| 3300009525|Ga0116220_10175937 | Not Available | 923 | Open in IMG/M |
| 3300009525|Ga0116220_10604903 | Not Available | 504 | Open in IMG/M |
| 3300009545|Ga0105237_12116184 | Not Available | 572 | Open in IMG/M |
| 3300009551|Ga0105238_10077950 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3305 | Open in IMG/M |
| 3300009650|Ga0105857_1233207 | Not Available | 545 | Open in IMG/M |
| 3300009672|Ga0116215_1427158 | Not Available | 573 | Open in IMG/M |
| 3300009683|Ga0116224_10235420 | Not Available | 875 | Open in IMG/M |
| 3300009792|Ga0126374_10499956 | Not Available | 876 | Open in IMG/M |
| 3300009824|Ga0116219_10127790 | Not Available | 1476 | Open in IMG/M |
| 3300009839|Ga0116223_10907934 | Not Available | 502 | Open in IMG/M |
| 3300010048|Ga0126373_10092958 | All Organisms → cellular organisms → Bacteria | 2774 | Open in IMG/M |
| 3300010048|Ga0126373_10448508 | All Organisms → cellular organisms → Bacteria | 1324 | Open in IMG/M |
| 3300010048|Ga0126373_10867770 | Not Available | 966 | Open in IMG/M |
| 3300010159|Ga0099796_10164116 | Not Available | 882 | Open in IMG/M |
| 3300010303|Ga0134082_10348971 | Not Available | 626 | Open in IMG/M |
| 3300010339|Ga0074046_10176178 | Not Available | 1354 | Open in IMG/M |
| 3300010341|Ga0074045_10888133 | Not Available | 562 | Open in IMG/M |
| 3300010343|Ga0074044_10140770 | Not Available | 1616 | Open in IMG/M |
| 3300010343|Ga0074044_10718778 | Not Available | 652 | Open in IMG/M |
| 3300010360|Ga0126372_10610402 | Not Available | 1049 | Open in IMG/M |
| 3300010360|Ga0126372_11333382 | Not Available | 748 | Open in IMG/M |
| 3300010371|Ga0134125_10397547 | Not Available | 1528 | Open in IMG/M |
| 3300010375|Ga0105239_11474613 | Not Available | 786 | Open in IMG/M |
| 3300010376|Ga0126381_102632816 | Not Available | 720 | Open in IMG/M |
| 3300010379|Ga0136449_104316910 | Not Available | 525 | Open in IMG/M |
| 3300010396|Ga0134126_12816472 | Not Available | 527 | Open in IMG/M |
| 3300010403|Ga0134123_10004204 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 9385 | Open in IMG/M |
| 3300011084|Ga0138562_1043947 | Not Available | 550 | Open in IMG/M |
| 3300011085|Ga0138581_1180395 | Not Available | 536 | Open in IMG/M |
| 3300011087|Ga0138570_1072015 | Not Available | 543 | Open in IMG/M |
| 3300011120|Ga0150983_10978038 | Not Available | 541 | Open in IMG/M |
| 3300011120|Ga0150983_12131687 | Not Available | 537 | Open in IMG/M |
| 3300011120|Ga0150983_14075631 | Not Available | 537 | Open in IMG/M |
| 3300011120|Ga0150983_16326785 | Not Available | 502 | Open in IMG/M |
| 3300011269|Ga0137392_10105647 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2226 | Open in IMG/M |
| 3300011269|Ga0137392_10145651 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1908 | Open in IMG/M |
| 3300011269|Ga0137392_10807977 | Not Available | 774 | Open in IMG/M |
| 3300011270|Ga0137391_10027347 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4761 | Open in IMG/M |
| 3300011270|Ga0137391_10044495 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3771 | Open in IMG/M |
| 3300011270|Ga0137391_11374540 | Not Available | 552 | Open in IMG/M |
| 3300011271|Ga0137393_10342715 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1276 | Open in IMG/M |
| 3300012207|Ga0137381_11275254 | Not Available | 628 | Open in IMG/M |
| 3300012210|Ga0137378_11374902 | Not Available | 620 | Open in IMG/M |
| 3300012356|Ga0137371_10643949 | Not Available | 812 | Open in IMG/M |
| 3300012356|Ga0137371_11313198 | Not Available | 535 | Open in IMG/M |
| 3300012357|Ga0137384_10422653 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1099 | Open in IMG/M |
| 3300012469|Ga0150984_104340327 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300012532|Ga0137373_10867042 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 664 | Open in IMG/M |
| 3300012683|Ga0137398_10095539 | All Organisms → cellular organisms → Bacteria | 1860 | Open in IMG/M |
| 3300012917|Ga0137395_10770863 | Not Available | 696 | Open in IMG/M |
| 3300012918|Ga0137396_10748312 | Not Available | 720 | Open in IMG/M |
| 3300012922|Ga0137394_10596230 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 935 | Open in IMG/M |
| 3300012923|Ga0137359_11213987 | Not Available | 642 | Open in IMG/M |
| 3300012951|Ga0164300_11208284 | Not Available | 502 | Open in IMG/M |
| 3300012971|Ga0126369_10751901 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1055 | Open in IMG/M |
| 3300012971|Ga0126369_11063496 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 898 | Open in IMG/M |
| 3300012986|Ga0164304_10377546 | All Organisms → cellular organisms → Bacteria | 1000 | Open in IMG/M |
| 3300012987|Ga0164307_10370771 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1045 | Open in IMG/M |
| 3300013102|Ga0157371_10743415 | Not Available | 736 | Open in IMG/M |
| 3300014155|Ga0181524_10284709 | Not Available | 760 | Open in IMG/M |
| 3300014168|Ga0181534_10648332 | Not Available | 612 | Open in IMG/M |
| 3300014169|Ga0181531_10252926 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1075 | Open in IMG/M |
| 3300014493|Ga0182016_10479248 | Not Available | 723 | Open in IMG/M |
| 3300014501|Ga0182024_11783882 | Not Available | 689 | Open in IMG/M |
| 3300014969|Ga0157376_12383691 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 569 | Open in IMG/M |
| 3300015241|Ga0137418_10293525 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1362 | Open in IMG/M |
| 3300015242|Ga0137412_10630813 | Not Available | 807 | Open in IMG/M |
| 3300015357|Ga0134072_10170594 | Not Available | 732 | Open in IMG/M |
| 3300015371|Ga0132258_10351700 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3644 | Open in IMG/M |
| 3300016357|Ga0182032_10082549 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2213 | Open in IMG/M |
| 3300016404|Ga0182037_11368093 | Not Available | 625 | Open in IMG/M |
| 3300016404|Ga0182037_11604684 | Not Available | 578 | Open in IMG/M |
| 3300016422|Ga0182039_11765762 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 567 | Open in IMG/M |
| 3300016445|Ga0182038_10190715 | All Organisms → cellular organisms → Bacteria | 1604 | Open in IMG/M |
| 3300016445|Ga0182038_10745431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 856 | Open in IMG/M |
| 3300016700|Ga0181513_1295793 | Not Available | 540 | Open in IMG/M |
| 3300017924|Ga0187820_1158992 | Not Available | 685 | Open in IMG/M |
| 3300017930|Ga0187825_10190226 | Not Available | 736 | Open in IMG/M |
| 3300017933|Ga0187801_10413851 | Not Available | 562 | Open in IMG/M |
| 3300017936|Ga0187821_10447643 | Not Available | 535 | Open in IMG/M |
| 3300017959|Ga0187779_10039745 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2728 | Open in IMG/M |
| 3300017961|Ga0187778_10189684 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1307 | Open in IMG/M |
| 3300017970|Ga0187783_10140610 | All Organisms → cellular organisms → Bacteria | 1779 | Open in IMG/M |
| 3300017972|Ga0187781_11366145 | Not Available | 523 | Open in IMG/M |
| 3300017973|Ga0187780_10329435 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1076 | Open in IMG/M |
| 3300017974|Ga0187777_11067210 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 586 | Open in IMG/M |
| 3300018026|Ga0187857_10200585 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 931 | Open in IMG/M |
| 3300018034|Ga0187863_10124779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1439 | Open in IMG/M |
| 3300018038|Ga0187855_10629007 | Not Available | 625 | Open in IMG/M |
| 3300018085|Ga0187772_10400221 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300018085|Ga0187772_10535452 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 828 | Open in IMG/M |
| 3300018085|Ga0187772_11082110 | Not Available | 588 | Open in IMG/M |
| 3300018086|Ga0187769_11174718 | Not Available | 581 | Open in IMG/M |
| 3300018090|Ga0187770_10421876 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1049 | Open in IMG/M |
| 3300018468|Ga0066662_11285130 | Not Available | 748 | Open in IMG/M |
| 3300018482|Ga0066669_11133300 | Not Available | 706 | Open in IMG/M |
| 3300019278|Ga0187800_1417171 | Not Available | 548 | Open in IMG/M |
| 3300019278|Ga0187800_1695404 | Not Available | 543 | Open in IMG/M |
| 3300019278|Ga0187800_1863492 | Not Available | 589 | Open in IMG/M |
| 3300019887|Ga0193729_1008698 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4667 | Open in IMG/M |
| 3300019890|Ga0193728_1199102 | Not Available | 842 | Open in IMG/M |
| 3300020001|Ga0193731_1165240 | Not Available | 534 | Open in IMG/M |
| 3300020170|Ga0179594_10103899 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1024 | Open in IMG/M |
| 3300020579|Ga0210407_11148246 | Not Available | 587 | Open in IMG/M |
| 3300020580|Ga0210403_10538198 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 947 | Open in IMG/M |
| 3300020582|Ga0210395_10516177 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 899 | Open in IMG/M |
| 3300021046|Ga0215015_10951690 | Not Available | 756 | Open in IMG/M |
| 3300021088|Ga0210404_10102347 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1446 | Open in IMG/M |
| 3300021088|Ga0210404_10446959 | Not Available | 727 | Open in IMG/M |
| 3300021168|Ga0210406_11287452 | Not Available | 527 | Open in IMG/M |
| 3300021170|Ga0210400_11387531 | Not Available | 560 | Open in IMG/M |
| 3300021170|Ga0210400_11521765 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 530 | Open in IMG/M |
| 3300021171|Ga0210405_10722292 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 768 | Open in IMG/M |
| 3300021358|Ga0213873_10208118 | Not Available | 609 | Open in IMG/M |
| 3300021401|Ga0210393_10051355 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3242 | Open in IMG/M |
| 3300021401|Ga0210393_10153853 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1849 | Open in IMG/M |
| 3300021401|Ga0210393_10939857 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 701 | Open in IMG/M |
| 3300021405|Ga0210387_10109954 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2316 | Open in IMG/M |
| 3300021405|Ga0210387_11468040 | Not Available | 584 | Open in IMG/M |
| 3300021407|Ga0210383_11656981 | Not Available | 525 | Open in IMG/M |
| 3300021420|Ga0210394_10317208 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1368 | Open in IMG/M |
| 3300021420|Ga0210394_10416349 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1182 | Open in IMG/M |
| 3300021433|Ga0210391_11575476 | Not Available | 503 | Open in IMG/M |
| 3300021477|Ga0210398_10925522 | Not Available | 698 | Open in IMG/M |
| 3300021477|Ga0210398_11046598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 650 | Open in IMG/M |
| 3300021477|Ga0210398_11201365 | Not Available | 599 | Open in IMG/M |
| 3300021478|Ga0210402_11580862 | Not Available | 583 | Open in IMG/M |
| 3300022528|Ga0242669_1017783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1000 | Open in IMG/M |
| 3300023255|Ga0224547_1020594 | Not Available | 841 | Open in IMG/M |
| 3300025414|Ga0208935_1056947 | Not Available | 524 | Open in IMG/M |
| 3300025898|Ga0207692_10046764 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2171 | Open in IMG/M |
| 3300025899|Ga0207642_10260982 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 988 | Open in IMG/M |
| 3300025903|Ga0207680_10530666 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 840 | Open in IMG/M |
| 3300025904|Ga0207647_10660932 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 572 | Open in IMG/M |
| 3300025908|Ga0207643_11074484 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300025909|Ga0207705_11466486 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 517 | Open in IMG/M |
| 3300025913|Ga0207695_10492489 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1108 | Open in IMG/M |
| 3300025921|Ga0207652_11265351 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 640 | Open in IMG/M |
| 3300025921|Ga0207652_11694364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 537 | Open in IMG/M |
| 3300025924|Ga0207694_10000383 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 41198 | Open in IMG/M |
| 3300025929|Ga0207664_10992617 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 753 | Open in IMG/M |
| 3300025931|Ga0207644_10312013 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1270 | Open in IMG/M |
| 3300025933|Ga0207706_11623687 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300026078|Ga0207702_10361659 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1391 | Open in IMG/M |
| 3300026078|Ga0207702_10545406 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1134 | Open in IMG/M |
| 3300026214|Ga0209838_1025041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 839 | Open in IMG/M |
| 3300026294|Ga0209839_10103890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 968 | Open in IMG/M |
| 3300026294|Ga0209839_10292050 | Not Available | 502 | Open in IMG/M |
| 3300026305|Ga0209688_1056541 | Not Available | 728 | Open in IMG/M |
| 3300026326|Ga0209801_1342427 | Not Available | 527 | Open in IMG/M |
| 3300026334|Ga0209377_1197863 | Not Available | 675 | Open in IMG/M |
| 3300026538|Ga0209056_10256609 | Not Available | 1239 | Open in IMG/M |
| 3300026547|Ga0209156_10046746 | All Organisms → cellular organisms → Bacteria | 2324 | Open in IMG/M |
| 3300026557|Ga0179587_10394139 | Not Available | 902 | Open in IMG/M |
| 3300026879|Ga0207763_1012496 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 873 | Open in IMG/M |
| 3300026941|Ga0207741_1028456 | Not Available | 584 | Open in IMG/M |
| 3300027047|Ga0208730_1023892 | Not Available | 698 | Open in IMG/M |
| 3300027061|Ga0209729_1028526 | Not Available | 689 | Open in IMG/M |
| 3300027070|Ga0208365_1017067 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 922 | Open in IMG/M |
| 3300027376|Ga0209004_1039843 | Not Available | 781 | Open in IMG/M |
| 3300027568|Ga0208042_1058840 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 980 | Open in IMG/M |
| 3300027625|Ga0208044_1051741 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1309 | Open in IMG/M |
| 3300027648|Ga0209420_1003731 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6478 | Open in IMG/M |
| 3300027684|Ga0209626_1006513 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2627 | Open in IMG/M |
| 3300027698|Ga0209446_1025906 | Not Available | 1465 | Open in IMG/M |
| 3300027795|Ga0209139_10314616 | Not Available | 550 | Open in IMG/M |
| 3300027795|Ga0209139_10341022 | Not Available | 525 | Open in IMG/M |
| 3300027812|Ga0209656_10234404 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 875 | Open in IMG/M |
| 3300027842|Ga0209580_10386870 | Not Available | 697 | Open in IMG/M |
| 3300027842|Ga0209580_10417917 | Not Available | 668 | Open in IMG/M |
| 3300027857|Ga0209166_10436194 | Not Available | 677 | Open in IMG/M |
| 3300027857|Ga0209166_10464726 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 652 | Open in IMG/M |
| 3300027869|Ga0209579_10418163 | Not Available | 727 | Open in IMG/M |
| 3300027869|Ga0209579_10501593 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 659 | Open in IMG/M |
| 3300027869|Ga0209579_10529066 | Not Available | 640 | Open in IMG/M |
| 3300027875|Ga0209283_10055377 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2534 | Open in IMG/M |
| 3300027875|Ga0209283_10144511 | All Organisms → cellular organisms → Bacteria | 1576 | Open in IMG/M |
| 3300027884|Ga0209275_10265046 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 946 | Open in IMG/M |
| 3300027910|Ga0209583_10687153 | Not Available | 532 | Open in IMG/M |
| 3300027915|Ga0209069_10975940 | Not Available | 518 | Open in IMG/M |
| 3300028719|Ga0307301_10286035 | Not Available | 540 | Open in IMG/M |
| 3300028748|Ga0302156_10427842 | Not Available | 573 | Open in IMG/M |
| 3300028784|Ga0307282_10356223 | Not Available | 707 | Open in IMG/M |
| 3300028792|Ga0307504_10188875 | Not Available | 723 | Open in IMG/M |
| 3300028795|Ga0302227_10427393 | Not Available | 502 | Open in IMG/M |
| 3300028808|Ga0302228_10334269 | Not Available | 676 | Open in IMG/M |
| 3300028906|Ga0308309_11116008 | Not Available | 681 | Open in IMG/M |
| 3300029636|Ga0222749_10025855 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2459 | Open in IMG/M |
| 3300029919|Ga0302141_1133087 | Not Available | 672 | Open in IMG/M |
| 3300029951|Ga0311371_10366348 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1983 | Open in IMG/M |
| 3300030000|Ga0311337_10714342 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 867 | Open in IMG/M |
| 3300030053|Ga0302177_10329181 | Not Available | 810 | Open in IMG/M |
| 3300030058|Ga0302179_10102729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1264 | Open in IMG/M |
| 3300030114|Ga0311333_11530475 | Not Available | 576 | Open in IMG/M |
| 3300030294|Ga0311349_10369914 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1355 | Open in IMG/M |
| 3300030494|Ga0310037_10084024 | Not Available | 1488 | Open in IMG/M |
| 3300030494|Ga0310037_10395099 | Not Available | 574 | Open in IMG/M |
| 3300030503|Ga0311370_11596524 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 676 | Open in IMG/M |
| 3300030659|Ga0316363_10219623 | Not Available | 784 | Open in IMG/M |
| 3300030707|Ga0310038_10089184 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1636 | Open in IMG/M |
| 3300030730|Ga0307482_1263000 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 545 | Open in IMG/M |
| 3300030737|Ga0302310_10555063 | Not Available | 611 | Open in IMG/M |
| 3300030738|Ga0265462_12073644 | Not Available | 555 | Open in IMG/M |
| 3300030738|Ga0265462_12157957 | Not Available | 547 | Open in IMG/M |
| 3300030740|Ga0265460_12382021 | Not Available | 561 | Open in IMG/M |
| 3300030888|Ga0265769_121288 | Not Available | 516 | Open in IMG/M |
| 3300031057|Ga0170834_107549914 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300031231|Ga0170824_102153195 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 678 | Open in IMG/M |
| 3300031231|Ga0170824_107152088 | Not Available | 562 | Open in IMG/M |
| 3300031236|Ga0302324_100082264 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5551 | Open in IMG/M |
| 3300031236|Ga0302324_101983887 | Not Available | 731 | Open in IMG/M |
| 3300031249|Ga0265339_10056563 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2124 | Open in IMG/M |
| 3300031446|Ga0170820_10093773 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 545 | Open in IMG/M |
| 3300031474|Ga0170818_106616149 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 886 | Open in IMG/M |
| 3300031474|Ga0170818_107097777 | Not Available | 559 | Open in IMG/M |
| 3300031546|Ga0318538_10079605 | All Organisms → cellular organisms → Bacteria | 1662 | Open in IMG/M |
| 3300031573|Ga0310915_10910550 | Not Available | 616 | Open in IMG/M |
| 3300031715|Ga0307476_10677397 | Not Available | 764 | Open in IMG/M |
| 3300031715|Ga0307476_11323919 | Not Available | 525 | Open in IMG/M |
| 3300031718|Ga0307474_11613457 | Not Available | 509 | Open in IMG/M |
| 3300031720|Ga0307469_10291996 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1338 | Open in IMG/M |
| 3300031744|Ga0306918_10433484 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1026 | Open in IMG/M |
| 3300031744|Ga0306918_11147903 | Not Available | 601 | Open in IMG/M |
| 3300031754|Ga0307475_10426697 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1066 | Open in IMG/M |
| 3300031754|Ga0307475_11496023 | Not Available | 518 | Open in IMG/M |
| 3300031823|Ga0307478_10495315 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1018 | Open in IMG/M |
| 3300031823|Ga0307478_10646376 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 885 | Open in IMG/M |
| 3300031938|Ga0308175_100496561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1296 | Open in IMG/M |
| 3300031947|Ga0310909_11578423 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 521 | Open in IMG/M |
| 3300031954|Ga0306926_11300914 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 849 | Open in IMG/M |
| 3300031962|Ga0307479_10294484 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1604 | Open in IMG/M |
| 3300031962|Ga0307479_11749502 | Not Available | 574 | Open in IMG/M |
| 3300032044|Ga0318558_10460940 | Not Available | 634 | Open in IMG/M |
| 3300032059|Ga0318533_10417802 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 980 | Open in IMG/M |
| 3300032094|Ga0318540_10208556 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 942 | Open in IMG/M |
| 3300032160|Ga0311301_10925464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1169 | Open in IMG/M |
| 3300032174|Ga0307470_10325485 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
| 3300032174|Ga0307470_10860121 | Not Available | 708 | Open in IMG/M |
| 3300032205|Ga0307472_101074934 | Not Available | 759 | Open in IMG/M |
| 3300032782|Ga0335082_10197833 | All Organisms → cellular organisms → Bacteria | 1911 | Open in IMG/M |
| 3300032783|Ga0335079_10324122 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1676 | Open in IMG/M |
| 3300032783|Ga0335079_11507349 | Not Available | 664 | Open in IMG/M |
| 3300032783|Ga0335079_12053532 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 549 | Open in IMG/M |
| 3300032805|Ga0335078_10553767 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1463 | Open in IMG/M |
| 3300032828|Ga0335080_10413269 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1446 | Open in IMG/M |
| 3300032892|Ga0335081_10559711 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1421 | Open in IMG/M |
| 3300032892|Ga0335081_11867319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 647 | Open in IMG/M |
| 3300032893|Ga0335069_10381840 | Not Available | 1657 | Open in IMG/M |
| 3300032893|Ga0335069_12692271 | Not Available | 511 | Open in IMG/M |
| 3300032896|Ga0335075_11058046 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 721 | Open in IMG/M |
| 3300032897|Ga0335071_11423998 | Not Available | 637 | Open in IMG/M |
| 3300032955|Ga0335076_10519329 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1074 | Open in IMG/M |
| 3300032955|Ga0335076_11737186 | Not Available | 513 | Open in IMG/M |
| 3300033158|Ga0335077_10006425 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 14525 | Open in IMG/M |
| 3300033158|Ga0335077_10737670 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1010 | Open in IMG/M |
| 3300033290|Ga0318519_10457273 | Not Available | 765 | Open in IMG/M |
| 3300033412|Ga0310810_10046475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5299 | Open in IMG/M |
| 3300033412|Ga0310810_10503432 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1203 | Open in IMG/M |
| 3300033433|Ga0326726_10754320 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 941 | Open in IMG/M |
| 3300033807|Ga0314866_004709 | Not Available | 1598 | Open in IMG/M |
| 3300033887|Ga0334790_046685 | Not Available | 1647 | Open in IMG/M |
| 3300034163|Ga0370515_0023913 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2789 | Open in IMG/M |
| 3300034199|Ga0370514_178755 | Not Available | 551 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.77% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.33% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.03% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.60% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.31% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.02% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.74% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.74% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.45% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.59% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.59% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.59% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.59% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.30% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.01% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.01% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.72% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.44% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.44% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.44% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.15% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.15% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.15% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.15% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.15% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.15% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.86% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.86% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.86% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.57% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.57% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.57% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.57% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.57% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.57% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.57% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.57% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.57% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.57% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.57% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.29% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.29% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.29% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.29% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.29% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.29% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.29% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.29% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.29% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.29% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.29% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.29% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.29% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.29% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.29% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.29% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.29% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908006 | Soil microbial communities from sample at FACE Site Metagenome WIR_Oz2 | Environmental | Open in IMG/M |
| 2170459014 | Litter degradation PV2 | Engineered | Open in IMG/M |
| 3300000579 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01 | Environmental | Open in IMG/M |
| 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Host-Associated | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004972 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 42 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005950 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009650 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-061 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011084 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 47 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011085 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 71 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011087 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 55 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300016700 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Host-Associated | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022528 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023255 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 10-14 | Environmental | Open in IMG/M |
| 3300025414 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026214 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 (SPAdes) | Environmental | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026879 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 50 (SPAdes) | Environmental | Open in IMG/M |
| 3300026941 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 39 (SPAdes) | Environmental | Open in IMG/M |
| 3300027047 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042 (SPAdes) | Environmental | Open in IMG/M |
| 3300027061 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027070 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes) | Environmental | Open in IMG/M |
| 3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028748 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028795 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1 | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029919 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_2 | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030000 | I_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300030738 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assembly | Environmental | Open in IMG/M |
| 3300030740 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly | Environmental | Open in IMG/M |
| 3300030888 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033807 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10 | Environmental | Open in IMG/M |
| 3300033887 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1 | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| 3300034199 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FWIROz_04916390 | 2124908006 | Soil | VALVPAITELEQLKEHPALARLLSWNSSAVDSAKFDRDELTIVVDRA |
| 2PV_00977910 | 2170459014 | Switchgrass, Maize And Mischanthus Litter | VPLAAAVTDIEQLKSHPAISRLLGWDPKVVESVKFD |
| AP72_2010_repI_A01DRAFT_10137201 | 3300000579 | Forest Soil | MPLAPAITDIEQLKNHPAVARLLDWNPAAVEAVKFDRDEMTIIVD |
| JGI24743J22301_100053095 | 3300001991 | Corn, Switchgrass And Miscanthus Rhizosphere | VALTPAITDLEQLKSHPALAKLLAWKQNAVTEAKFDRDEL |
| JGIcombinedJ26739_1002490571 | 3300002245 | Forest Soil | MPGQPPITDLEQLRSHPAVAKLTAWNSATVVGAKFDRDEMSIYLQRSS |
| JGI25388J43891_10440871 | 3300002909 | Grasslands Soil | MPLPPAITDLEQLKSHPAIAKLLAWNPVAVEEARFDRDEISI |
| JGIcombinedJ51221_103757611 | 3300003505 | Forest Soil | MPLTPAITDLEALKDHPAVVRLRSWNSAAVEGAKFDRDEMTIYIERS |
| Ga0062385_104136342 | 3300004080 | Bog Forest Soil | VPLVPSITDVEQLKTHPAVARLLAWNAAAVTGVKFDRDEM |
| Ga0062385_110643661 | 3300004080 | Bog Forest Soil | MPLAPAVTDLEQLKNHPAVSRLVGWNAAAVTGAKFDRDEMTIFIERG |
| Ga0062389_1042964642 | 3300004092 | Bog Forest Soil | MPLAPAITDLEQVKNHPAVARLVDWNREAVTGVKFDRDEM |
| Ga0062389_1048708352 | 3300004092 | Bog Forest Soil | MPLAPAITDLEALKDHPAVARLRSWNSAAVEGAKFDRDEMTIYI |
| Ga0062386_1002570011 | 3300004152 | Bog Forest Soil | MPWPAAVTDLERVKTHPAVARLLEWNQASVTAVKYDREEMT |
| Ga0062589_1015393942 | 3300004156 | Soil | MPLPPAITDLEQLKNHPAVAKITAWNPAAVEGAKFDRDEMSIYVERSSI |
| Ga0066395_101721521 | 3300004633 | Tropical Forest Soil | MPLPPAITDREQLKNHPAVARLTDWNSGAVQEVKFDRDEMT |
| Ga0072325_12384441 | 3300004972 | Peatlands Soil | MPLTPAITDLEALKEHPAIARLRSSNSAAVEGAKFDRDEM |
| Ga0066672_109531212 | 3300005167 | Soil | MPLPPAITDLEQLKSHPAIAKLLAWNPVAVEEARFDRDEISIY |
| Ga0066677_103686001 | 3300005171 | Soil | MALAPAVTDIQQLKSHPAIARLLSWNEGAVEGVKFDRDEMTIY |
| Ga0066677_107099611 | 3300005171 | Soil | MSLSPAITDRELLKAHPALAPLLAWNPDSVHSVKFDRDEMTIYVDR |
| Ga0066683_103364343 | 3300005172 | Soil | MPLVPAITELDQLKGHPALAKMLAWNSEAVEGAKFDRDELTIYIERSSIRE |
| Ga0066680_100874731 | 3300005174 | Soil | MPSVPAITDLEQLKDHPALALLLAWNPAAVQSAKYDRDEITICVDRCYVRDVCVLL |
| Ga0066388_1028491071 | 3300005332 | Tropical Forest Soil | MTLAPAVTDLGQLKSHPAVARLMEWNAQAVEGVKFDREEM |
| Ga0070709_104560943 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLAPAITDIEQLKSHPAVARLHGWNPEAIQAVKFDRDEMTLVVDRST |
| Ga0070713_1007561411 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MALAPAVTDIEQLKGHPAVARLVGWNPQAVQGVKFDRDEMTIYV |
| Ga0070708_1019968271 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MALAPAVTDLEQLKGHPAISRLISWNARAVQGVKFDRDEMTIYVER |
| Ga0070707_1019958342 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLLPAVTELDQLRGHPALAKMLAWNSEAVGGAKFDRDELTIYIERSSIREAC |
| Ga0070734_105460352 | 3300005533 | Surface Soil | MPLAPAITDLEQLKNHPAVARLAGWNASAVQGVKFDRDEM |
| Ga0070735_108727552 | 3300005534 | Surface Soil | MPLSPAITDIEELKNHPAVARIQGWNAAAIQEVKFDREEMTIV |
| Ga0070697_1005322001 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MPFQSAITDLEQLKNHPAVTKLLAWNPAAVEGAKFDRDEMSI |
| Ga0070730_103165893 | 3300005537 | Surface Soil | MPLVPAVTDLEELKNHPALASLLVWNKGAVEGAKFDR |
| Ga0070733_104203633 | 3300005541 | Surface Soil | MPLSPAVTDLEQLKNHPAVARLVGWNAQAVTGAKFDREEMTIYLDRASIREA |
| Ga0070733_105389523 | 3300005541 | Surface Soil | MPLIPAITDLEALKDHPAVVRLRSWNSAAVEGAKFDRDEMTIYIERS |
| Ga0070733_107596571 | 3300005541 | Surface Soil | MAWPPAVTDLEHLKTHPAVARLLEWNPTAITGVKY |
| Ga0070732_108876171 | 3300005542 | Surface Soil | MPLTPAITDLEALKDHPAVARLRSWNLAAVEGAKFDRDEM |
| Ga0070732_110033121 | 3300005542 | Surface Soil | MPLAPAITDLEALKDHPAVARLRSWNTPAVEGAKF |
| Ga0070672_1002536844 | 3300005543 | Miscanthus Rhizosphere | MALAPAVTDLEQLKGHPAVARIVGWNSSALQAAKFDREELTLYVERRALR |
| Ga0066701_103148551 | 3300005552 | Soil | MPLVPAITDLEQLKDHPALALLLAWNPAAVQSAKYDRDEITICVDRCYVRDVCVLL |
| Ga0066699_102235601 | 3300005561 | Soil | MPSVPAITDLEQLKDHPALALLLAWNPAAVQSAKYDRDEITICVDRCYVRDVCVL |
| Ga0068855_1018922201 | 3300005563 | Corn Rhizosphere | MTLAPAVTDIEQLKGHPAVARLMGWNAQSVEGVKFDREE |
| Ga0066703_100553531 | 3300005568 | Soil | MAIAPPITDLEQLKTHPALAALLDWNPAAIQGVKFDRDEMTIIVDRTHIR |
| Ga0066703_103470293 | 3300005568 | Soil | MALVPAVTDLEQLKGHPAISRLLSWNPKVVEGVKFDRDEMTIYVERPGIR |
| Ga0066705_108905292 | 3300005569 | Soil | MPSVPAITDLEQLKDHPALALLLAWNPAAVQSAKYDRDE |
| Ga0066708_106480601 | 3300005576 | Soil | MPLAPAITDLDQLKNHPVVAALLAWNPTSIEGAKFDRDELS |
| Ga0068854_1004212231 | 3300005578 | Corn Rhizosphere | MALAPAVTDLEQLKGHPAVARIVGWNSSALQAAKFDRE |
| Ga0070761_109807602 | 3300005591 | Soil | VPLTPAITDLEALKDHPAVAQLRSWNSAAVEAAKFDREEMTIYIER |
| Ga0070764_101507063 | 3300005712 | Soil | MPTVPAITNVDELKSHPAVARLVAWKSAAVQGAKFDREEMTI |
| Ga0070764_102730181 | 3300005712 | Soil | MALVPAITDIEQLKGHPAVARLLAWNPAAVAEVKFDRDEMTIVVGRENIREA |
| Ga0070766_103138663 | 3300005921 | Soil | MPLAPAITDLNELKDHPAIARLRSWNSAAVEGAKFDREEMTI |
| Ga0066787_100460593 | 3300005950 | Soil | MPWPPAVTDLEQLKEHPAIAALIAWNPAAVEGAKYDRDET |
| Ga0066656_110017641 | 3300006034 | Soil | MPLVAAITELDQLKAHPALVKLQAWNSEAVEGAKFDRDELTIYIERSSI |
| Ga0075028_1001565161 | 3300006050 | Watersheds | MSFGPAITDLDALKDHPALACLRSWNPTAVEGVKFDRDEMTIY |
| Ga0075029_1007883102 | 3300006052 | Watersheds | MPLAPAVTDIALLKDHPALAALLAWNSAAVEAAKFDRDEMTVWISAPLIR |
| Ga0075029_1011007621 | 3300006052 | Watersheds | MPLSLAITDVDQLKNHPAVARLLGGKAGMVQGAKFDRAEVTISVDRDS |
| Ga0075030_1015858521 | 3300006162 | Watersheds | MALEPAVTDLEQLKSHPEVACLQAWNPAAVQGAKFDRNELTI |
| Ga0070715_102220291 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MALSPAITDIDQLKSHPAVARLHEWNPEVIQAVKFDRDEMTIVV |
| Ga0075018_104138541 | 3300006172 | Watersheds | VPLVPAITDIEQLKGHPALARILAWNRAAVEGAKFDRDELTITIER |
| Ga0070712_1008546663 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VPLTAAISDLEQLKGHPAVARLLTANASVVQSVKFDRDELT |
| Ga0070712_1018492531 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MPIAPPITDVNELKAHPAVAVLLGWNAASVEGVKFDRDEMSIYI |
| Ga0070765_1009804253 | 3300006176 | Soil | VSLTPAITDLEQLKGHPAIACLLAANSVVVEAVKFDREEMTIWVNRGSIRDACA |
| Ga0070765_1009835391 | 3300006176 | Soil | MPLAPAITDLEQLKNHPAVARLIAWNPQAVTRAKFDREEMTIFID |
| Ga0068871_1023116191 | 3300006358 | Miscanthus Rhizosphere | MPFQPAITDLEQLKNHPAVTKLLAWNPAAVEGAKFDRDEMSI |
| Ga0066659_114507641 | 3300006797 | Soil | MPLQAAITDLQHLKNHPAVGKLMAWNSAVVEGAKFDRDEMSIYLERSFI |
| Ga0075425_1016482791 | 3300006854 | Populus Rhizosphere | MPIEPAITALDQLKEHPAVAQLLAWNPGAVEGAKFFRDEMTIYIERSSIR |
| Ga0075425_1031091362 | 3300006854 | Populus Rhizosphere | MTVPAPITDLEQLKNHPAIAKLMAWKSSAVEGAKFDREEMTIYLERSSIRQ |
| Ga0073928_103310903 | 3300006893 | Iron-Sulfur Acid Spring | MPLAPAITDLEELKEHPAVARLRSWNSAAVVGAKFDRDEM |
| Ga0073928_110163881 | 3300006893 | Iron-Sulfur Acid Spring | MALAPAITDPEQLKEHPAIARLLAWNAGSVEGTKFDR |
| Ga0075436_1013286312 | 3300006914 | Populus Rhizosphere | MPLQPAITDLEQLKSHPAIAKLLAWNPAAVEEARFDRDETS |
| Ga0079218_133350172 | 3300007004 | Agricultural Soil | MALAPAITDLEQLKDQPAVSRLLSWSMEAVEAAK* |
| Ga0075435_1009847513 | 3300007076 | Populus Rhizosphere | MLATPVTDLEQLKHHPAVSKLLAWNGSAIEEVKFDRDEMTIYVDRSAIRE |
| Ga0066710_1023947522 | 3300009012 | Grasslands Soil | MALTPAVTDIEQLKGHPAVARLVGWNPQAVEGVKFDR |
| Ga0099829_101141675 | 3300009038 | Vadose Zone Soil | MPLAPAITDLEQLQTHPAIAKLLAWNPAAVEGAKFDRD |
| Ga0099829_112422441 | 3300009038 | Vadose Zone Soil | MALAPAVTDLEQLKGHPAIARLVSWNPQAVEGVKFDRDEMSIYVE |
| Ga0099830_109710842 | 3300009088 | Vadose Zone Soil | MSLAPAITDLEQLKTHPAIAKLLAWNPAAVEGAKFDRDEMTIYIERSAL |
| Ga0099828_104824083 | 3300009089 | Vadose Zone Soil | MSLAPAITDLEQLKTHPAIAKLQAWNPAAVEGAKFDRDEM |
| Ga0105240_101485116 | 3300009093 | Corn Rhizosphere | MPLQPAITDLEQLKQHPAIAALLAWNPSSVEGAKFDRE |
| Ga0105247_103877301 | 3300009101 | Switchgrass Rhizosphere | MALAPAVTDLEQLKSHPAVARLVGWNASAVQEAKFDRDELTLYIERS |
| Ga0066709_1002878861 | 3300009137 | Grasslands Soil | MTLAAAVTDLDQLKSHPAIARLLCWNPKAVEGVKFDRDEMTIYVERSTI |
| Ga0105248_109152711 | 3300009177 | Switchgrass Rhizosphere | VALAPAITDLEQLKGHPAIARLLGWNAAAVQEAKFDREELSIYIDRFSIRE |
| Ga0116222_13085512 | 3300009521 | Peatlands Soil | MPLSPAITDLEQLKSHPAVARLVAWNSSAVQGVKFDREEMTIYIDR |
| Ga0116222_13317951 | 3300009521 | Peatlands Soil | VPLAPAITDLEQLKNHPAVARLVGWNAAGVQGGKFDRE |
| Ga0116225_11172473 | 3300009524 | Peatlands Soil | VPLAPAITDLEKLKDHPAITRLRGWNPAAVTDAKFDRDEISIYVERSAI |
| Ga0116220_101759371 | 3300009525 | Peatlands Soil | MPLAPAITDLEQLKERPPLARLLAWDAGAVEGAKFDRDEFTIV |
| Ga0116220_106049032 | 3300009525 | Peatlands Soil | VPLAPAITDLEQLKNHPAVARLVGWNAAGVQGMKFDREEM |
| Ga0105237_121161841 | 3300009545 | Corn Rhizosphere | MPMAPPITDLEQLKNHPAIARLLAWNPQVVEGVKFDRDEM |
| Ga0105238_100779501 | 3300009551 | Corn Rhizosphere | VALAQAVTDLEQLKGHPAVARLLAWNSKSVEGVKFDRE |
| Ga0105857_12332072 | 3300009650 | Permafrost Soil | MPMQPAITDLEQLRNHPAVAKLAAWNPAAVVGVKFDRDEMSIY |
| Ga0116215_14271582 | 3300009672 | Peatlands Soil | VPLAPAITDLEQLKNHPAVARLVGWNAAGVQGVKFDR |
| Ga0116224_102354203 | 3300009683 | Peatlands Soil | MPLAPAITDLEALKDHPAVAKLRSWNPAAVEGAKFDREEMTIYVERSSIRD |
| Ga0126374_104999561 | 3300009792 | Tropical Forest Soil | MALTAAVTDLEQLKEHPEVACLLAWKAAAVEGAKF |
| Ga0116219_101277901 | 3300009824 | Peatlands Soil | MPLTPAITDLEALKEHPAIARLRSWNSAAVEGAKFDRDEMTIYVERSCIRDACVI |
| Ga0116223_109079341 | 3300009839 | Peatlands Soil | MPPTPAITDLEALKEHPAIARLRSWNSAAVEGAKFDRDEM |
| Ga0126373_100929581 | 3300010048 | Tropical Forest Soil | MAIAPPITDLEQLKTHPALAALLDWNPAAIQGVKFDRDEMTI |
| Ga0126373_104485081 | 3300010048 | Tropical Forest Soil | VPLPPPITALEEVKGHPAVARLIAWNPAAIQHVKFDRDEMTIYVD |
| Ga0126373_108677702 | 3300010048 | Tropical Forest Soil | MALAPAVTDLEQLKSHPAVARLVGWNAQAVEGVKFD |
| Ga0099796_101641163 | 3300010159 | Vadose Zone Soil | MALSAAITNLEELKGHPAIARLQAWNASAVQNAKFDRDE |
| Ga0134082_103489711 | 3300010303 | Grasslands Soil | MSLQPAITDLEQLKSHPAIAKLLAWNPAAVEEAKFDRDEVSIYIDRSSIRE |
| Ga0074046_101761784 | 3300010339 | Bog Forest Soil | MPLAAPITNLEELKDHPAVAKLRSWNSAAVEGAKF |
| Ga0074045_108881332 | 3300010341 | Bog Forest Soil | VLAPAITDLEQLKGHPAVARLLAWNPSAVGDVKFDR |
| Ga0074044_101407704 | 3300010343 | Bog Forest Soil | MPLPPAITDIEQLKNHPAVARLVGWNAEAVQGVKFDREE |
| Ga0074044_107187782 | 3300010343 | Bog Forest Soil | VPLSPAITDLEKLKGHPAVSRLLAWNPATVTGIKFDRDEMTI |
| Ga0126372_106104022 | 3300010360 | Tropical Forest Soil | VSLAPAVTDLEQLKSHPAIFRLLAWDPKVVESVKF |
| Ga0126372_113333822 | 3300010360 | Tropical Forest Soil | MAPGPAVVDIEQLKGHPAVARLVGWNPQAVEGVKFDREEMTITVVRE |
| Ga0134125_103975471 | 3300010371 | Terrestrial Soil | MALAPAVTDLEQLKSHPAVARLVGWNASAVQEAKFDRDELTLY |
| Ga0105239_114746132 | 3300010375 | Corn Rhizosphere | MPMAPPITDLEQLKNHPAIARLLAWNPQVVEGVKFDRDEMSIIVERSAIRE |
| Ga0126381_1026328162 | 3300010376 | Tropical Forest Soil | MAPAAAVVDIEQLKGHPAVARLVGWNPQAVEGVKFDREE |
| Ga0136449_1043169102 | 3300010379 | Peatlands Soil | MPLAPAITDIEQLKNHPAVARLVGWNAEAVQGVKFDREEMT |
| Ga0134126_128164721 | 3300010396 | Terrestrial Soil | VALAPAVTDIEQLKGHPALARLLAWNPKAVEGVKFDRDEMTIY |
| Ga0134123_100042041 | 3300010403 | Terrestrial Soil | VALTQAVTDLEQLKGHPAVARLVAWNPKAVEGVKFDRDEMTLYV |
| Ga0138562_10439471 | 3300011084 | Peatlands Soil | MPLAPAITDLEQLKNHPAVARLLGWNADALTGVKFDRDE |
| Ga0138581_11803951 | 3300011085 | Peatlands Soil | MPLAPAITDLEQLKERPPLARLLGWDADAVEAAKFDRDEL |
| Ga0138570_10720151 | 3300011087 | Peatlands Soil | VPLAAAITDLEQLKNHPAVACLLAWNAAAVEGAKFDRDE |
| Ga0150983_109780382 | 3300011120 | Forest Soil | MPLTPAITDLAALKDHPAVTRLRSWKSAAVEGAKFDREEMTIY |
| Ga0150983_121316871 | 3300011120 | Forest Soil | MALSPAITDLEQLKGHPAVARLLAWNPSSVAGVKFDRD |
| Ga0150983_140756312 | 3300011120 | Forest Soil | MPVSPAVTDLEQLKTHPAVARLLAWNREAVLEAKFDREEMTIVIDRAKIRE |
| Ga0150983_163267851 | 3300011120 | Forest Soil | VPLTPAITDLEALKDHPAVARLRSWNSAAVEAAKFDREEM |
| Ga0137392_101056475 | 3300011269 | Vadose Zone Soil | MALVPAVTDLEQLKGHPAISRLISWDPQSVQGVKFDRDEMTIYVERSAI |
| Ga0137392_101456515 | 3300011269 | Vadose Zone Soil | VALSPAITDLEQLKGHPAVARLLAWNPAAVTGVKFDR |
| Ga0137392_108079772 | 3300011269 | Vadose Zone Soil | VALSPAITDLEQLKGHPALARLLAWNAPAVTGVKFDRD |
| Ga0137391_100273479 | 3300011270 | Vadose Zone Soil | MALAPAVTDLEQLKGHPAISRLISWNPLAVEGVKFDRDEMTIYVERS |
| Ga0137391_100444959 | 3300011270 | Vadose Zone Soil | MALVPAVTDLEQLKEHPAISRLISWDPQSVQGVKFDR |
| Ga0137391_113745401 | 3300011270 | Vadose Zone Soil | MALETAITDLEQLKSHPAIAKLMGGNRSAVEGAKFDRNEISIY |
| Ga0137393_103427151 | 3300011271 | Vadose Zone Soil | MTVVPAITDVEQLKGHPAVARLLEWNPSAVVGVKFDRDEMTIYVD |
| Ga0137381_112752541 | 3300012207 | Vadose Zone Soil | MALAAAVTDLDQLKSHPAIARLLSWNPKAVEGVKF |
| Ga0137378_113749022 | 3300012210 | Vadose Zone Soil | MTPAPAVTDVEQLKGHPAVARLTGWNPQAVEGVKFDREEMTIYVE |
| Ga0137371_106439492 | 3300012356 | Vadose Zone Soil | MALTPAVTDLEQLKSHPAVSRLVSWSAQAVEGAKFDREEMTIYVERSFIREA |
| Ga0137371_113131981 | 3300012356 | Vadose Zone Soil | MALTPPVTDLEQLKGHPAVARLLGWNANAVPEARFDRE |
| Ga0137384_104226531 | 3300012357 | Vadose Zone Soil | MALVPAVTDLEQLKAHPAISRLLSWNPQAVEGVKFDRD |
| Ga0150984_1043403271 | 3300012469 | Avena Fatua Rhizosphere | MPEIAPAVTDIEQLKTHPALEKLLGWKPEAVKSAKFD |
| Ga0137373_108670422 | 3300012532 | Vadose Zone Soil | MALAAAVTDLDQLKSHPAIARLLSWNPKAVEGVKFDRDEMTIYV* |
| Ga0137398_100955393 | 3300012683 | Vadose Zone Soil | MALAPAVTDLEQLKGHPAISRLISWNAQAVQGVKFDRDEMTLYV |
| Ga0137395_107708631 | 3300012917 | Vadose Zone Soil | VASAPAITDLEQLKGHPAVARLLEWNPAAVAGVKFDRD |
| Ga0137396_107483121 | 3300012918 | Vadose Zone Soil | MALAPAVTDLEQLKGHPAISRLLSWNPQSVEGVKFDRDEMTIYVE |
| Ga0137394_105962301 | 3300012922 | Vadose Zone Soil | MPLQSAITDLEELKNHPAVAKLLAWNPAAVEGAKFDR |
| Ga0137359_112139872 | 3300012923 | Vadose Zone Soil | MSSLAPAVTELEQLKDRYPVAKLLEWNKSAVQSAKFDRDELSI |
| Ga0164300_112082841 | 3300012951 | Soil | MPLAPPITDVEQLKDNPALARLLSWNSAAVEGVKF |
| Ga0126369_107519013 | 3300012971 | Tropical Forest Soil | MALAPAVTDLEQLKGHPAVARLVGWNASAVQEVKFDRE |
| Ga0126369_110634961 | 3300012971 | Tropical Forest Soil | MALAPAVNDLEQLKGHPAVSCLLSANPQTVAGGKFDRDEMTIYVERSLIR |
| Ga0164304_103775461 | 3300012986 | Soil | MALVPAVTDLEQLKSHPAIARLLTWNEKAVTGVKFDRDEMT |
| Ga0164307_103707711 | 3300012987 | Soil | MALVPAVTDIEQLKGHPAVSRLVGWNPQAVQGVKFDRDEMTI |
| Ga0157371_107434152 | 3300013102 | Corn Rhizosphere | VALTQAVTDLEQLKGHPAVARLVAWNPKAVEGVKFDRDE |
| Ga0181524_102847092 | 3300014155 | Bog | MPLAAAITDLEALKDHPAVAKLRSWNSAAVEAAKFDREEMTIYIERSSI |
| Ga0181534_106483322 | 3300014168 | Bog | MPTAPANTNLDELKSHPAVARLLAWNSAAVQGAKFDREEMTIYVDR |
| Ga0181531_102529263 | 3300014169 | Bog | MPVTPAITDLEQLKAHPAVARLLAWNPASVTGAKFDRDEISIHVDRPFIR |
| Ga0182016_104792481 | 3300014493 | Bog | MALSPAITDIEQLKGHPALDRLLAWKTSAVAGAKFD |
| Ga0182024_117838821 | 3300014501 | Permafrost | MALAPAITDLEQLKGHPALARLLAWKTSSVTAAKFDRSEITIT |
| Ga0157376_123836912 | 3300014969 | Miscanthus Rhizosphere | MALAPAITDLEQLKDHPALARLLAWDTASVESAKFDR |
| Ga0137418_102935251 | 3300015241 | Vadose Zone Soil | MPLQPAITDLEELKNHPAVAKLLAWNPAAVEGAKFD |
| Ga0137412_106308133 | 3300015242 | Vadose Zone Soil | MPLAPAITDLEQLKNHPAVARLVGWNVAAVTGVKF |
| Ga0134072_101705941 | 3300015357 | Grasslands Soil | MPLVPAITELDQLKGHPALAKMLAWNSEAVEGAKF |
| Ga0132258_103517001 | 3300015371 | Arabidopsis Rhizosphere | VALTQAVTDLEQLKGHPAVARLVAWNPKAVEGVKFDR |
| Ga0182032_100825495 | 3300016357 | Soil | MPLAPPITDIEQLKNHPAVARLLGWKDSAIQSVKF |
| Ga0182037_113680932 | 3300016404 | Soil | MVLSPAITDLEQLKGHPALARLLEWNDKTVRGVKFDRDEMTIQI |
| Ga0182037_116046842 | 3300016404 | Soil | MALAPAVNDLEQLKGHPAVSCLLSANPQTVAGGKFDRDEMTIYVERS |
| Ga0182039_117657621 | 3300016422 | Soil | MPLAPAITDIEQLRNHPAVARLLGWKDSAIQGVKFDRDEMTI |
| Ga0182038_101907154 | 3300016445 | Soil | MPLSPAVTDIEQLKNHPAVARILEWNAQAIQGVKFDREEM |
| Ga0182038_107454311 | 3300016445 | Soil | MALAPAVNDLEQLKGHPAVSCLLSANPQTVAGGKFDR |
| Ga0181513_12957931 | 3300016700 | Peatland | MALAPAITDLEQLKDRPAMARLLSWKADAVTGAKFDRGELT |
| Ga0187820_11589921 | 3300017924 | Freshwater Sediment | MALPAAITDIEQLKGHPAVTRIHGWNPEAIQAVKFDRDEMTIVVDRS |
| Ga0187825_101902262 | 3300017930 | Freshwater Sediment | MALAAAVTDIQQLKSHPAVVRLVSWNPQAVEGAKFDREEMTIYVER |
| Ga0187801_104138512 | 3300017933 | Freshwater Sediment | MPLIPAITDLEALKDHPAVVRLRSWNSAAVEGAKFDRDEMTIYIERSSIR |
| Ga0187821_104476431 | 3300017936 | Freshwater Sediment | MPLSPPITDLEQLKSHPAVARLLDWNSTAVTGVRFDR |
| Ga0187779_100397451 | 3300017959 | Tropical Peatland | MPLAPAITDLEQLKSHPAVARLVAWNAAAVQGVKFDREEMTI |
| Ga0187778_101896841 | 3300017961 | Tropical Peatland | VPLSPAISDLEQLKQHPAIARLQAWNPQVVEGAQFDRDEMSIYIE |
| Ga0187783_101406104 | 3300017970 | Tropical Peatland | MPLPPAITDLKQLKHHPAVTRLTDWNSNAVQEVKFDRDEMTIYLDRSS |
| Ga0187781_108214801 | 3300017972 | Tropical Peatland | MPTAPAITDLDQLKVQPPLALLLSWNPGAVTSAKLDRGELSITISG |
| Ga0187781_113661452 | 3300017972 | Tropical Peatland | MPLAPAITDRAQLKGHPALAMLLGWNPAAVEGAKFDRNE |
| Ga0187780_103294353 | 3300017973 | Tropical Peatland | MPLAPAITDLEQLKNHPAVARLLAWNPAAVQGVKFDREEM |
| Ga0187777_110672101 | 3300017974 | Tropical Peatland | MPLPPAITDLEQLKNHPAVTRLTDWNSNAVQEVKFDRDEMTIYVDRSSIRG |
| Ga0187857_102005851 | 3300018026 | Peatland | MALAPAITDLEQLKDHPAVARLLTWNPAAVTGVKFDRDEMTIYIDAAHI |
| Ga0187863_101247791 | 3300018034 | Peatland | VALAPAITDLEQLKSHPALACLLGWNPASVEGAKFDREEMT |
| Ga0187855_106290071 | 3300018038 | Peatland | MPTAPANTNLDELKSHPAVARLLAWNSAAVQGAKFDREEMTIYVD |
| Ga0187887_104621771 | 3300018043 | Peatland | MALAPAITNLEQLKDRPALAKLLSWKADAVTGVKFDRGELT |
| Ga0187766_105624423 | 3300018058 | Tropical Peatland | MPLAPAITDLDQLKERPALARLLAWDAGAVEAAKFDRDEL |
| Ga0187772_104002211 | 3300018085 | Tropical Peatland | LSLNPAITDLEQLKAHPAIARLQAWNPSAVEGVKFDRDEMSIYVER |
| Ga0187772_105354523 | 3300018085 | Tropical Peatland | MTLAPPITAVEQVKSHPAIARLLAWDPAVIEAVKFDRAEMSVVV |
| Ga0187772_110821101 | 3300018085 | Tropical Peatland | MPFAPAITDLAQLKNHPAVACLLEWNAAAVEGAKFDREEMTIYIER |
| Ga0187769_111747182 | 3300018086 | Tropical Peatland | MALSPPITGIEQLKSHPAIARLLAWNPPAIEAVKFD |
| Ga0187770_104218763 | 3300018090 | Tropical Peatland | MALAPAITDLEKLKEHPAVARLQAWNAAAVEGVKYDRGE |
| Ga0066662_112851301 | 3300018468 | Grasslands Soil | MALAPAVTDIEQLKAHPAVARIMGWNPQAVEGVKFDRDEMTIYVPRE |
| Ga0066669_111333001 | 3300018482 | Grasslands Soil | MALAAAVTDLDQLKSHPAIVRLLSWNPKAVEGVKFD |
| Ga0187800_14171711 | 3300019278 | Peatland | MPLAPAITDIEQVKNHPAVACLVAWNPAAVEGVKFDREEMTIYVER |
| Ga0187800_16954041 | 3300019278 | Peatland | MALAPAITDLEQLKGHPAVARLLAWNPAAVAGVKFDRDEMTIC |
| Ga0187800_18634922 | 3300019278 | Peatland | MPFAPPISDLEQLRNHPAVACLLEWNAAAVEGAKFDRDEMTLYIERGSIRE |
| Ga0193729_10086982 | 3300019887 | Soil | MPLEPAITDLEQLKNHPAIAKLTAWNPEAVEGAKLCGAVADP |
| Ga0193728_11991021 | 3300019890 | Soil | MALAPAVTDLEQLKGHPAISQLISWNPKVVEGVKFDRDEMTIYVERSAI |
| Ga0193731_11652402 | 3300020001 | Soil | MALAPAITDLELLKDHPALAVLLAWNKAGVEAAKFDHDEMTVW |
| Ga0179594_101038991 | 3300020170 | Vadose Zone Soil | MPLPPAITDLEQLKSHPAIAKLLAWNPVAVEEARFDRDEISIYINWD |
| Ga0210407_111482462 | 3300020579 | Soil | MAIAPPITDLEQLKTHPALAALLDWNPAAIQGVKFDRDEMTIVV |
| Ga0210403_105381983 | 3300020580 | Soil | MPLAPAITDLEQLKNHPAVARLVDWNREAVTRAKFDREEM |
| Ga0210395_105161771 | 3300020582 | Soil | MPLAPPITDIEQLKNHPAVARLVGWKADAITDVKFDRDEMTVYVDREHIRES |
| Ga0215015_109516901 | 3300021046 | Soil | MALTAAVTDLQELKSHPAIARLLAWNASAVQNAKFDLSLIHI |
| Ga0210404_101023473 | 3300021088 | Soil | MPLQPAITDLEELKNHPAVAKLLAWNPAAVEGAKFDRDEMSIYVE |
| Ga0210404_104469591 | 3300021088 | Soil | MALAPAITDLAQLKNHPAVARLVGWKAAAVTGVKFDREEMTLHIDR |
| Ga0210406_112874521 | 3300021168 | Soil | MSLTPAITDLAELKNHPAIARLLGWKESAVQSVKYDRDEMTIYVDRS |
| Ga0210400_113875312 | 3300021170 | Soil | MALAPAITDLEQLKGHPAIVKLQSWNAGSVEGAKFDRDEMTIYVERS |
| Ga0210400_115217652 | 3300021170 | Soil | MPLQPAITDLEELKNHPAVAKLLAWNPAAVEGAKFDRDEMSIY |
| Ga0210405_107222922 | 3300021171 | Soil | MPLAPPITDIEQLKNHPAVARLVGWKADAITDVKFDRDEMTVY |
| Ga0213873_102081181 | 3300021358 | Rhizosphere | MGLAPAVTDLEQLKGHPAVARLLSTNPAAVTAVKFD |
| Ga0210393_100513557 | 3300021401 | Soil | MPLAPPITDIEQLKNHPAVARLVGWKADAITDVKFDR |
| Ga0210393_101538535 | 3300021401 | Soil | VALVPAITDVEQLKGHPAVARLLAWNPAAVTGVKFD |
| Ga0210393_109398572 | 3300021401 | Soil | MPLAAAITDLEQLKNHPAVARLVGWNASAVEGAKFDREEMTIHIERGFIREA |
| Ga0210387_101099545 | 3300021405 | Soil | MPLAPAITDLEQLKNHPAVARLVGWNRAAVTGVKFDRDE |
| Ga0210387_114680402 | 3300021405 | Soil | MPLTPAITDLEALKDHPAVVRLRSWNSAAVEGAKFDRDEMTIYIERSLIREAC |
| Ga0210383_116569811 | 3300021407 | Soil | MGLAPAITDIEQLKGHPAVARLLAWNPAAVTGVKFDRDEMTI |
| Ga0210394_103172083 | 3300021420 | Soil | MPLTPAITDLEALKEHPAVARLRGWNSAAVEGAKFDRDEMTIYIERSCIHDAC |
| Ga0210394_104163491 | 3300021420 | Soil | VLTPAITDLGQLKEHPAVERLRSWNAAAVEGAKFDRDEISIYIERSSLREA |
| Ga0210391_115754762 | 3300021433 | Soil | MPLAPAITDLEQLKNHPAVARLVGWNPAAVTGVKFD |
| Ga0210398_109255221 | 3300021477 | Soil | VALVPAITDVEQLKGHPAVARLLAWNPAAVTGVKFDR |
| Ga0210398_110465981 | 3300021477 | Soil | MPLAPAITDLEKLRNHPAVARLVGWNAAAVTGVKFDREEMTIYVDRDHIR |
| Ga0210398_112013651 | 3300021477 | Soil | MATVPAITDLEELKSHPAVARLLAWNPSAVQGAKFDREEMTIYVD |
| Ga0210402_115808621 | 3300021478 | Soil | MPLAPAITDLEQLKNHPAVARLLDWNAEAVTGVKFGREEM |
| Ga0242669_10177831 | 3300022528 | Soil | MPLAPAITDLAELKNHPAIARLLGWKESAVQGVKFDREEMTI |
| Ga0224547_10205941 | 3300023255 | Soil | MALAPAITDLEQLKSHPAVARLLAWNPAAVMGGKFDR |
| Ga0208935_10569472 | 3300025414 | Peatland | MPTAPANTNLDELKSHPAVARLLAWNSAAVQGAKFDRE |
| Ga0207692_100467641 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MALVPAIIDIEQLKEHPALARILAWNRTAVESAKYDRDELTIVIDRAF |
| Ga0207642_102609821 | 3300025899 | Miscanthus Rhizosphere | MALVPAITDLEQLKDHPSIAKLLSWNPTAVEGAKFDREEL |
| Ga0207680_105306661 | 3300025903 | Switchgrass Rhizosphere | MPLQPAITDLEQLKQHPAIAALLAWNPSSVEGAKFDREEMSVYVERS |
| Ga0207647_106609322 | 3300025904 | Corn Rhizosphere | MPLPPAITDLEQLKNHPAVAKITAWNPAAVEGAKFDRDE |
| Ga0207643_110744841 | 3300025908 | Miscanthus Rhizosphere | MPLPPAITDLEQLKNHPAVAKITAWNPAAVEGAKFDRDEMSIYVERSSIRDVCE |
| Ga0207705_114664862 | 3300025909 | Corn Rhizosphere | MPLPPAITDLEQLKNHPAVAKITAWNPAAVEGAKFDRDEMSIYVERS |
| Ga0207695_104924891 | 3300025913 | Corn Rhizosphere | MPLQPAITDLEQLKQHPAIAALLAWNPSSVEGAKFDREEMSIYV |
| Ga0207652_112653511 | 3300025921 | Corn Rhizosphere | MPMAPPITDLEQLKNHPAIARLLAWNPQVVEGVKFDRDEMSIIVERSAI |
| Ga0207652_116943641 | 3300025921 | Corn Rhizosphere | MALAPAVTDLEQLKSHPAIARLLSWNEKAVEGVKFDRDEMTIYVQR |
| Ga0207694_100003831 | 3300025924 | Corn Rhizosphere | VALAQAVTDLEQLKGHPAVARLLAWNSKSVEGVKF |
| Ga0207664_109926171 | 3300025929 | Agricultural Soil | VAIAPAITDLEQLKGHPAVARLLEWNPASVVGVKFDRDEMTIYVDRENI |
| Ga0207644_103120133 | 3300025931 | Switchgrass Rhizosphere | MPLQPAITDLEQLKQHPAIAALLAWNPSSVEGAKFD |
| Ga0207706_116236871 | 3300025933 | Corn Rhizosphere | MPLVPAITDLEQLKDRPVVARLLSWRPEAVTGAKFDRDELTIWIEPKFIRGACA |
| Ga0207702_103616593 | 3300026078 | Corn Rhizosphere | MPLPPAITDLEQLKNHPAVAKITAWNPAAVEGAKFDRD |
| Ga0207702_105454063 | 3300026078 | Corn Rhizosphere | VPLAAAVTDIEQLKSHPAISRLLGWDPKVVESVKFDRD |
| Ga0209838_10250411 | 3300026214 | Soil | MPWPPAVTDLEQLKEHPAIAALIAWNPAAVEGAKYDRDETTIYI |
| Ga0209839_101038903 | 3300026294 | Soil | MPWPAAVTDLEQLKEHPAIAALIAWNSAAVEGAKYDRDETTIYIERSAIR |
| Ga0209839_102920501 | 3300026294 | Soil | MAWAPAITDLEQLKEHPAIARLLAWNTDSVTGAKF |
| Ga0209688_10565411 | 3300026305 | Soil | MALAPAVTDIQQLKSHPAIARLLSWNEGAVEGVKFD |
| Ga0209801_13424271 | 3300026326 | Soil | VALAPAITDLDQLKGHPAIGNLLAWNPAVVEGAKFDREEITIYVEH |
| Ga0209377_11978631 | 3300026334 | Soil | MPLVPAITDLEQLKDHPALALLLAWNPGAVQSAKYDRD |
| Ga0209056_102566094 | 3300026538 | Soil | MALAPAVTDLEQLKGHPAISRLLSSNPQVVEGVKFDRDEMT |
| Ga0209156_100467461 | 3300026547 | Soil | MSLQPAITDLEQLKSHPAIAKLLAWNPAAVEEAKFDR |
| Ga0179587_103941391 | 3300026557 | Vadose Zone Soil | MPFPPAITDLEQLKGHPAVARLLAWDPSAVQSVKYDRDEMTIWVVRSALREA |
| Ga0207763_10124961 | 3300026879 | Tropical Forest Soil | MALEPAVTDLEELKSHPEVACLVAWNAAAVEGAKFD |
| Ga0207741_10284561 | 3300026941 | Tropical Forest Soil | MALEPAVTDLEELKSHPEVACLVAWNAAAVEGAKFDRDE |
| Ga0208730_10238922 | 3300027047 | Forest Soil | VQLIPAITDLEALKDHPAVARLRSWNSAAVEGAKYDRDEM |
| Ga0209729_10285263 | 3300027061 | Forest Soil | MPLVPAITDVKQLKGHPAVARLSGWNAAAIEGVKFDRDEM |
| Ga0208365_10170671 | 3300027070 | Forest Soil | MAIAPKITDLEQLKTHPAVAALLDWNPGAIQGVRFDRDEMTII |
| Ga0209004_10398431 | 3300027376 | Forest Soil | MALAAPITDLAELKAHPALAPLLAWNPGAIPAVKFDRDEMSI |
| Ga0208042_10588401 | 3300027568 | Peatlands Soil | MPLAPAITDLEQLKERPPLARLLGWDADAVEAAKFDRDELT |
| Ga0208044_10517411 | 3300027625 | Peatlands Soil | MPITPAVTDLEALKDHPAVAKLRGWNSAAVEGAKFDRDEMTIYIERSSIR |
| Ga0209420_100373110 | 3300027648 | Forest Soil | MPLAPAITDLNELKDHPAIARLRSWNSAAVEGAKFDREEMTIYIERS |
| Ga0209626_10065131 | 3300027684 | Forest Soil | VTLVPAITNLEQLKSHPAVARLLAWNPTSVVGVKFDRDEMSISVDGANIREA |
| Ga0209446_10259064 | 3300027698 | Bog Forest Soil | MPLVPAITDLEALKDHPAVVRLRSWNSAAVEGAKFDRDE |
| Ga0209139_103146162 | 3300027795 | Bog Forest Soil | MPLSPAITDLELLKNHPAVARLMGWNAAAVEGARFDRDELTIHIERGSI |
| Ga0209139_103410222 | 3300027795 | Bog Forest Soil | MALTPAITDLEQLKGHPAVARLLAWNPAAVAGVKF |
| Ga0209656_102344043 | 3300027812 | Bog Forest Soil | MPWQAAITDLEQLKSHPAVARLAAWNPAAVEGAKFDRDEMSIYVER |
| Ga0209580_103868701 | 3300027842 | Surface Soil | MALAPAITDLEKLKEAPALARLLSWNAAAVTSAKFDRDELTLYIDRPYIREA |
| Ga0209580_104179172 | 3300027842 | Surface Soil | MPLTPAITDLEALKDHPAVARLRSWNLAAVEGAKFDRDEMTIYIERSCIRE |
| Ga0209166_104361943 | 3300027857 | Surface Soil | MPLAPAITDLEALKDHPAVARLRSWNSTAVEGAKFDRD |
| Ga0209166_104647261 | 3300027857 | Surface Soil | MAMAPAITDIEQLKDHPAVARLVAWNRAAVQGVKFDREEMTIYVE |
| Ga0209579_104181631 | 3300027869 | Surface Soil | MALAPAITDLEQLKSHPALACLLGWNSASVEGAKFDREE |
| Ga0209579_105015932 | 3300027869 | Surface Soil | MPLSPAITDIEELKNHPAVARIQGWNAQAIQAVKFDREEMTIVVDRS |
| Ga0209579_105290662 | 3300027869 | Surface Soil | MALAPAIIDLEELKNHPAVARLVGWKAEAVTGVKFD |
| Ga0209283_100553776 | 3300027875 | Vadose Zone Soil | MPFEAAITDLEQLKNHPAIAKLMAWNPAAVEGAKFDR |
| Ga0209283_101445114 | 3300027875 | Vadose Zone Soil | MPLAPAITDLEQLQTHPAIAKLLAWNPAAVEGAKFDRDEMTIYIERS |
| Ga0209275_102650463 | 3300027884 | Soil | VLTPAITDLEQLKEHPAVERLRSWNAAAVEGAKFDRDEISIYIERSSLREA |
| Ga0209583_106871531 | 3300027910 | Watersheds | VALTPPVTDVEQLKDHPALARLLDWNPAAVKEVKFDREEM |
| Ga0209069_109759401 | 3300027915 | Watersheds | MPLVPAITDLEALKDHPAVVRLRSWNSSAVEGAKFDREEMT |
| Ga0307301_102860351 | 3300028719 | Soil | MPLVPAITDLELLTKHFAVAQLLAWNRAAVLSAKFDRDELS |
| Ga0302156_104278422 | 3300028748 | Bog | MALAPAITDLQQLKDHPAVARLLEWSPSAVEGVKFDRDEMT |
| Ga0307282_103562231 | 3300028784 | Soil | MALAPAVTDLDQLKGHPAISRLLAWNPQAVEGVKFDRDEMTIYVERPTI |
| Ga0307504_101888751 | 3300028792 | Soil | MPLAPAITDLEQLKTHPAIAKLLAWNPAAVAGAKFDRDE |
| Ga0302227_104273931 | 3300028795 | Palsa | MPLSPAITDLEQLKTHPAVARLLAWNKDAVEGAKFDR |
| Ga0302228_103342691 | 3300028808 | Palsa | MPLAPAITDLEQLKNHPAVARLLGWNPQAVTGVKFDRDEM |
| Ga0308309_111160082 | 3300028906 | Soil | MAWPAPVTDLEKLKEHPAIARLLVWNPAAVEGAKYDRDETTIY |
| Ga0222749_100258556 | 3300029636 | Soil | MPLTPAVTDLQQLKTHPAIAKLLAWNSAAVEGAKFDRDETTIYIERSWLR |
| Ga0302141_11330871 | 3300029919 | Bog | MAWPRAIVDLEELKAHPTVAGLLAWNRAAVTGVKFDRDEMT |
| Ga0311371_103663481 | 3300029951 | Palsa | VALAPAITDLEQLKGHPAVGRLLAWNPSAVTEVKFDREE |
| Ga0311337_107143421 | 3300030000 | Fen | MPIAPTITDIEKLKEHPAIARLLAWNSAAVEGVKFDREEMTI |
| Ga0302177_103291813 | 3300030053 | Palsa | MPTAPAITNLDELKSHPAVARLLAWNSAVVQGAKFDREEMTIYVDR |
| Ga0302179_101027293 | 3300030058 | Palsa | MPLAPAITDLEQLKNHPAVARLLGWNPQAVTGVKF |
| Ga0311333_115304751 | 3300030114 | Fen | MPIAPAITDIQKLKEHPAIARLLDWNSAAVEGVKFDREEMTIYVGKAFIREVCA |
| Ga0311349_103699141 | 3300030294 | Fen | MALTPAITDLEQLKSHPPVARLLEWNAAAVQNAKFDRDE |
| Ga0310037_100840244 | 3300030494 | Peatlands Soil | MPITPAVTDLEALKDHPAVAKLRGWNSAAVEGAKFDRDEMTIYIERSSI |
| Ga0310037_103950991 | 3300030494 | Peatlands Soil | MPPTPAITDLEALKEHPAIARLRSWNSAAVEGAKFDRDEMTIYIERSCIRDA |
| Ga0311370_115965241 | 3300030503 | Palsa | MPLAPAITDLNELKDHPAVARLRSWNSTAVEGAKFDREEMTIYIER |
| Ga0316363_102196231 | 3300030659 | Peatlands Soil | MPLAPAITDLEALKEHPAVARLRSWNSAAVEGAKF |
| Ga0310038_100891844 | 3300030707 | Peatlands Soil | MPLAPAITDLEQLKNHPAVARLVGWNADAVTGVKFDRDEMTIYVD |
| Ga0307482_12630001 | 3300030730 | Hardwood Forest Soil | MALVPAITDLEELKHHPAVARLVGWNAAAVSGVKFDRDEMTI |
| Ga0302310_105550631 | 3300030737 | Palsa | VALAPAITDLEQLKGHPAVGRLLAWNPSAVTEVKFDREEMTIYIDRANLRE |
| Ga0265462_120736442 | 3300030738 | Soil | MPLAPAITDLEQLKNHPAVARLVGWNAEAVTGVKFDRDRKKKGKI |
| Ga0265462_121579572 | 3300030738 | Soil | MPTVPAITNLDELKSHPAVARLVAWNSTAVQGAKFDREEMT |
| Ga0265460_123820212 | 3300030740 | Soil | MPTVPAITNVDELKSHPAVARLVAWNSAAVQGAKFDREEMT |
| Ga0265769_1212881 | 3300030888 | Soil | MPLTPAITDLAALKDHPAVARLRSWNAAAVEAAKFD |
| Ga0170834_1075499143 | 3300031057 | Forest Soil | MALAPAVTKIEQLKGHPAVARLVGWNPDAVTGVKFDRD |
| Ga0170824_1021531951 | 3300031231 | Forest Soil | MALEPAVTDLEQLNSHAEVACLVGWNAGSVEAAKFDRNEL |
| Ga0170824_1071520882 | 3300031231 | Forest Soil | MALVPAITDLEQLKGHPAVARLLAWNPASVTGAKFDRDEMTIYV |
| Ga0302324_1000822646 | 3300031236 | Palsa | MPLVAAITDLEQLKTHPAVAGLLAWNPSAVAGVKFDREEMTICVDRTNLRE |
| Ga0302324_1019838872 | 3300031236 | Palsa | VSLAPAITDLEQLKGHPAVARLLVWNPAAVTGVKFDR |
| Ga0265339_100565631 | 3300031249 | Rhizosphere | MTLVPAITDLEELKNHPAVARLVGWNTSAVEGAKFDRDEMTIY |
| Ga0170820_100937732 | 3300031446 | Forest Soil | MPLAPAITDLEQLKNHPAIARLLGWNAEAVTGVKFDRDEMTLYVD |
| Ga0170818_1066161493 | 3300031474 | Forest Soil | MPLAPAITDLEQLKNHPAVARLVGWNAEAITGVKFDRDEMTIYVDR |
| Ga0170818_1070977771 | 3300031474 | Forest Soil | MALVPAVTDIEQLKAHPAISRLVSWNPLAVEGVKLEE |
| Ga0318538_100796055 | 3300031546 | Soil | MALSPPITDLEQLKSHPALVRLLEWNAKAVTGVKFDREEMTIY |
| Ga0310915_109105502 | 3300031573 | Soil | MALAPAITDLEQLKDHPAVARLLAWHPQAIERVKYD |
| Ga0307476_106773971 | 3300031715 | Hardwood Forest Soil | VTIAAAITDLEQLKGHPAVARLLEWNPSAVAGVKFDRDEMTIYVDRS |
| Ga0307476_113239191 | 3300031715 | Hardwood Forest Soil | VALVPAITDLEQLKAHPAVARLLAWNPSAVTGVKFDRDEMT |
| Ga0307474_116134572 | 3300031718 | Hardwood Forest Soil | MPLAPAITDLAELKNHPAIARLLGWKESAVQGVKFDRE |
| Ga0307469_102919963 | 3300031720 | Hardwood Forest Soil | MPGTAITNVEQLKGHPAVARLLAWNPAAIQGAKFDREEMTLSIERSLL |
| Ga0306918_104334843 | 3300031744 | Soil | MPLAPPITDIEQLKNHPAVARLLGWKDSAIQHVKFDRDEMTI |
| Ga0306918_111479032 | 3300031744 | Soil | MPLAAAITDIEQVKNHPAVVRLLGWKDSAIQSVKFDRDEM |
| Ga0307475_104266971 | 3300031754 | Hardwood Forest Soil | MALAPAVTDLEQLKGHPAIARLLAWNPKAVEGVKFDRDEMSIYVE |
| Ga0307475_114960231 | 3300031754 | Hardwood Forest Soil | VALSAAITDLEQLKGHPAVARLLAWNPAAVTGVKFDR |
| Ga0307478_104953153 | 3300031823 | Hardwood Forest Soil | MPLTPAITDLAELKDHPAVARLRSWNLAAVEGAKFDRDEMTIYIERSCIRDACVI |
| Ga0307478_106463761 | 3300031823 | Hardwood Forest Soil | MALAPAVTDLEQLKGHPAIARLIAWNQSAVEGVKFDREEMTIYVER |
| Ga0308175_1004965613 | 3300031938 | Soil | MPAQVTDIEQLKNHPAISKILAWSAEAIEQVKFDRDEMTIWV |
| Ga0310909_115784231 | 3300031947 | Soil | MPLAPPITDIEQLKNHPAVARLLGWKDSAIQSVKFDRDEMTIFVDR |
| Ga0306926_113009143 | 3300031954 | Soil | MPLAPAVTDIEQVKNHPAVARLLGWNDSAIQSVKFDRDEMTIYLDRSDIRE |
| Ga0307479_102944844 | 3300031962 | Hardwood Forest Soil | MPPQPAITDLEQLKNHPAVAKLVAWNPAAVEGAKFDRDEMSIYVERSCIRDAC |
| Ga0307479_117495022 | 3300031962 | Hardwood Forest Soil | MALAPAVTDLEQLKGHPAIARLIAWNPSAVESVKFDRDEM |
| Ga0318558_104609402 | 3300032044 | Soil | MAWDSAVTGVEQLKDCAEVGCLLAWNAAAVTQAKLDRKELTLW |
| Ga0318533_104178021 | 3300032059 | Soil | MALTPAVTDLEQLKEHPEVACLLAWKAAAVEGEKFDR |
| Ga0318540_102085563 | 3300032094 | Soil | MALSPPITDLEQLKSHPALVRLLEWNAKAVTGVKF |
| Ga0311301_109254643 | 3300032160 | Peatlands Soil | MALAPAITDLEQLKEHPAIARLLAWNAGSVEGTKFD |
| Ga0307470_103254853 | 3300032174 | Hardwood Forest Soil | MTLVPAITDLEQLKGHPAVARLLAWNPSSVVGVKF |
| Ga0307470_108601212 | 3300032174 | Hardwood Forest Soil | MPFQSAITDLEQLQNHPAVTKLLAWNRAAVEGAKFDRDEMSIYVERSLIR |
| Ga0307472_1010749341 | 3300032205 | Hardwood Forest Soil | MPLQPAITDLEQLRSHPAIAKLLAWNPAAVEEARFDRDEISIYINRDFIHQVCV |
| Ga0335082_101978331 | 3300032782 | Soil | MPQAPAITDVEQLKGHPAIARLRSWNGAAIAGVKFDR |
| Ga0335079_103241221 | 3300032783 | Soil | VALAPAITDLEQLKAHPAIARLLSWSPTAVEGAKFDREEM |
| Ga0335079_115073491 | 3300032783 | Soil | MPLAPAITDMEQLKSHPAVARLVGWNAAAVEGVKFD |
| Ga0335079_120535321 | 3300032783 | Soil | MPLAPAITDLEHLKDRPALARLLAWDPSAIEGAKFDREELTIVVKRG |
| Ga0335078_102413631 | 3300032805 | Soil | MPLAPAITDLDQLKERPALARLLAWNSGAVETAKLDRDELTIVVGRAA |
| Ga0335078_105537671 | 3300032805 | Soil | MPLSRAITDLDKLKDHPAVARLLGWNAGAIQGVKFDRDE |
| Ga0335080_104132694 | 3300032828 | Soil | MALAPAITDLEQLKGHPAVTRLFAWNPRAVEAAKFDRDEMTVVIERSAIR |
| Ga0335081_105597113 | 3300032892 | Soil | MPLAPAITDLEQLKNHPAVARLVGWNAEAVTGVKF |
| Ga0335081_118673193 | 3300032892 | Soil | MPLAPAITDLEQLKERPPLARLLAWDPGAVEGAKLDRDELTIV |
| Ga0335069_103818401 | 3300032893 | Soil | MTDLEQLKEHPAISRLRAWNPTVVEGAKFDREEMSLYIERSA |
| Ga0335069_126922711 | 3300032893 | Soil | MALTPAITDIEQLKDHPAVSRLVGWNAAAVEAVKFDREE |
| Ga0335075_110580461 | 3300032896 | Soil | MPPAPAITDLEQLKDHPAVARLLAWNRASVAGVKFDRDEMTIYVDR |
| Ga0335071_114239981 | 3300032897 | Soil | MTDLEQLKEHPAISRLRAWNPTVVEGAKFDREEMSLYIERSAIR |
| Ga0335076_105193293 | 3300032955 | Soil | MPLAPAITDLEQLKNHPAVACLLSWKQDVIQSIKYDRDEMTIVVD |
| Ga0335076_117371862 | 3300032955 | Soil | MPLPPAITDLEQLKGHPAIARLLEWKDAAVQSVKFDRDEMTIY |
| Ga0335084_104406591 | 3300033004 | Soil | MALAPAIRTIEALQERPALARLLAWKPAAVEAAVLD |
| Ga0335077_100064251 | 3300033158 | Soil | MPLAPPVTDLEQLKNHPAVARLLAWNSGAVERVKFDRDEMTVY |
| Ga0335077_107376703 | 3300033158 | Soil | MALEPAVTDLEQLKSHAEVACLLAWNAAAVEGAKFDR |
| Ga0318519_104572731 | 3300033290 | Soil | MALSPPITDLEQLKSHPALVRLLEWNAKAVTGVKFDREEM |
| Ga0310810_100464756 | 3300033412 | Soil | VALTPAITDLEQLKSHPALAKLLAWKQNAVTEAKFMD |
| Ga0310810_105034321 | 3300033412 | Soil | MALAPAVTNIEQLKGHPAVARLVGWNPDAVTGAKFDRD |
| Ga0326726_107543201 | 3300033433 | Peat Soil | MALAPAVTDLEQLKSHPAVARLLGWNAGSVQEAKFDRDELTLYVERSLL |
| Ga0314866_004709_1462_1596 | 3300033807 | Peatland | MPLVPAITDLEQLKSHPAVARLAGWNAAAIEGVKFDRDEMTISVE |
| Ga0334790_046685_2_118 | 3300033887 | Soil | MPLTPAITDLEALKEHPAVARLRGWNSAAVEGAKFDRDE |
| Ga0370515_0023913_3_146 | 3300034163 | Untreated Peat Soil | MPLAPAITDLEQLKNHPAVARLVDCNAEAVTGVKFDRDEMTVYVDRAF |
| Ga0370514_178755_3_119 | 3300034199 | Untreated Peat Soil | MPLAPAITDLEQLKNHPAVARLVDWNAEAVTGVKFDRDE |
| ⦗Top⦘ |