NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F007471

Metagenome / Metatranscriptome Family F007471

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F007471
Family Type Metagenome / Metatranscriptome
Number of Sequences 350
Average Sequence Length 43 residues
Representative Sequence QKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA
Number of Associated Samples 275
Number of Associated Scaffolds 350

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 46.86 %
% of genes near scaffold ends (potentially truncated) 40.00 %
% of genes from short scaffolds (< 2000 bps) 81.14 %
Associated GOLD sequencing projects 254
AlphaFold2 3D model prediction Yes
3D model pTM-score0.58

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.714 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(11.429 % of family members)
Environment Ontology (ENVO) Unclassified
(29.143 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(36.286 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 43.84%    β-sheet: 0.00%    Coil/Unstructured: 56.16%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.58
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 350 Family Scaffolds
PF02627CMD 24.29
PF01663Phosphodiest 16.86
PF02597ThiS 5.43
PF00296Bac_luciferase 4.29
PF03243MerB 2.86
PF13561adh_short_C2 2.57
PF00144Beta-lactamase 2.29
PF02738MoCoBD_1 2.29
PF01042Ribonuc_L-PSP 2.00
PF00275EPSP_synthase 1.71
PF05638T6SS_HCP 1.71
PF02668TauD 1.43
PF00501AMP-binding 1.14
PF13193AMP-binding_C 1.14
PF00496SBP_bac_5 1.14
PF00106adh_short 0.86
PF10282Lactonase 0.86
PF02335Cytochrom_C552 0.86
PF104171-cysPrx_C 0.57
PF02515CoA_transf_3 0.57
PF10518TAT_signal 0.57
PF02769AIRS_C 0.57
PF03328HpcH_HpaI 0.57
PF00248Aldo_ket_red 0.57
PF00230MIP 0.57
PF13565HTH_32 0.57
PF01522Polysacc_deac_1 0.57
PF00892EamA 0.57
PF01546Peptidase_M20 0.57
PF01979Amidohydro_1 0.57
PF03404Mo-co_dimer 0.57
PF04909Amidohydro_2 0.29
PF00561Abhydrolase_1 0.29
PF00990GGDEF 0.29
PF01799Fer2_2 0.29
PF08352oligo_HPY 0.29
PF11716MDMPI_N 0.29
PF09994DUF2235 0.29
PF14791DNA_pol_B_thumb 0.29
PF00753Lactamase_B 0.29
PF07690MFS_1 0.29
PF12867DinB_2 0.29
PF01425Amidase 0.29
PF12973Cupin_7 0.29
PF02894GFO_IDH_MocA_C 0.29
PF08282Hydrolase_3 0.29
PF01028Topoisom_I 0.29
PF01894UPF0047 0.29
PF02776TPP_enzyme_N 0.29
PF07969Amidohydro_3 0.29
PF03446NAD_binding_2 0.29
PF00211Guanylate_cyc 0.29
PF07486Hydrolase_2 0.29
PF01494FAD_binding_3 0.29
PF00486Trans_reg_C 0.29
PF01243Putative_PNPOx 0.29
PF03480DctP 0.29
PF07859Abhydrolase_3 0.29
PF00300His_Phos_1 0.29
PF04392ABC_sub_bind 0.29
PF00072Response_reg 0.29

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 350 Family Scaffolds
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 24.29
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 24.29
COG2104Sulfur carrier protein ThiS (thiamine biosynthesis)Coenzyme transport and metabolism [H] 5.43
COG1977Molybdopterin synthase sulfur carrier subunit MoaDCoenzyme transport and metabolism [H] 5.43
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 4.29
COG2367Beta-lactamase class ADefense mechanisms [V] 2.29
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 2.29
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 2.29
COG0251Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 familyDefense mechanisms [V] 2.00
COG3157Type VI protein secretion system component Hcp (secreted cytotoxin)Intracellular trafficking, secretion, and vesicular transport [U] 1.71
COG2175Taurine dioxygenase, alpha-ketoglutarate-dependentSecondary metabolites biosynthesis, transport and catabolism [Q] 1.43
COG3303Formate-dependent nitrite reductase, periplasmic cytochrome c552 subunitInorganic ion transport and metabolism [P] 0.86
COG38362-keto-3-deoxy-L-rhamnonate aldolase RhmACarbohydrate transport and metabolism [G] 0.57
COG2301Citrate lyase beta subunitCarbohydrate transport and metabolism [G] 0.57
COG1804Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferasesLipid transport and metabolism [I] 0.57
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 0.57
COG0469Pyruvate kinaseCarbohydrate transport and metabolism [G] 0.57
COG0580Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family)Carbohydrate transport and metabolism [G] 0.57
COG0726Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 familyCell wall/membrane/envelope biogenesis [M] 0.57
COG2217Cation-transporting P-type ATPaseInorganic ion transport and metabolism [P] 0.29
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 0.29
COG3773Cell wall hydrolase CwlJ, involved in spore germinationCell cycle control, cell division, chromosome partitioning [D] 0.29
COG3769Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamilyCarbohydrate transport and metabolism [G] 0.29
COG3569DNA topoisomerase IBReplication, recombination and repair [L] 0.29
COG0432Thiamin phosphate synthase YjbQ, UPF0047 familyCoenzyme transport and metabolism [H] 0.29
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 0.29
COG0560Phosphoserine phosphataseAmino acid transport and metabolism [E] 0.29
COG0561Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatasesCoenzyme transport and metabolism [H] 0.29
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.29
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 0.29
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 0.29
COG0657Acetyl esterase/lipaseLipid transport and metabolism [I] 0.29
COG1877Trehalose-6-phosphate phosphataseCarbohydrate transport and metabolism [G] 0.29
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 0.29
COG0673Predicted dehydrogenaseGeneral function prediction only [R] 0.29


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.71 %
UnclassifiedrootN/A2.29 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000363|ICChiseqgaiiFebDRAFT_11364671All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101700885All Organisms → cellular organisms → Bacteria1040Open in IMG/M
3300000955|JGI1027J12803_109354482All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria921Open in IMG/M
3300000956|JGI10216J12902_108077629All Organisms → cellular organisms → Bacteria838Open in IMG/M
3300002561|JGI25384J37096_10114410All Organisms → cellular organisms → Bacteria916Open in IMG/M
3300002561|JGI25384J37096_10249074All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300002886|JGI25612J43240_1013329All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1216Open in IMG/M
3300002886|JGI25612J43240_1064233All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria563Open in IMG/M
3300002909|JGI25388J43891_1014310All Organisms → cellular organisms → Bacteria1447Open in IMG/M
3300002914|JGI25617J43924_10167371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria742Open in IMG/M
3300004019|Ga0055439_10191833All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria651Open in IMG/M
3300004024|Ga0055436_10092099All Organisms → cellular organisms → Bacteria878Open in IMG/M
3300004052|Ga0055490_10244871All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300004268|Ga0066398_10160573All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300004463|Ga0063356_100331804All Organisms → cellular organisms → Bacteria1909Open in IMG/M
3300004463|Ga0063356_102891595All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300004479|Ga0062595_101111423All Organisms → cellular organisms → Bacteria692Open in IMG/M
3300004480|Ga0062592_102056723All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300005093|Ga0062594_100195795All Organisms → cellular organisms → Bacteria1401Open in IMG/M
3300005093|Ga0062594_102755770All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300005180|Ga0066685_10104453All Organisms → cellular organisms → Bacteria1894Open in IMG/M
3300005205|Ga0068999_10017461All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1045Open in IMG/M
3300005206|Ga0068995_10060315All Organisms → cellular organisms → Bacteria704Open in IMG/M
3300005295|Ga0065707_10042339All Organisms → cellular organisms → Bacteria707Open in IMG/M
3300005295|Ga0065707_10478204All Organisms → cellular organisms → Bacteria776Open in IMG/M
3300005328|Ga0070676_10027264All Organisms → cellular organisms → Bacteria3238Open in IMG/M
3300005332|Ga0066388_100069649All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3813Open in IMG/M
3300005332|Ga0066388_100342883All Organisms → cellular organisms → Bacteria2140Open in IMG/M
3300005332|Ga0066388_103098200All Organisms → cellular organisms → Bacteria849Open in IMG/M
3300005334|Ga0068869_100015229All Organisms → cellular organisms → Bacteria → Proteobacteria5154Open in IMG/M
3300005336|Ga0070680_100075032All Organisms → cellular organisms → Bacteria2783Open in IMG/M
3300005345|Ga0070692_10054669All Organisms → cellular organisms → Bacteria2085Open in IMG/M
3300005356|Ga0070674_101494483All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales607Open in IMG/M
3300005406|Ga0070703_10013859All Organisms → cellular organisms → Bacteria2291Open in IMG/M
3300005440|Ga0070705_100674988All Organisms → cellular organisms → Bacteria809Open in IMG/M
3300005444|Ga0070694_100562923All Organisms → cellular organisms → Bacteria914Open in IMG/M
3300005445|Ga0070708_100447275All Organisms → cellular organisms → Bacteria1219Open in IMG/M
3300005445|Ga0070708_102092545All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300005467|Ga0070706_101243690All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300005471|Ga0070698_100246214All Organisms → cellular organisms → Bacteria1720Open in IMG/M
3300005471|Ga0070698_101022798All Organisms → cellular organisms → Bacteria774Open in IMG/M
3300005471|Ga0070698_101704642All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300005518|Ga0070699_100404777All Organisms → cellular organisms → Bacteria1234Open in IMG/M
3300005518|Ga0070699_101726865All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300005526|Ga0073909_10627934All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300005536|Ga0070697_100272857All Organisms → cellular organisms → Bacteria1450Open in IMG/M
3300005540|Ga0066697_10064434All Organisms → cellular organisms → Bacteria → Proteobacteria2096Open in IMG/M
3300005545|Ga0070695_100049288All Organisms → cellular organisms → Bacteria2696Open in IMG/M
3300005545|Ga0070695_100599073All Organisms → cellular organisms → Bacteria865Open in IMG/M
3300005549|Ga0070704_100627472All Organisms → cellular organisms → Bacteria947Open in IMG/M
3300005553|Ga0066695_10074526All Organisms → cellular organisms → Bacteria2056Open in IMG/M
3300005568|Ga0066703_10506344All Organisms → cellular organisms → Bacteria716Open in IMG/M
3300005574|Ga0066694_10051645All Organisms → cellular organisms → Bacteria → Acidobacteria1872Open in IMG/M
3300005586|Ga0066691_10001062All Organisms → cellular organisms → Bacteria → Proteobacteria10259Open in IMG/M
3300005586|Ga0066691_10066132All Organisms → cellular organisms → Bacteria → Proteobacteria1972Open in IMG/M
3300005617|Ga0068859_100077617All Organisms → cellular organisms → Bacteria → Proteobacteria3362Open in IMG/M
3300005713|Ga0066905_100058199All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2412Open in IMG/M
3300005764|Ga0066903_100160227All Organisms → cellular organisms → Bacteria → Proteobacteria3260Open in IMG/M
3300005764|Ga0066903_100549409All Organisms → cellular organisms → Bacteria1980Open in IMG/M
3300005764|Ga0066903_102902976All Organisms → cellular organisms → Bacteria929Open in IMG/M
3300005764|Ga0066903_103538755All Organisms → cellular organisms → Bacteria842Open in IMG/M
3300005829|Ga0074479_10307350All Organisms → cellular organisms → Bacteria873Open in IMG/M
3300005843|Ga0068860_100655088All Organisms → cellular organisms → Bacteria → Proteobacteria1058Open in IMG/M
3300005844|Ga0068862_100191494All Organisms → cellular organisms → Bacteria1840Open in IMG/M
3300006034|Ga0066656_10068976All Organisms → cellular organisms → Bacteria2085Open in IMG/M
3300006049|Ga0075417_10076179All Organisms → cellular organisms → Bacteria → Proteobacteria1492Open in IMG/M
3300006049|Ga0075417_10167209All Organisms → cellular organisms → Bacteria → Proteobacteria1030Open in IMG/M
3300006050|Ga0075028_100096945All Organisms → cellular organisms → Bacteria1499Open in IMG/M
3300006358|Ga0068871_101897134All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300006806|Ga0079220_11221039All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria622Open in IMG/M
3300006844|Ga0075428_100018578All Organisms → cellular organisms → Bacteria → Proteobacteria7683Open in IMG/M
3300006844|Ga0075428_100627744All Organisms → cellular organisms → Bacteria1147Open in IMG/M
3300006845|Ga0075421_100131049All Organisms → cellular organisms → Bacteria3144Open in IMG/M
3300006845|Ga0075421_100149264All Organisms → cellular organisms → Bacteria2921Open in IMG/M
3300006845|Ga0075421_101998791All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300006847|Ga0075431_101011420All Organisms → cellular organisms → Bacteria798Open in IMG/M
3300006852|Ga0075433_10914638All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae765Open in IMG/M
3300006853|Ga0075420_100297795All Organisms → cellular organisms → Bacteria1399Open in IMG/M
3300006854|Ga0075425_100567912All Organisms → cellular organisms → Bacteria1305Open in IMG/M
3300006880|Ga0075429_101196826All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300006894|Ga0079215_10178936All Organisms → cellular organisms → Bacteria1048Open in IMG/M
3300006903|Ga0075426_11531622All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium507Open in IMG/M
3300006904|Ga0075424_100103556All Organisms → cellular organisms → Bacteria3002Open in IMG/M
3300006914|Ga0075436_100163100All Organisms → cellular organisms → Bacteria1572Open in IMG/M
3300006918|Ga0079216_10239020All Organisms → cellular organisms → Bacteria → Proteobacteria1028Open in IMG/M
3300006954|Ga0079219_10228823All Organisms → cellular organisms → Bacteria1084Open in IMG/M
3300007255|Ga0099791_10138952All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1132Open in IMG/M
3300007265|Ga0099794_10030765All Organisms → cellular organisms → Bacteria2509Open in IMG/M
3300007265|Ga0099794_10137200All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1237Open in IMG/M
3300009012|Ga0066710_100090758All Organisms → cellular organisms → Bacteria4037Open in IMG/M
3300009012|Ga0066710_102356453All Organisms → cellular organisms → Bacteria773Open in IMG/M
3300009012|Ga0066710_103581669All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium586Open in IMG/M
3300009038|Ga0099829_10337293All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1240Open in IMG/M
3300009089|Ga0099828_10004017All Organisms → cellular organisms → Bacteria10335Open in IMG/M
3300009089|Ga0099828_10565114All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1025Open in IMG/M
3300009090|Ga0099827_11249626All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300009100|Ga0075418_11174325All Organisms → cellular organisms → Bacteria832Open in IMG/M
3300009100|Ga0075418_12605134All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria552Open in IMG/M
3300009100|Ga0075418_13024951All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium512Open in IMG/M
3300009101|Ga0105247_11318511All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300009147|Ga0114129_10034060All Organisms → cellular organisms → Bacteria → Proteobacteria7195Open in IMG/M
3300009147|Ga0114129_12387694All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium633Open in IMG/M
3300009147|Ga0114129_13065148All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria547Open in IMG/M
3300009148|Ga0105243_12373532All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria568Open in IMG/M
3300009157|Ga0105092_10633276All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium619Open in IMG/M
3300009162|Ga0075423_10103031All Organisms → cellular organisms → Bacteria2987Open in IMG/M
3300009176|Ga0105242_12793906All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium538Open in IMG/M
3300009792|Ga0126374_10024591All Organisms → cellular organisms → Bacteria2713Open in IMG/M
3300009792|Ga0126374_10328464All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1039Open in IMG/M
3300009802|Ga0105073_1010002All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria844Open in IMG/M
3300009804|Ga0105063_1007150All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1116Open in IMG/M
3300009814|Ga0105082_1025250All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria921Open in IMG/M
3300009816|Ga0105076_1075505All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria632Open in IMG/M
3300009820|Ga0105085_1005273All Organisms → cellular organisms → Bacteria → Proteobacteria2152Open in IMG/M
3300010043|Ga0126380_10103600All Organisms → cellular organisms → Bacteria1714Open in IMG/M
3300010043|Ga0126380_10363954All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1059Open in IMG/M
3300010046|Ga0126384_10509015All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1039Open in IMG/M
3300010046|Ga0126384_10720666All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium886Open in IMG/M
3300010304|Ga0134088_10337523All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria731Open in IMG/M
3300010336|Ga0134071_10216600All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria947Open in IMG/M
3300010358|Ga0126370_10270921All Organisms → cellular organisms → Bacteria1329Open in IMG/M
3300010358|Ga0126370_10748752All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria865Open in IMG/M
3300010360|Ga0126372_10100549All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria2173Open in IMG/M
3300010360|Ga0126372_10162125All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1806Open in IMG/M
3300010361|Ga0126378_11899654All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria678Open in IMG/M
3300010362|Ga0126377_11108643All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria860Open in IMG/M
3300010366|Ga0126379_10090977All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria2680Open in IMG/M
3300010366|Ga0126379_11404158All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria804Open in IMG/M
3300010371|Ga0134125_10882717All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria982Open in IMG/M
3300010376|Ga0126381_101275298All Organisms → cellular organisms → Bacteria1062Open in IMG/M
3300010376|Ga0126381_103754336All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria594Open in IMG/M
3300010391|Ga0136847_10247606All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria703Open in IMG/M
3300010399|Ga0134127_10041705All Organisms → cellular organisms → Bacteria3745Open in IMG/M
3300010400|Ga0134122_11360969All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria721Open in IMG/M
3300011414|Ga0137442_1119670All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300011427|Ga0137448_1202908All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria550Open in IMG/M
3300011436|Ga0137458_1201976All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria604Open in IMG/M
3300011437|Ga0137429_1030181All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1559Open in IMG/M
3300012040|Ga0137461_1043189All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1212Open in IMG/M
3300012134|Ga0137330_1062279All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria500Open in IMG/M
3300012164|Ga0137352_1029585All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1048Open in IMG/M
3300012174|Ga0137338_1020768All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1287Open in IMG/M
3300012189|Ga0137388_10977333Not Available781Open in IMG/M
3300012202|Ga0137363_10948251All Organisms → cellular organisms → Bacteria → Proteobacteria731Open in IMG/M
3300012203|Ga0137399_10862342All Organisms → cellular organisms → Bacteria762Open in IMG/M
3300012203|Ga0137399_11423587All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300012205|Ga0137362_10111107All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria2317Open in IMG/M
3300012205|Ga0137362_10142991All Organisms → cellular organisms → Bacteria → Proteobacteria2041Open in IMG/M
3300012225|Ga0137434_1059928All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria590Open in IMG/M
3300012355|Ga0137369_10952665All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria573Open in IMG/M
3300012361|Ga0137360_10290809All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1354Open in IMG/M
3300012362|Ga0137361_11187892Not Available685Open in IMG/M
3300012899|Ga0157299_10237895All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria570Open in IMG/M
3300012917|Ga0137395_10964308All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria613Open in IMG/M
3300012917|Ga0137395_11068234All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium574Open in IMG/M
3300012922|Ga0137394_10106663All Organisms → cellular organisms → Bacteria2364Open in IMG/M
3300012925|Ga0137419_11267271All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300012927|Ga0137416_11101836All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium712Open in IMG/M
3300012929|Ga0137404_10009884All Organisms → cellular organisms → Bacteria → Proteobacteria6575Open in IMG/M
3300012929|Ga0137404_10717826All Organisms → cellular organisms → Bacteria905Open in IMG/M
3300012930|Ga0137407_10066776All Organisms → cellular organisms → Bacteria2981Open in IMG/M
3300012930|Ga0137407_10558041All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1073Open in IMG/M
3300012930|Ga0137407_10608453All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1026Open in IMG/M
3300012930|Ga0137407_11845123All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia576Open in IMG/M
3300012931|Ga0153915_10161733All Organisms → cellular organisms → Bacteria → Proteobacteria2434Open in IMG/M
3300012931|Ga0153915_10811906All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1085Open in IMG/M
3300012944|Ga0137410_10352325All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1177Open in IMG/M
3300012944|Ga0137410_11800582All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300012948|Ga0126375_12040600All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300012961|Ga0164302_11674021All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria532Open in IMG/M
3300012971|Ga0126369_12867963All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria564Open in IMG/M
3300012976|Ga0134076_10009691All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3260Open in IMG/M
3300012986|Ga0164304_11019841All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria657Open in IMG/M
3300014326|Ga0157380_11415624All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria746Open in IMG/M
3300014867|Ga0180076_1092091All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria558Open in IMG/M
3300014882|Ga0180069_1095005All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria706Open in IMG/M
3300014883|Ga0180086_1160651All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria585Open in IMG/M
3300015241|Ga0137418_10091970All Organisms → cellular organisms → Bacteria → Proteobacteria2739Open in IMG/M
3300015264|Ga0137403_10131758All Organisms → cellular organisms → Bacteria → Proteobacteria2482Open in IMG/M
3300015264|Ga0137403_10198478All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1940Open in IMG/M
3300015264|Ga0137403_10751718All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria833Open in IMG/M
3300015264|Ga0137403_11442432All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium537Open in IMG/M
3300015359|Ga0134085_10027833All Organisms → cellular organisms → Bacteria2188Open in IMG/M
3300015371|Ga0132258_10685729All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria2578Open in IMG/M
3300015371|Ga0132258_12537364All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1282Open in IMG/M
3300017654|Ga0134069_1095040All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium969Open in IMG/M
3300017656|Ga0134112_10027138All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1999Open in IMG/M
3300017930|Ga0187825_10043980All Organisms → cellular organisms → Bacteria1511Open in IMG/M
3300017966|Ga0187776_10035297All Organisms → cellular organisms → Bacteria → Proteobacteria2797Open in IMG/M
3300017993|Ga0187823_10025386All Organisms → cellular organisms → Bacteria → Proteobacteria1517Open in IMG/M
3300017994|Ga0187822_10006371All Organisms → cellular organisms → Bacteria → Proteobacteria2689Open in IMG/M
3300017997|Ga0184610_1031496All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1490Open in IMG/M
3300018031|Ga0184634_10394704All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria632Open in IMG/M
3300018052|Ga0184638_1183674All Organisms → cellular organisms → Bacteria742Open in IMG/M
3300018053|Ga0184626_10004567All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria5197Open in IMG/M
3300018053|Ga0184626_10167238All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria934Open in IMG/M
3300018054|Ga0184621_10038746All Organisms → cellular organisms → Bacteria1554Open in IMG/M
3300018059|Ga0184615_10282724All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria927Open in IMG/M
3300018061|Ga0184619_10144550All Organisms → cellular organisms → Bacteria1084Open in IMG/M
3300018063|Ga0184637_10097566All Organisms → cellular organisms → Bacteria → Proteobacteria1808Open in IMG/M
3300018074|Ga0184640_10279799All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria758Open in IMG/M
3300018076|Ga0184609_10050832All Organisms → cellular organisms → Bacteria1769Open in IMG/M
3300018076|Ga0184609_10324885All Organisms → cellular organisms → Bacteria719Open in IMG/M
3300018077|Ga0184633_10027582All Organisms → cellular organisms → Bacteria2832Open in IMG/M
3300018079|Ga0184627_10063970All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1917Open in IMG/M
3300018084|Ga0184629_10209879All Organisms → cellular organisms → Bacteria1009Open in IMG/M
3300018089|Ga0187774_10053072All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1807Open in IMG/M
3300018422|Ga0190265_10250496All Organisms → cellular organisms → Bacteria → Proteobacteria1817Open in IMG/M
3300018422|Ga0190265_10691342All Organisms → cellular organisms → Bacteria1142Open in IMG/M
3300018422|Ga0190265_11787126All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria723Open in IMG/M
3300018433|Ga0066667_10040493All Organisms → cellular organisms → Bacteria2720Open in IMG/M
3300018433|Ga0066667_11421239All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria610Open in IMG/M
3300019255|Ga0184643_1246542All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria513Open in IMG/M
3300019458|Ga0187892_10031168All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria4336Open in IMG/M
3300019458|Ga0187892_10230940All Organisms → cellular organisms → Bacteria964Open in IMG/M
3300019487|Ga0187893_10093974All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria2682Open in IMG/M
3300019487|Ga0187893_10438458All Organisms → cellular organisms → Bacteria871Open in IMG/M
3300019487|Ga0187893_10439868All Organisms → cellular organisms → Bacteria869Open in IMG/M
3300019789|Ga0137408_1088551All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1025Open in IMG/M
3300019789|Ga0137408_1299379All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria540Open in IMG/M
3300019879|Ga0193723_1031465All Organisms → cellular organisms → Bacteria1597Open in IMG/M
3300019881|Ga0193707_1011698All Organisms → cellular organisms → Bacteria2972Open in IMG/M
3300019881|Ga0193707_1153932All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium638Open in IMG/M
3300019999|Ga0193718_1020264All Organisms → cellular organisms → Bacteria1478Open in IMG/M
3300020004|Ga0193755_1003505All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae4989Open in IMG/M
3300020004|Ga0193755_1110556All Organisms → cellular organisms → Bacteria863Open in IMG/M
3300020021|Ga0193726_1149668All Organisms → cellular organisms → Bacteria1018Open in IMG/M
3300020065|Ga0180113_1043699Not Available880Open in IMG/M
3300020067|Ga0180109_1346960All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1436Open in IMG/M
3300021073|Ga0210378_10040882All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1838Open in IMG/M
3300021086|Ga0179596_10695347Not Available515Open in IMG/M
3300021088|Ga0210404_10178860All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1127Open in IMG/M
3300021445|Ga0182009_10060612All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1631Open in IMG/M
3300021560|Ga0126371_12458274All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria630Open in IMG/M
3300021560|Ga0126371_13728661All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria514Open in IMG/M
3300021972|Ga0193737_1007207All Organisms → cellular organisms → Bacteria1497Open in IMG/M
3300022534|Ga0224452_1166651All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300024246|Ga0247680_1067813All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300025160|Ga0209109_10229275All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria907Open in IMG/M
3300025165|Ga0209108_10165034All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1160Open in IMG/M
3300025324|Ga0209640_10513935All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria975Open in IMG/M
3300025569|Ga0210073_1141013All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium524Open in IMG/M
3300025885|Ga0207653_10002075All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria6382Open in IMG/M
3300025899|Ga0207642_10596505All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium687Open in IMG/M
3300025907|Ga0207645_10021541All Organisms → cellular organisms → Bacteria4202Open in IMG/M
3300025910|Ga0207684_10051267All Organisms → cellular organisms → Bacteria3501Open in IMG/M
3300025910|Ga0207684_10084211All Organisms → cellular organisms → Bacteria → Proteobacteria2708Open in IMG/M
3300025910|Ga0207684_10347223All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1277Open in IMG/M
3300025911|Ga0207654_11306624All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300025912|Ga0207707_10128642All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria2215Open in IMG/M
3300025912|Ga0207707_11077624All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria656Open in IMG/M
3300025912|Ga0207707_11207469Not Available612Open in IMG/M
3300025916|Ga0207663_10269879All Organisms → cellular organisms → Bacteria1260Open in IMG/M
3300025917|Ga0207660_10405808All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1098Open in IMG/M
3300025922|Ga0207646_11040943All Organisms → cellular organisms → Bacteria722Open in IMG/M
3300025923|Ga0207681_10533696All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium964Open in IMG/M
3300025923|Ga0207681_10999838All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300025925|Ga0207650_10034266All Organisms → cellular organisms → Bacteria3682Open in IMG/M
3300025930|Ga0207701_10769650Not Available812Open in IMG/M
3300025934|Ga0207686_10117776All Organisms → cellular organisms → Bacteria → Proteobacteria1803Open in IMG/M
3300025945|Ga0207679_10042783All Organisms → cellular organisms → Bacteria3257Open in IMG/M
3300025957|Ga0210089_1024041All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium726Open in IMG/M
3300025962|Ga0210070_1004350All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1475Open in IMG/M
3300025971|Ga0210102_1042097All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria987Open in IMG/M
3300026048|Ga0208915_1031476All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria503Open in IMG/M
3300026298|Ga0209236_1149521All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium988Open in IMG/M
3300026309|Ga0209055_1046915All Organisms → cellular organisms → Bacteria1882Open in IMG/M
3300026333|Ga0209158_1124839All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium961Open in IMG/M
3300026333|Ga0209158_1191000All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria723Open in IMG/M
3300026334|Ga0209377_1347673All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300026351|Ga0257170_1020177All Organisms → cellular organisms → Bacteria872Open in IMG/M
3300026355|Ga0257149_1015901All Organisms → cellular organisms → Bacteria1006Open in IMG/M
3300026358|Ga0257166_1002656All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae1839Open in IMG/M
3300026361|Ga0257176_1085971All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria515Open in IMG/M
3300026371|Ga0257179_1002118All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1561Open in IMG/M
3300026480|Ga0257177_1052140All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria635Open in IMG/M
3300026508|Ga0257161_1012941All Organisms → cellular organisms → Bacteria1533Open in IMG/M
3300026540|Ga0209376_1111813All Organisms → cellular organisms → Bacteria1375Open in IMG/M
3300026548|Ga0209161_10063002All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2362Open in IMG/M
3300026551|Ga0209648_10003569All Organisms → cellular organisms → Bacteria13088Open in IMG/M
3300027068|Ga0209898_1011634All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1062Open in IMG/M
3300027511|Ga0209843_1095856All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria501Open in IMG/M
3300027562|Ga0209735_1068611All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium766Open in IMG/M
3300027577|Ga0209874_1006179All Organisms → cellular organisms → Bacteria3602Open in IMG/M
3300027671|Ga0209588_1067682All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1154Open in IMG/M
3300027681|Ga0208991_1125457All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria764Open in IMG/M
3300027761|Ga0209462_10170893All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300027775|Ga0209177_10098358All Organisms → cellular organisms → Bacteria924Open in IMG/M
3300027846|Ga0209180_10296445All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium927Open in IMG/M
3300027862|Ga0209701_10104810All Organisms → cellular organisms → Bacteria → Proteobacteria1764Open in IMG/M
3300027873|Ga0209814_10087849All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1314Open in IMG/M
3300027880|Ga0209481_10142468All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1179Open in IMG/M
3300027880|Ga0209481_10351903All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria751Open in IMG/M
3300027886|Ga0209486_10365626Not Available866Open in IMG/M
3300027907|Ga0207428_10125601All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1965Open in IMG/M
3300027909|Ga0209382_10223043All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria2151Open in IMG/M
3300027909|Ga0209382_11490599All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300027909|Ga0209382_11556744All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria656Open in IMG/M
3300027947|Ga0209868_1012991All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium823Open in IMG/M
3300027952|Ga0209889_1079164All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria668Open in IMG/M
3300028047|Ga0209526_10332117All Organisms → cellular organisms → Bacteria1022Open in IMG/M
3300028381|Ga0268264_10880308All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria898Open in IMG/M
3300028792|Ga0307504_10311708All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria595Open in IMG/M
3300028799|Ga0307284_10424563All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria542Open in IMG/M
3300028803|Ga0307281_10036211All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1502Open in IMG/M
3300028828|Ga0307312_11009625All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium551Open in IMG/M
3300028878|Ga0307278_10091727All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1367Open in IMG/M
3300030620|Ga0302046_10711090All Organisms → cellular organisms → Bacteria813Open in IMG/M
3300031229|Ga0299913_11715389All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300031421|Ga0308194_10401504All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria500Open in IMG/M
3300031548|Ga0307408_100055562All Organisms → cellular organisms → Bacteria2867Open in IMG/M
3300031548|Ga0307408_100306803All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1332Open in IMG/M
3300031716|Ga0310813_10012920All Organisms → cellular organisms → Bacteria → Proteobacteria5464Open in IMG/M
3300031720|Ga0307469_10082684All Organisms → cellular organisms → Bacteria2181Open in IMG/M
3300031731|Ga0307405_10280133All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1255Open in IMG/M
3300031731|Ga0307405_10854416All Organisms → cellular organisms → Bacteria → Proteobacteria766Open in IMG/M
3300031736|Ga0318501_10121612All Organisms → cellular organisms → Bacteria1322Open in IMG/M
3300031740|Ga0307468_101135961All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium699Open in IMG/M
3300031832|Ga0318499_10220945All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria738Open in IMG/M
3300031834|Ga0315290_10498552All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1063Open in IMG/M
3300031854|Ga0310904_11279800All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria531Open in IMG/M
3300031892|Ga0310893_10524463All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria534Open in IMG/M
3300031965|Ga0326597_11215276All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria743Open in IMG/M
3300032000|Ga0310903_10526061All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300032075|Ga0310890_11415904All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria571Open in IMG/M
3300032174|Ga0307470_10039686All Organisms → cellular organisms → Bacteria2321Open in IMG/M
3300032174|Ga0307470_11507824All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria559Open in IMG/M
3300032205|Ga0307472_100677483All Organisms → cellular organisms → Bacteria923Open in IMG/M
3300032205|Ga0307472_101881146All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria596Open in IMG/M
3300032770|Ga0335085_10010878All Organisms → cellular organisms → Bacteria13552Open in IMG/M
3300032770|Ga0335085_10575952All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1271Open in IMG/M
3300032954|Ga0335083_10862494All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria721Open in IMG/M
3300033004|Ga0335084_11587901All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium645Open in IMG/M
3300033158|Ga0335077_11254213All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium723Open in IMG/M
3300033432|Ga0326729_1064946All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300033433|Ga0326726_10610257All Organisms → cellular organisms → Bacteria1049Open in IMG/M
3300033480|Ga0316620_12120350All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria559Open in IMG/M
3300033501|Ga0326732_1017905All Organisms → cellular organisms → Bacteria1234Open in IMG/M
3300033513|Ga0316628_100123598All Organisms → cellular organisms → Bacteria2966Open in IMG/M
3300033550|Ga0247829_10185911All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1643Open in IMG/M
3300033550|Ga0247829_10285683All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1336Open in IMG/M
3300033807|Ga0314866_070310All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria598Open in IMG/M
3300033811|Ga0364924_038134All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1001Open in IMG/M
3300033812|Ga0364926_110472Not Available572Open in IMG/M
3300033814|Ga0364930_0305131All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria535Open in IMG/M
3300034164|Ga0364940_0202429All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria581Open in IMG/M
3300034165|Ga0364942_0030239All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1730Open in IMG/M
3300034176|Ga0364931_0080213All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1017Open in IMG/M
3300034177|Ga0364932_0371700All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium539Open in IMG/M
3300034818|Ga0373950_0072174All Organisms → cellular organisms → Bacteria709Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil11.43%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere8.29%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.57%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.29%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.14%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment4.29%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.71%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil3.43%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.14%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand2.86%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands2.57%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.57%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.00%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment2.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.71%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.71%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.71%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.43%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.14%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.14%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.14%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.14%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.86%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.86%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.86%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.86%
Microbial Mat On RocksEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks0.86%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.86%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.86%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.86%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.57%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.57%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.57%
Bio-OozeEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze0.57%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.57%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.57%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.57%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.29%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.29%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment0.29%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.29%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.29%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.29%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.29%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.29%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.29%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.29%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.29%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.29%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.29%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.29%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.29%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.29%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.29%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.29%
AgaveHost-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave0.29%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000363Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cmEnvironmentalOpen in IMG/M
3300002886Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cmEnvironmentalOpen in IMG/M
3300002909Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cmEnvironmentalOpen in IMG/M
3300002914Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cmEnvironmentalOpen in IMG/M
3300004019Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2EnvironmentalOpen in IMG/M
3300004024Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2EnvironmentalOpen in IMG/M
3300004052Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2EnvironmentalOpen in IMG/M
3300004268Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBioEnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005205Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D2EnvironmentalOpen in IMG/M
3300005206Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D2EnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005829Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBCEnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009802Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_50_60EnvironmentalOpen in IMG/M
3300009804Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40EnvironmentalOpen in IMG/M
3300009814Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60EnvironmentalOpen in IMG/M
3300009816Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10EnvironmentalOpen in IMG/M
3300009820Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011414Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT266_2EnvironmentalOpen in IMG/M
3300011427Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT418_2EnvironmentalOpen in IMG/M
3300011436Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2EnvironmentalOpen in IMG/M
3300011437Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2EnvironmentalOpen in IMG/M
3300012040Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT746_2EnvironmentalOpen in IMG/M
3300012134Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT142_2EnvironmentalOpen in IMG/M
3300012164Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT730_2EnvironmentalOpen in IMG/M
3300012174Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT366_2EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012225Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT860_2EnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2EnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014867Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT433_16_10DEnvironmentalOpen in IMG/M
3300014882Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231B'_16_10DEnvironmentalOpen in IMG/M
3300014883Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10DEnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300017656Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015EnvironmentalOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300017993Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3EnvironmentalOpen in IMG/M
3300017994Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2EnvironmentalOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018053Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1EnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018059Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coexEnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018077Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1EnvironmentalOpen in IMG/M
3300018079Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1EnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300019255Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019458Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaGEnvironmentalOpen in IMG/M
3300019487White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaGEnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300019881Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2EnvironmentalOpen in IMG/M
3300019999Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1EnvironmentalOpen in IMG/M
3300020004Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2EnvironmentalOpen in IMG/M
3300020021Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1EnvironmentalOpen in IMG/M
3300020065Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT499_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020067Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT47_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redoEnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300021972Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2m2EnvironmentalOpen in IMG/M
3300022534Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1EnvironmentalOpen in IMG/M
3300024246Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK21EnvironmentalOpen in IMG/M
3300025160Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2EnvironmentalOpen in IMG/M
3300025165Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1EnvironmentalOpen in IMG/M
3300025324Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025569Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025957Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025962Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025971Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026048Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026298Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300026333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes)EnvironmentalOpen in IMG/M
3300026334Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes)EnvironmentalOpen in IMG/M
3300026351Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-BEnvironmentalOpen in IMG/M
3300026355Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-AEnvironmentalOpen in IMG/M
3300026358Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-BEnvironmentalOpen in IMG/M
3300026361Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-BEnvironmentalOpen in IMG/M
3300026371Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-BEnvironmentalOpen in IMG/M
3300026480Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-BEnvironmentalOpen in IMG/M
3300026508Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-AEnvironmentalOpen in IMG/M
3300026540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)EnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300027068Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_50_60 (SPAdes)EnvironmentalOpen in IMG/M
3300027511Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027562Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027577Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027671Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027681Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027761Agave microbial communities from Guanajuato, Mexico - As.Sf.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300027947Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_40_50 (SPAdes)EnvironmentalOpen in IMG/M
3300027952Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300030620Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111EnvironmentalOpen in IMG/M
3300031229Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38EnvironmentalOpen in IMG/M
3300031421Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031834Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031892Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033432Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF6AY SIP fractionEnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033480Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_BEnvironmentalOpen in IMG/M
3300033501Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF12FN SIP fractionEnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300033807Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10EnvironmentalOpen in IMG/M
3300033811Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17EnvironmentalOpen in IMG/M
3300033812Sediment microbial communities from East River floodplain, Colorado, United States - 65_j17EnvironmentalOpen in IMG/M
3300033814Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17EnvironmentalOpen in IMG/M
3300034164Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17EnvironmentalOpen in IMG/M
3300034165Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17EnvironmentalOpen in IMG/M
3300034176Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17EnvironmentalOpen in IMG/M
3300034177Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17EnvironmentalOpen in IMG/M
3300034818Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ICChiseqgaiiFebDRAFT_1136467123300000363SoilVDDALWAEMRRQFTEAEIIELVAHTTLYIGFGRFNEIVG
INPhiseqgaiiFebDRAFT_10170088523300000364SoilVDHHKVDDALWAELRKHFSEADLIELTMHTTLYIGLGRFNEIVGLDPA*
JGI1027J12803_10935448233300000955SoilEMRSHFSEAEIIELVAHTTLYIGFGRFNEIVGLDPA*
JGI10216J12902_10807762913300000956SoilKIDDALWTEMRSQFTEPEVIELVAHTTLYIGFGRFNEIIGLDPA*
JGI25384J37096_1011441023300002561Grasslands SoilDALWSELRGHFSEAEIIELVANATLFIGWGRFNAIXGLDPS*
JGI25384J37096_1024907413300002561Grasslands SoilKVDDALWSELRGHFSEAEIIELVANATLFIGWGRFNAIVGLDPS*
JGI25612J43240_101332923300002886Grasslands SoilVDHNKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA*
JGI25612J43240_106423313300002886Grasslands SoilVDHQKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA*
JGI25388J43891_101431013300002909Grasslands SoilDDALWSEVRAHFSEAEVIELVAHTTLYIGFGRFNEIVGLDPA*
JGI25617J43924_1016737123300002914Grasslands SoilVDHQKVDEALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA*
Ga0055439_1019183313300004019Natural And Restored WetlandsAVDHQKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIEPA*
Ga0055436_1009209933300004024Natural And Restored WetlandsALWSEMRQHFSEAEIIELVAHTTLYIGFGRFNEIVGLDPA*
Ga0055490_1024487123300004052Natural And Restored WetlandsVDHQKVDDRLWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA*
Ga0066398_1016057313300004268Tropical Forest SoilVDEALWSELREHFSEAEIIELVAHTTLYIGWGRFNEIVGIDPA*
Ga0063356_10033180433300004463Arabidopsis Thaliana RhizosphereALWAEVRAQFSEAEVIELVAHTTLFIGFGRFNEIVGIEPA*
Ga0063356_10289159523300004463Arabidopsis Thaliana RhizosphereVDDALWADLRAQFSEAEIIELTMHTMVFIGMGRFNEIIGL*
Ga0062595_10111142323300004479SoilLWAELRQHFSEAEIIELTAHTTLYIGFGRFNEIVGLDPA*
Ga0062592_10205672323300004480SoilVDDALWAEMRRQFTEAEIIELVAHTTLYIGFGRFNEIVGLDPA*
Ga0062594_10019579533300005093SoilVDHHKVDEPQWAEMRSHFSEAEIIELVAHTTLYIGFGRFNEIVGLDPA*
Ga0062594_10275577023300005093SoilVDDALWTDLRAQFSEAEIIELTMHAMVFIGMGRFNEIVGLDPV*
Ga0066685_1010445333300005180SoilHRKVDDALWAELRGHFSEAEIIELVASATLFIGWGRFNEIIGIDPA*
Ga0068999_1001746123300005205Natural And Restored WetlandsVDHQKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIEPG*
Ga0068995_1006031513300005206Natural And Restored WetlandsVDHQKVDDTLWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGI
Ga0065707_1004233913300005295Switchgrass RhizosphereVDHXKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA*
Ga0065707_1047820423300005295Switchgrass RhizosphereVDHQKVDDALWAEVREQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA*
Ga0070676_1002726443300005328Miscanthus RhizosphereVDHHKVDDALWAEVRGQFSEAEVIELVAHTTLYIGFGRFNEVVGIDPA*
Ga0066388_10006964953300005332Tropical Forest SoilVDHQKIDDVLWTELRRQFTEAELIELAAHTTLYIGFGRFNEVVGLDPA*
Ga0066388_10034288343300005332Tropical Forest SoilVDDELWAELRAQFSEAEIIELVAHTTLYIGYGRFNEILGIDPA*
Ga0066388_10309820023300005332Tropical Forest SoilVDEALWSELREHLSEAEIIELVAHTTLYIGWGRFNEIVGIDPA*
Ga0068869_10001522943300005334Miscanthus RhizosphereVDHHKVDDALWAEVRGQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA*
Ga0070680_10007503233300005336Corn RhizosphereVDHNKVDDALWAEVRAQFSEAEVIELVAHTTLFIGFGRFNEIVGIEPA*
Ga0070692_1005466913300005345Corn, Switchgrass And Miscanthus RhizosphereVDHQKVDDALWAEMRRQFTEAEIIELVAHTTLYIGFGRFNEIVGLD
Ga0070674_10149448323300005356Miscanthus RhizosphereVDHHKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA*
Ga0070703_1001385933300005406Corn, Switchgrass And Miscanthus RhizosphereVDHQKVDDALWAEMRRQFTEAEIIELVAHTTLYIGFGRFNEIVGLDPA*
Ga0070705_10067498823300005440Corn, Switchgrass And Miscanthus RhizosphereVDHQKVDDDLWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA*
Ga0070694_10056292323300005444Corn, Switchgrass And Miscanthus RhizosphereVDDALWSDVRHHLSEAEVIELVAHTTLYIGFGRFNEIVGLDPA*
Ga0070708_10044727513300005445Corn, Switchgrass And Miscanthus RhizosphereVDHHKVDDTLWAEMRRHFSEAEIIELVAHTTLYIGFGRFNEIVGLDPA*
Ga0070708_10209254513300005445Corn, Switchgrass And Miscanthus RhizosphereVDHQKIDDDLWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA*
Ga0070706_10124369013300005467Corn, Switchgrass And Miscanthus RhizosphereAQWAELRSHFSDAEVIELVAHTTLYIGFGRFNEIVGLDPS*
Ga0070698_10024621423300005471Corn, Switchgrass And Miscanthus RhizosphereVDHQKVDEALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVRIDPA*
Ga0070698_10102279823300005471Corn, Switchgrass And Miscanthus RhizosphereVDDALWSELREHFSEAEIIELVAHTTLYIGFGRFNEIVGLDPATPTDA*
Ga0070698_10170464223300005471Corn, Switchgrass And Miscanthus RhizosphereVDDALWSEMRRQFTEAEIIELVAHTTLFIGFGRFNEIVGLDPA*
Ga0070699_10040477743300005518Corn, Switchgrass And Miscanthus RhizosphereMWAEMRSHFSEAEIIELVAHTTLFIGFGRFNEIVGLEPA*
Ga0070699_10172686513300005518Corn, Switchgrass And Miscanthus RhizosphereDAFWQELRSHFTEAEIIELTAHTTIYIGWGRFNDVVGIDVD*
Ga0073909_1062793423300005526Surface SoilVDHEKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA*
Ga0070697_10027285713300005536Corn, Switchgrass And Miscanthus RhizosphereVDHQKVDDALWSEMRRQFTEAEIIELVAHTTLFIGFGRFNEIVGIEPA*
Ga0066697_1006443433300005540SoilMRRHFSEAEIIELVAHTTLYIGFGRFNEIVGLDPA*
Ga0070695_10004928833300005545Corn, Switchgrass And Miscanthus RhizosphereVDHNKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEVVGIDPA*
Ga0070695_10059907313300005545Corn, Switchgrass And Miscanthus RhizosphereVDHQKVDDALWSEMRRQFTEAEIIELVAHTTLFIGFGRFNEIV
Ga0070704_10062747223300005549Corn, Switchgrass And Miscanthus RhizosphereVDETLWSELRSHFSEAEIIELVAHTTLYIGWGRFNEIVGIDPA*
Ga0066695_1007452623300005553SoilVRAHFSEAEVIELVAHTTLYIGFGRFNEIVGLDPA*
Ga0066703_1050634423300005568SoilLAVDHHKVDDALWSEVRRHFSEAEIIELVAHTTLYIGFGRFNEIVGVDPA*
Ga0066694_1005164513300005574SoilEMRRHFTEAEIVELVAHATLYIGFGRFNEIVGIEPA*
Ga0066691_1000106263300005586SoilMRRHFTEAEIVELVAHATLYIGFGRFNEIVGIEPA*
Ga0066691_1006613243300005586SoilLRSHFSEADIIELVAHTTLFIGFGRFNEIVGLEPA*
Ga0068859_10007761733300005617Switchgrass RhizosphereMRRHFSEAEIIELTAHTTLYIGFGRFNEIVGLDPA*
Ga0066905_10005819943300005713Tropical Forest SoilVDHQKIDDALWTELRSQFTESELIELAAHTTLYIGFGRFNEIVGLDPA*
Ga0066903_10016022733300005764Tropical Forest SoilMQWEEMRRHFSEAEIIELVAHTTLYIGFGRFNEIVGLEPA*
Ga0066903_10054940943300005764Tropical Forest SoilVDHQKIDDVLWTDLRRQFTEAELIELAALTTLYIGFGRFNEVVGLDPA*
Ga0066903_10290297623300005764Tropical Forest SoilVDHHKVDDALWAEMRKHFSEAEIIELVAHTTLFIGFGRFNEIVGLDPA*
Ga0066903_10353875533300005764Tropical Forest SoilVDEAVWSELREHFSEAEIIELVAHTTLYIGWGRFNEIVGIDPA*
Ga0074479_1030735023300005829Sediment (Intertidal)VDHQKVDDGLWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIEPG*
Ga0068860_10065508833300005843Switchgrass RhizosphereMRAHFSEAEIIELVAHTTLYIGFGRFNEIVGLEPPA*
Ga0068862_10019149413300005844Switchgrass RhizosphereAVDHHKVDDALWAEVRGQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA*
Ga0066656_1006897613300006034SoilVDDALWAELRGHFSEAEIIELVANATLFIGWGRFNEIIGIDPA*
Ga0075417_1007617923300006049Populus RhizosphereVDESLWSELREHFSEAEIIELVAHTTLYIGWGRFNEIVGIDPA*
Ga0075417_1016720913300006049Populus RhizosphereVDHQKVDDALWAELRANFSEAEIIELAAHTTLFIGLGRFNEILG
Ga0075028_10009694523300006050WatershedsVDHQKVDDALWAEVRAQFSEAEVIELAAHTTLYIGLGRFNEIVGIDPA*
Ga0068871_10189713413300006358Miscanthus RhizosphereVDHQKVDDELWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA*
Ga0079220_1122103913300006806Agricultural SoilVDHRKVDDDLWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA*
Ga0075428_10001857873300006844Populus RhizosphereVDEALWSELRGHFSEAEIIELVAHTTLYIGWGRFNEIVGIDPS*
Ga0075428_10062774433300006844Populus RhizosphereVDHQKVDDDLWAEVRAHFSEAELIELVAHTTLYIGFGRFNEIVGLDPS*
Ga0075421_10013104953300006845Populus RhizosphereWAAMRQQFTEAEIIELVAHTTLFIGFGRFNEIVGLDPA*
Ga0075421_10014926443300006845Populus RhizosphereVDDRAWAELRAQFSEAEVIELTMHATLYIGLGRFNEVIGLDPNDLG*
Ga0075421_10199879123300006845Populus RhizosphereVRRHFSEAEVIELVAHTTLYIGFGRFNEIVGLDPA*
Ga0075431_10101142033300006847Populus RhizosphereWSDVRHHLSEAEVIELVAHTTLYIGFGRFNEIVGLDPA*
Ga0075433_1091463813300006852Populus RhizosphereAELREHFSEAEIVELAANITVNLGLGRFNHVVGIEP*
Ga0075420_10029779533300006853Populus RhizosphereWSELRTHFSEADIIELTMHTTLYIGLGRFNEVVGLDPA*
Ga0075425_10056791223300006854Populus RhizosphereLWAELRSQFTEAELIELVAHTTLYIGFGRFNEIIGLDPA*
Ga0075429_10119682613300006880Populus RhizosphereDDRAWGELRAQFSEAEVIELTMHATLYIGLGRFNEVIGLDPNDLG*
Ga0079215_1017893623300006894Agricultural SoilVDHHKVDDSLWAEMRSHFSEAEIIELVAHTTLYIGFGRFNEIVGLDPA*
Ga0075426_1153162213300006903Populus RhizosphereAVDHRKVDDVLWAEVRTHFSEAEIIELTAHTTLYIGFGRFNEIIGL*
Ga0075424_10010355633300006904Populus RhizosphereVDHHKVDDTQWTETRRHFTEAEIIELVAHTTLYIGFGRFNEIVGVDPA*
Ga0075436_10016310013300006914Populus RhizosphereVRAQFSEAEVIELVAHTTLYIGWGRFNEIVGIEPA*
Ga0079216_1023902013300006918Agricultural SoilVDDALWADLRAQFTEAEIIELTMHAMVFIGMGRFNEIIGL*
Ga0079219_1022882333300006954Agricultural SoilDHHKVDDELWAELCRHFTQAEIIELTAHTTLFIGFGRFNEIVGLDPA*
Ga0099791_1013895223300007255Vadose Zone SoilRSHFSEAEIVELVAHATLYIGFGRFNEIVRVDPA*
Ga0099794_1003076533300007265Vadose Zone SoilVRAHFSEAEIIELVAHTTLYIGFGRFNAIVGLDPA*
Ga0099794_1013720023300007265Vadose Zone SoilVDHQKVDEVLWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA*
Ga0066710_10009075843300009012Grasslands SoilDDTLWAELRRHFSEAEIIELAAHTTLFIGFGRFNEIVGLDLA
Ga0066710_10235645313300009012Grasslands SoilTLAVDHHKVDDALWSEVRRHFSEAEIIELVAHTTLYIGFGRFNEIVGVDPA
Ga0066710_10358166923300009012Grasslands SoilALWSEVRAHFSEAEVIELVAHTTLYIGFGRFNEIVGLDPA
Ga0099829_1033729323300009038Vadose Zone SoilRRHFSEAEIIELAAHTTLFIGFGRFNEIVGLDPA*
Ga0099828_10004017103300009089Vadose Zone SoilVDHQKVDDALWAEVHAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA*
Ga0099828_1056511423300009089Vadose Zone SoilVDHHKVDDTLWAEMRRHFSEAEIIELVAHTTLYVGFGRFNEIVGLDPA*
Ga0099827_1124962623300009090Vadose Zone SoilWAELRRHFSEGEIVELVAHTTIYIGFGRFNDIVGIDPA*
Ga0075418_1117432523300009100Populus RhizosphereLWADLRAQLSEAEIIELVAHTTLYIGFGRFNDIIGLGPVEGGRS*
Ga0075418_1260513423300009100Populus RhizosphereVDDTLWAEVRAQFSEAEVIELATHTTLYIGFGRLNEIIGIEPA*
Ga0075418_1302495113300009100Populus RhizosphereSDMRAQFSEADIVVLVAHATPYIGFGRFNEIVGVDPASQ*
Ga0105247_1131851113300009101Switchgrass RhizosphereMRGQFSEAEVIELVAHTTLYIGFGRFNEIIGLDPA*
Ga0114129_1003406043300009147Populus RhizosphereVDHQKVDDALWAEVRAEFSEAEVIELVAHATLYIGFGRFNEIVGIDPA*
Ga0114129_1238769413300009147Populus RhizosphereLWAELRRHFSEAEIIELVANATLFIGWGRFNEIIGIDPA*
Ga0114129_1306514823300009147Populus RhizosphereVDDALWSDVRHHLSEAEVIKLVAHTTLYIGFGRLNEIVGLDPA*
Ga0105243_1237353223300009148Miscanthus RhizosphereVDHQKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVG
Ga0105092_1063327623300009157Freshwater SedimentVWAELRQHLSEAEVIELVAHTTLYIGFGRFNEIVGLEPR*
Ga0075423_1010303113300009162Populus RhizosphereQKVDDALWDEVRAQFSEAEVIELVAHTTLYIGWGRFNEIVGIEPA*
Ga0105242_1279390613300009176Miscanthus RhizosphereMRRQFTEAEIIELVAHTTLYIGFGRFNEIVGIDPA*
Ga0126374_1002459113300009792Tropical Forest SoilVDHQKIDDALWTELRSQFTEAELIELAAHTTLYIGFGRFNEVVGLDPA*
Ga0126374_1032846413300009792Tropical Forest SoilVDHQKIDDVLWTELRRQFTEAELIELAALTTLYIGFGRFNEVVGLDPA*
Ga0105073_101000233300009802Groundwater SandMRSHFSEAEIIELVAHATLYIGLGRFNEIVGLDPA*
Ga0105063_100715023300009804Groundwater SandMRSQFSEAEIIELVAHTTLYIGFGRFNEIVGLDPA*
Ga0105082_102525033300009814Groundwater SandVRHHFSEAEVIELVAHTTVYIGFGRFNAIVGLDPA*
Ga0105076_107550523300009816Groundwater SandVRDHFSEAEVIELVAHATLYIGFGRFNEILGIEPA*
Ga0105085_100527323300009820Groundwater SandVDHQKVDDALWAELRGQFSEAEIIELVAHTTIYIGFGRFNEIVGIDPA*
Ga0126380_1010360013300010043Tropical Forest SoilVDHQKIDDVLWAELRSQFTEAELIELVAHTTLYIGFGRFNEIIGLDPS*
Ga0126380_1036395423300010043Tropical Forest SoilVDHQKIDDTLWTELRSQFTEAELIELAAHTTLYIGFGRFNEIVGLDPA*
Ga0126384_1050901533300010046Tropical Forest SoilVDHQKIDDALWTELRSQFTESELIELAAHTTLYIGFGRFNEVVGLDPA*
Ga0126384_1072066613300010046Tropical Forest SoilDHQKIDDALWAELRSHFTEAELIELVAHTTLYIGFGRFNEIIGLDLS*
Ga0134088_1033752323300010304Grasslands SoilMRSLFTEAEVIELVAHTTLYIGFGRFNEIIGLDPA*
Ga0134071_1021660013300010336Grasslands SoilVDHHKVDDALWSELRSHFSEAEIIELVAHTTLYIGFGRFNEIVGLDPA*
Ga0126370_1027092143300010358Tropical Forest SoilWAELRSQFTEAELIELVAHTTLYIGFGRFNEIIGLDPS*
Ga0126370_1074875233300010358Tropical Forest SoilVDDELWAALRAQFSEAEIIELVAHTTLYIGYGRFNEILGIDPA*
Ga0126372_1010054943300010360Tropical Forest SoilVDDELWVELRAQFSEAEIIELVAHTTLYIGYGRFNEILGIDPA*
Ga0126372_1016212523300010360Tropical Forest SoilVDHQKIDDVLWTDLRRQFTEAELIELAAHTTLYIGFGRFNEVVGLDPA*
Ga0126378_1189965423300010361Tropical Forest SoilVDDALWAEMRQHFSEAEIIELVAHTTLYIGWGRFNEILGLDPA*
Ga0126377_1110864333300010362Tropical Forest SoilAELRSQFTDAELIELAAHTTLYIGFGRFNEIIGLEPA*
Ga0126379_1009097753300010366Tropical Forest SoilVDHQKIDDVLWTELRRQFTEAELIELAAHITLYIGFGRFNEVVGLDPA*
Ga0126379_1140415823300010366Tropical Forest SoilVDHQKIDDALWAEFRRQFTEAELIELAAHTTLYIGFGRFNEIVGLDPA*
Ga0134125_1088271733300010371Terrestrial SoilVDHHKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEVVGIDPA*
Ga0126381_10127529813300010376Tropical Forest SoilIDDAQWAELRSSFSEAEIIELVAHTTLFIGWGRFNEIVGIDPA*
Ga0126381_10375433623300010376Tropical Forest SoilHQKIDDVLWAELRSQFTEAELIELVAHTTLYIGFGRFNEIIGLDPS*
Ga0136847_1024760613300010391Freshwater SedimentMRQHFSEAEIIELVAHTTLYIGFGRFNEIVGLDPA*
Ga0134127_1004170523300010399Terrestrial SoilVDHNKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIEPA*
Ga0134122_1136096913300010400Terrestrial SoilVDHQKVDDGLWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIEPA*
Ga0137442_111967023300011414SoilVDHRKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA*
Ga0137448_120290813300011427SoilVDHQKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDP
Ga0137458_120197623300011436SoilVDHQKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGID*
Ga0137429_103018123300011437SoilVDHQKVDDALWVEMRREFTEAEIIELVAHTTLYIGFGRFNEIVGLDPA*
Ga0137461_104318933300012040SoilLRQHFSEAEIIELVAHTTLYIGFGRFNEIVGLDPA*
Ga0137330_106227913300012134SoilVDHQKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRISENVGPDPAKHLHEVRPGHVA
Ga0137352_102958533300012164SoilVDHQKVDDALWAELRAQFSEAEVIELAAHTTLYIGFGRFNEIVGLDPA*
Ga0137338_102076823300012174SoilVDHQKVDDALWAELRAQFSEAEVIELAAHTTLYIGFGRFNEIVGIEPA*
Ga0137388_1097733313300012189Vadose Zone SoilFWSEMRSHFSEAEIIELVAHATLYIGFGRFNEIVGVDPA*
Ga0137363_1094825113300012202Vadose Zone SoilRRHFSEAEIVELVAHTTIYIGFGRFNDVVGIDPL*
Ga0137399_1086234223300012203Vadose Zone SoilVDHNNVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA*
Ga0137399_1142358713300012203Vadose Zone SoilVDHQKVDDALWAEVRAEFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA*
Ga0137362_1011110723300012205Vadose Zone SoilVDHQKVDDDLWAVLRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA*
Ga0137362_1014299113300012205Vadose Zone SoilVDDALWAEMRRHFSEAEIIELVAHTTLYIGFGRFNEIIGLEPS*
Ga0137434_105992823300012225SoilVDDGLWADLRAQFSEAEIIELTMHTMVFIGMGRFNEIIGLDPV*
Ga0137369_1095266523300012355Vadose Zone SoilVDHQKVDDALWSEMRRQFTEAEIIELVAHTTLYIGFGRFNEIVGIDPV*
Ga0137360_1029080943300012361Vadose Zone SoilMRRHFSEAEIIELVAHTTLDIGFGRVNEIVGLDPA*
Ga0137361_1118789213300012362Vadose Zone SoilAFWSEMRSHFSEAEIIELVAHATLYIGFGRFNEMVGVDPA*
Ga0157299_1023789523300012899SoilVRTHFSEAEVIELVAHTTLYIGFGRFNEVIRLDPS*
Ga0137395_1096430823300012917Vadose Zone SoilAADHHKVDDALWAEMRRHFSEAEIIELEAHTTLYIGFGRFNEIIGLEPS*
Ga0137395_1106823413300012917Vadose Zone SoilEMRRHFSEAEIIELVAHTTLYIGFGRFNEIVGLDPA*
Ga0137394_1010666323300012922Vadose Zone SoilLWAELRLHFSEAEVIELTAHTTLYIGFGRFNEIVGLDPA*
Ga0137419_1126727113300012925Vadose Zone SoilDDELWAEMRRHFSEAEIIELVAHTTLYIGFGRFNEIVGLDPA*
Ga0137416_1110183613300012927Vadose Zone SoilDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA*
Ga0137404_1000988433300012929Vadose Zone SoilVDHQKVDDALWSEMRRQFTEAEIIELVAHTTLFIGFGRFNEIVGLDPA*
Ga0137404_1071782623300012929Vadose Zone SoilALWAEVRAQFSEAEVIELVAHATLYIGFGRFNEIVGID*
Ga0137407_1006677613300012930Vadose Zone SoilDDTLWAELSRHFSEAEIIELAAHMTLFIGFGRFNEIVGLDPA*
Ga0137407_1055804113300012930Vadose Zone SoilVDHNKVDDALWAEVRAQFSEAEVIELVAHATLYIGFGRFNEIVGID*
Ga0137407_1060845313300012930Vadose Zone SoilVDHQKVDDALWAEVRAEFSEAEVIELVAHTTLYIGFGRFNEIVGID*
Ga0137407_1184512323300012930Vadose Zone SoilWSEMRSHFSEAEIIELVAHATLYIGFGRFNEIIGIEPA*
Ga0153915_1016173323300012931Freshwater WetlandsVDHQKVDDALWAEVRAQFSEGEVIELVAHTTLYIGFGRFNEIVGIDPA*
Ga0153915_1081190623300012931Freshwater WetlandsMRTHFSEAEIIELVAHTTLYIGFGRFNEIVGLEPA*
Ga0137410_1035232523300012944Vadose Zone SoilWSEMRSHFSEAEIVELVAHATLYIGFGRFNEIVGVDPA*
Ga0137410_1180058223300012944Vadose Zone SoilLWAEMRRHFSEAEIIELVAHTTLYIGFGRFNEIVGLDPA*
Ga0126375_1204060013300012948Tropical Forest SoilKIDDVLWTELRRQFTEAELIELAAHTTLYIGFGRFNEVVGLDPA*
Ga0164302_1167402123300012961SoilVDHQKVDDDLWAEVRAQFSEAEVIELVAHATLYIGFGRFNEIVGID*
Ga0126369_1286796313300012971Tropical Forest SoilRSQFTEAELIELVAHTTLYIGFGRFNEIIGLDPS*
Ga0134076_1000969143300012976Grasslands SoilVDEALWSELRGHFSEAEIIELVAHTTLYIGWGRFNEIVGIDPA*
Ga0164304_1101984123300012986SoilVDHQRVDDDLWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA*
Ga0157380_1141562413300014326Switchgrass RhizosphereVDHHKVDDALWAEVRGQFSEAEVIELVAHTTLYIGFGRFNEIVGIDP
Ga0180076_109209123300014867SoilVDHHKVDDTEWADMRSHFSEAEIIELVAHTTLYIGFGRFNEIVGLDPA*
Ga0180069_109500523300014882SoilMRQHFSEAEIIELVAHTTLYIGFGRFNEIVGIDPA*
Ga0180086_116065113300014883SoilMRQHFSEAEIIELVAHTTLYIGFGRFNEIIGLDPA*
Ga0137418_1009197053300015241Vadose Zone SoilMRAHFSEAEIVELVAHATLYIGFGRFNEILGVEPASR*
Ga0137403_1013175813300015264Vadose Zone SoilRRHFSEAEIIELVAHTTLYIGFGRFNEIVGLDPI*
Ga0137403_1019847843300015264Vadose Zone SoilVDHNKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEI
Ga0137403_1075171823300015264Vadose Zone SoilVDDALWSELRHHFSEAEIIELVAHTTLYIGFGRFNEIVGLDPS*
Ga0137403_1144243213300015264Vadose Zone SoilQKVDDDLWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA*
Ga0134085_1002783343300015359Grasslands SoilVRAHFSEAEVIELVAHTTLYIGFGRFNEIVGLDPV*
Ga0132258_1068572923300015371Arabidopsis RhizosphereVDHQKIDDALWAELRSQFTDAELIELAAHTTLYIGFGRFNEIVGLDPA*
Ga0132258_1253736433300015371Arabidopsis RhizosphereVDDAQWAKLRRHFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA*
Ga0134069_109504033300017654Grasslands SoilVRRHFSEAEIVELVAHATLYIGFGRFNEIVGIEPA
Ga0134112_1002713853300017656Grasslands SoilVDEALWSELRGHFSEAEIIELVAHTTLYIGWGRFNEIVGIDPA
Ga0187825_1004398023300017930Freshwater SedimentVDHQKVDDDLWAEVRAQFSEAEVIELVAHATLYIGFGRFNEIVGIDPA
Ga0187776_1003529743300017966Tropical PeatlandVRAQFSEAEVIELVAHTTLYIGFGRFNEILGIEPA
Ga0187823_1002538633300017993Freshwater SedimentVDHRKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA
Ga0187822_1000637133300017994Freshwater SedimentVDHRKVDDDLWAEVRAQFSEAEVIELVAHATLYIGFGRFNEIVGIDPA
Ga0184610_103149643300017997Groundwater SedimentVDHQKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRF
Ga0184634_1039470413300018031Groundwater SedimentVDHQKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFSEIVGIDPA
Ga0184638_118367423300018052Groundwater SedimentVDHQKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIMGIDPA
Ga0184626_1000456773300018053Groundwater SedimentVDHQKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA
Ga0184626_1016723823300018053Groundwater SedimentVRDHFSEAEVIELVAHATLYIGFGRFNEILGVEPA
Ga0184621_1003874623300018054Groundwater SedimentVDHQKVDDALWAEVRAEFSEAEVIELVAHATLYIGFGRFNEIVGIDPA
Ga0184615_1028272433300018059Groundwater SedimentMRQHFSEAEIIELVAHTTLYIGFGRFNEIVGLDPG
Ga0184619_1014455023300018061Groundwater SedimentVDHQKVDDALWAEVRAEFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA
Ga0184637_1009756623300018063Groundwater SedimentVRFREEVRGRPQKVRDALWAEMRGQFSEAEIIELVAHTTLYIGFGRFNEIVGLDPA
Ga0184640_1027979923300018074Groundwater SedimentVDHQKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIEPA
Ga0184609_1005083213300018076Groundwater SedimentKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIMGIDPA
Ga0184609_1032488523300018076Groundwater SedimentWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA
Ga0184633_1002758233300018077Groundwater SedimentMRQHFSEAEIIELVAHTTLYIGFGRFNEIVGLDPA
Ga0184627_1006397033300018079Groundwater SedimentMRQHFSEAEIIELVAHTTLYIGFGRFNEIVGLEPA
Ga0184629_1020987913300018084Groundwater SedimentLWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA
Ga0187774_1005307243300018089Tropical PeatlandVRAQFSEAEVIALVAHTTLYIGFGRFNEILGIEPA
Ga0190265_1025049623300018422SoilVDHNKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA
Ga0190265_1069134223300018422SoilVDHQKVDDTLWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA
Ga0190265_1178712623300018422SoilVEDAQWAELRRHFSEAEVIELVAHTTLYIGFGRFNEIVGIEAI
Ga0066667_1004049343300018433Grasslands SoilVRAHFSEAEVIELVAHTTLYIGFGRFNEIVGLDPA
Ga0066667_1142123923300018433Grasslands SoilWAEMRSHFSEAEIIELVAHTTLYIGFGRFNEIVGLDPS
Ga0184643_124654223300019255Groundwater SedimentVDHQKVDDALWSEMRRQFTEAEIIELVAHTTLFIGFGRFNEIVGLDPA
Ga0187892_1003116823300019458Bio-OozeVDHQKVDDALWAEVRGQFSEAEIIELVAHTTLYIGFGRFNEIIGIEPA
Ga0187892_1023094013300019458Bio-OozeDALWAEVRGQFSEAEVIELVAHTTLYIGFGRFNEIVGIEPA
Ga0187893_1009397433300019487Microbial Mat On RocksVDHQKVDDALWAEVRGQFSEAEVIELVAHTTLYIGFGRFNEIVGIEPA
Ga0187893_1043845813300019487Microbial Mat On RocksDEALWSQLRSHFSEAEIIELVAHTTLYIGFGRFNAIVGLDPA
Ga0187893_1043986813300019487Microbial Mat On RocksEALWSELRSHFSEAEIIELVAHTTLYIGFGRFNTIVGLDPA
Ga0137408_108855133300019789Vadose Zone SoilMRRHFSEAEIIELVAHTTLYIGFGRFNEIVGLDPA
Ga0137408_129937913300019789Vadose Zone SoilMRRHFTEAEIIELVAHTTLYIGFGRFNEIVGLDPA
Ga0193723_103146543300019879SoilVDHHKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA
Ga0193707_101169833300019881SoilVDHQKVDDALWAEVRAEFSEAEVIELVAHTTLYIGFGRFNEIVGID
Ga0193707_115393223300019881SoilALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA
Ga0193718_102026443300019999SoilVDHQKVDDELWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDP
Ga0193755_100350573300020004SoilVDHQKVDDALWSELRRLFTEAEIIELVAHTTLFIGFGRFNEIVGLDPV
Ga0193755_111055623300020004SoilVDDALWAEVRAQFSEAEVIELVAHATLYIGFGRFNEIVGIDPA
Ga0193726_114966813300020021SoilVDHQKVDDALWAEVRAQFSEAEVIELVAHATLYIGFGRFNEIVGIDPA
Ga0180113_104369913300020065Groundwater SedimentDALWVEMRREFTEAEIIELVAHTTLYIGFGRFNEIVGLDPA
Ga0180109_134696023300020067Groundwater SedimentVDHQKVDDALWAELRAQFSEAEVIELAAHTTLYIGFGRFNEIVGIEPA
Ga0210378_1004088213300021073Groundwater SedimentLWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIMGIDPA
Ga0179596_1069534713300021086Vadose Zone SoilHHKVDDALWAEMRRHFSEAAIIELVAHTTLYIGFGRFNEIIGLEPS
Ga0210404_1017886043300021088SoilVDHQKVDDALWAELRAQFSEGEIIELAAHTTLFIGLGRFNEILGIDPV
Ga0182009_1006061213300021445SoilVDDALWAKVRAQFSEAEVIELVAHTTLYIGWGRFNEIVGIEPA
Ga0126371_1245827423300021560Tropical Forest SoilWAELRSHFTEAELIELVAHTTLYIGFGRFNEIIGLEPA
Ga0126371_1372866123300021560Tropical Forest SoilVDDELWAALRAQFSEAEIIELVAHTTLYIGYGRFNEILGIDPA
Ga0193737_100720723300021972SoilVDHNKVDDALWAEVRAQFSEAEVIELVAHATLYIGFGRFNEIVGID
Ga0224452_116665113300022534Groundwater SedimentDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA
Ga0247680_106781323300024246SoilVDHQKVDDELWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA
Ga0209109_1022927523300025160SoilVDHQKVDDALWAELRGQFSEAEIIELVAHTTLYIGFGRFNEIVGLDPA
Ga0209108_1016503413300025165SoilVDHQKVDDALWAEVRAQFSEAEVIELVAHATLFIGFGRFNEIVGIEPA
Ga0209640_1051393523300025324SoilVDDAQWAELRAHFSEAELIELVAHTALYIGFGRFNDIIGLEPA
Ga0210073_114101323300025569Natural And Restored WetlandsGDAQWAELRSHFSEAEIIELVAHTTLYIGLGRFNEIVGLEPV
Ga0207653_1000207563300025885Corn, Switchgrass And Miscanthus RhizosphereVDHQKVDDALWAEMRRQFTEAEIIELVAHTTLYIGFGRFNEIVGLDPA
Ga0207642_1059650523300025899Miscanthus RhizosphereVDHHKVDDALWAEVRGQFSEAEVIELVAHTTLYIGFGRFNEVVGIDPA
Ga0207645_1002154123300025907Miscanthus RhizosphereVDHHKVDDALWAEVRGQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA
Ga0207684_1005126713300025910Corn, Switchgrass And Miscanthus RhizosphereDDLWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA
Ga0207684_1008421143300025910Corn, Switchgrass And Miscanthus RhizosphereVDHQKIDDDLWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA
Ga0207684_1034722333300025910Corn, Switchgrass And Miscanthus RhizosphereMRGQFSEAEVIELVAHTTLYIGFGRFNEIIGLDPA
Ga0207654_1130662423300025911Corn RhizosphereVDHNKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEVVGIDPA
Ga0207707_1012864233300025912Corn RhizosphereMRRHFSEAEIIELTAHTTLYIGFGRFNEIVGLDPA
Ga0207707_1107762423300025912Corn RhizosphereVDHHKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEVVGIDPA
Ga0207707_1120746923300025912Corn RhizosphereDALWAEVRAQFSEAEVIELVAHTTLFIGFGRFNEIVGIEPA
Ga0207663_1026987913300025916Corn, Switchgrass And Miscanthus RhizosphereGVRSQFTEAEVIELVAHTTLYIGFGRFNEIIGLDPA
Ga0207660_1040580823300025917Corn RhizosphereVDHNKVDDALWAEVRAQFSEAEVIELVAHTTLFIGFGRFNEIVGIEPA
Ga0207646_1104094313300025922Corn, Switchgrass And Miscanthus RhizosphereAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA
Ga0207681_1053369623300025923Switchgrass RhizosphereVRTHFSEAEVIELVAHTTLYIGFGRFNEVIRLDPS
Ga0207681_1099983813300025923Switchgrass RhizosphereHQKIDDTLWTEVRSQFTEAEVIELVAHTTLYIGFGRFNEIIGL
Ga0207650_1003426643300025925Switchgrass RhizosphereDHQKVDDALWAEVRAQFSEAEVIELVAHTTLYIGWGRFNEIVGIEPA
Ga0207701_1076965013300025930Corn, Switchgrass And Miscanthus RhizosphereAEMRSHFSEAEIIELVAHTTLYIGFGRFNEIVGLDPA
Ga0207686_1011777613300025934Miscanthus RhizosphereKLAVDHQKVDDALWAEMRRQFTEAEIIELVAHTTLYIGFGRFNEIVGLDPA
Ga0207679_1004278313300025945Corn RhizosphereVRAQFSEAEVIELVAHTTLYIGWGRFNEIVGIEPA
Ga0210089_102404133300025957Natural And Restored WetlandsTLWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA
Ga0210070_100435013300025962Natural And Restored WetlandsVDHQKVDDTLWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGID
Ga0210102_104209723300025971Natural And Restored WetlandsVDHQKVDDRLWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA
Ga0208915_103147613300026048Natural And Restored WetlandsVDHQKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIEPG
Ga0209236_114952133300026298Grasslands SoilMRRHFTEAEIVELVAHATLYIGFGRFNEIVGIEPA
Ga0209055_104691543300026309SoilFADKLAVDQHKVDEALWAELRSHFSEADIIELVAHTTLFIGFGRFNEIVGLEPA
Ga0209158_112483913300026333SoilLRRHFSEAEIIELVAHTTLYIGLGRFNEIVGLDPA
Ga0209158_119100033300026333SoilVRRHFSEAEIIELVAHTTLYIGLGRFNEIVGLDPA
Ga0209377_134767313300026334SoilHHKVDDALWSELRGHFSEAEIIELVAHTTLYIGLGRFNEIVGLDPA
Ga0257170_102017723300026351SoilVDHQKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGVDPA
Ga0257149_101590143300026355SoilVDHQKVDDALWAEVRAQFSEAEVIELAAHTTLYIGLGRFNEIVGIDPA
Ga0257166_100265613300026358SoilAQWAELRSHFSDAEIIELVAHTTLYIGFGRFNEIVGLDPS
Ga0257176_108597113300026361SoilELGSHFSDAEIIELVAHTTLYIGFGRFNEIVGLDPS
Ga0257179_100211843300026371SoilVDQQKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA
Ga0257177_105214023300026480SoilVDHQKVDEVLWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA
Ga0257161_101294113300026508SoilEVRAQFSEAEVIELAAHTTLYIGLGRFNEIVGIDPA
Ga0209376_111181313300026540SoilHRKVDDALWAELRGHFSEAEIIELVASATLFIGWGRFNEIIGIDPA
Ga0209161_1006300233300026548SoilVDDELWAELRRHFSEAEIIELVAHTTLYIGFGRFNEIVGLDPA
Ga0209648_10003569103300026551Grasslands SoilVRAHFSEAEIIELVAHTTLYIGFGRFNAIVGLDPA
Ga0209898_101163423300027068Groundwater SandAFWSELRAHFSEAEVIELVAHATLYIGFGRLNEILGLDPA
Ga0209843_109585613300027511Groundwater SandVDHQKVDDALWAELRGQFSEAEIIELVAHTTIYIGFGRFNEIVGIDPA
Ga0209735_106861123300027562Forest SoilMRQHFSEAEIIELVAHTTLYIGFGRFNEIVGIDPA
Ga0209874_100617913300027577Groundwater SandFWSEMRSHFSEAEIVELVAHATLYIGLGRFNEIVGLDPA
Ga0209588_106768223300027671Vadose Zone SoilMRRHFSESEIIELVAHTTLYIGFGRFNEIVGLDPA
Ga0208991_112545713300027681Forest SoilVDDALWAEVRAEFSEAEVIELVAHTTLYIGFGRFNEIVGID
Ga0209462_1017089323300027761AgaveDDAAWAELRDQFSESEIIELALHVTLFIGLGRFNEVVGLEV
Ga0209177_1009835823300027775Agricultural SoilAEKLAVDHHKVDDELWAELCRHFTQAEIIELTAHTTLFIGFGRFNEIVGLDPA
Ga0209180_1029644533300027846Vadose Zone SoilQKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA
Ga0209701_1010481033300027862Vadose Zone SoilLWSELRQRFSEAEIIELVAHTTLYIGLGRFNEIVGLDPA
Ga0209814_1008784943300027873Populus RhizosphereVDESLWSELREHFSEAEIIELVAHTTLYIGWGRFNEIVGIDPA
Ga0209481_1014246813300027880Populus RhizosphereVDEALWSELRGHFSEAEIIELVAHTTLYIGWGRFNEIVGIDPS
Ga0209481_1035190323300027880Populus RhizosphereVDHHKVDEPQWAEMRSHFSEAEIIELVAHTTLYIGFGRFNEIVGLDPA
Ga0209486_1036562623300027886Agricultural SoilMRQQFTEAEIIELVAHTTLFIGFGRFNEIVGLDPA
Ga0207428_1012560123300027907Populus RhizosphereVDHQKVDDDLWAEVRAHFSEAELIELVAHTTLYIGFGRFNEIVGLDPS
Ga0209382_1022304333300027909Populus RhizosphereVDDRAWAELRAQFSEAEVIELTMHATLYIGLGRFNEVIGLDPNDLG
Ga0209382_1149059923300027909Populus RhizosphereVDHHKVDDTLWSEMRAQFTEAEIIELVAHTTLFIGFGRFNEIVGIEPPE
Ga0209382_1155674423300027909Populus RhizosphereVRRHFSEAEVIELVAHTTLYIGFGRFNEIVGLDPA
Ga0209868_101299123300027947Groundwater SandDALWAEMRSQFSEAEIIELVAHTTLYIGFGRFNEIVGLDPA
Ga0209889_107916413300027952Groundwater SandVDHHKVDDTLWAEMRSLFSEAEIIELAAHTTLFIGFGRFNEIVGLEPA
Ga0209526_1033211713300028047Forest SoilVDHHKVDDTLWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA
Ga0268264_1088030823300028381Switchgrass RhizosphereVDHQKVDDALWAEMRREFTEAEIIELVAHTTLFIGFGRFNEIVGLDPA
Ga0307504_1031170823300028792SoilVDHQKVDDALWAELRGQFSEAEIIELVAHATLYIGFGRFNEIIGI
Ga0307284_1042456313300028799SoilVDHQKVDDELWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGID
Ga0307281_1003621113300028803SoilVDHQKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNE
Ga0307312_1100962513300028828SoilMRQHFSEAEIIELVAHTTLYIGFGRFNEIVGLDPARSGP
Ga0307278_1009172723300028878SoilMRSHFSQAEIIELVAHTTLYIGFGRFNEIVGLDPA
Ga0302046_1071109023300030620SoilVDHQKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGID
Ga0299913_1171538913300031229SoilTLWAELRSHLSEAEIIELVAHTTLYIGFGRFNEIVGLDPA
Ga0308194_1040150423300031421SoilVDHNKVDDAFWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEI
Ga0307408_10005556243300031548RhizosphereLWADLRAEFSEAEIIELVAHTTLYIGFGRFNDIIGLQPVAASRS
Ga0307408_10030680323300031548RhizosphereVRRHFSEAEVIELVAHTTLYIGFGRLNEIIGLDLA
Ga0310813_1001292053300031716SoilVLWAELSRHFTEAEIIELTAHTTLFIGFGRFNEIVGLDPA
Ga0307469_1008268433300031720Hardwood Forest SoilVDDALWAELRAQFSEAEIIELAAHTTLFIGLGRFNEILGIDPV
Ga0307405_1028013333300031731RhizosphereDDALWRELRSHYSEAEIIELTVHLTLYIGMGRFNEVIGLDPA
Ga0307405_1085441613300031731RhizosphereWAELRERFSESEIIELALHVTLFIGLGRFNTVIGLEV
Ga0318501_1012161243300031736SoilQKIDDALWAELRSHFTEAELIELVAHTTLYIGFGRFNEIIGLEPA
Ga0307468_10113596113300031740Hardwood Forest SoilEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA
Ga0318499_1022094533300031832SoilLWAELRSHFTEAELIELVAHTTLYIGFGRFNEIIGLEPA
Ga0315290_1049855223300031834SedimentMRQHFSEAEIIELVAHTTLYIGFGRFNEIVGLDPV
Ga0310904_1127980023300031854SoilVDHQKVDDALWAEVRAQFSEAEVIELVAHTTLYIGWGRFNEIVGIEPA
Ga0310893_1052446313300031892SoilVDDAQWAKLRRHFSEAEVIELVAHTTLYIGFGRFNEIVGLDPA
Ga0326597_1121527623300031965SoilMRSHFSEAEIIELVAHTTLYIGFGRFNEIVGLDPA
Ga0310903_1052606123300032000SoilVDHQKVDDDLWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGLDPA
Ga0310890_1141590423300032075SoilVDHHKVDDSLWAEMRSHFSEAEIIELVAHTTLYIGFGRFNEIVGLDPA
Ga0307470_1003968643300032174Hardwood Forest SoilVDHSKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGID
Ga0307470_1150782413300032174Hardwood Forest SoilMELRDNFSESELIELTMHTTLYIGMGRFNEVIGLDPA
Ga0307472_10067748313300032205Hardwood Forest SoilDLWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA
Ga0307472_10188114623300032205Hardwood Forest SoilVDHHKVDDALWAEMRRHFSEAEIIELVAHTTLYIGFGRFNDIVGLDPV
Ga0335085_1001087893300032770SoilVDHQKVDDALWAEVRAQFSEAEVIELAAHTTLYIGFGRFNEIVGIDPA
Ga0335085_1057595233300032770SoilVDHQKIDDALWAELRSQFTEAELIELTAHTTLYIGFGRFNEIVGLDPA
Ga0335083_1086249423300032954SoilDHQKIDDALWAELRSQFTEAELIELTAHTTLYIGFGRFNEIVGLDPA
Ga0335084_1158790123300033004SoilLRTHFSESDVIELAMHTTLYIGLGRFNEVVGLDPA
Ga0335077_1125421313300033158SoilDDVLWAELRKHFSESDIIELAMHTTLYIGLGRFNEVVGLDPA
Ga0326729_106494623300033432Peat SoilVDHRKVDDALWAEVRARFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA
Ga0326726_1061025713300033433Peat SoilAEKLAVDHRKVDDALWAEVRARFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA
Ga0316620_1212035023300033480SoilVDHQKVDDALWAEVRARFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA
Ga0326732_101790523300033501Peat SoilVDHRKVDDALWSEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA
Ga0316628_10012359833300033513SoilVDHQKVDDALWAEVRAQFSEGEVIELVAHTTLYIGFGRFNEIVGIDPA
Ga0247829_1018591123300033550SoilVRRHFSEAEMIELVAHTTLYIGFGRFNEIVGLDPA
Ga0247829_1028568333300033550SoilVDDALWSDVRHHLSEAEVIELVAHTTLYIGFGRFNEIVGLDPA
Ga0314866_070310_77_2233300033807PeatlandVDHRKIDDTLWAELRRHFSDAELIELTAHTTLYIGFGRFNEIVGLDPA
Ga0364924_038134_35_1813300033811SedimentVDHQKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGLEPA
Ga0364926_110472_456_5633300033812SedimentMRSHFSEAEIVELVAHATLYIGFGRFNEIVGVDPA
Ga0364930_0305131_46_1533300033814SedimentVRARFSEAEVIELVAHTTLYIGFGRFNEIVGLDPA
Ga0364940_0202429_452_5803300034164SedimentVDHQKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIV
Ga0364942_0030239_88_1953300034165SedimentMRSHFSEAEIIELVAHTTLYIGLGRFNEIVGLDPA
Ga0364931_0080213_906_10133300034176SedimentVRDRFSEAEIIELVAHATLYIGFGRFNEIVGVEPA
Ga0364932_0371700_421_5373300034177SedimentWSELRRQFSEAEIIELVAHTTLYIGFGRFNEIVGLDPA
Ga0373950_0072174_2_1453300034818Rhizosphere SoilVDHQKVDDELWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEMVGIDPA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.