Basic Information | |
---|---|
Family ID | F007424 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 351 |
Average Sequence Length | 46 residues |
Representative Sequence | MAPQSDTSTLYVLVCSLAGTVLSLAATWIVVAHSFVQPMVA |
Number of Associated Samples | 226 |
Number of Associated Scaffolds | 349 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 36.18 % |
% of genes near scaffold ends (potentially truncated) | 57.55 % |
% of genes from short scaffolds (< 2000 bps) | 80.06 % |
Associated GOLD sequencing projects | 191 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.49 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (64.387 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (9.687 % of family members) |
Environment Ontology (ENVO) | Unclassified (43.305 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (61.823 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.83% β-sheet: 0.00% Coil/Unstructured: 52.17% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 349 Family Scaffolds |
---|---|---|
PF12706 | Lactamase_B_2 | 7.16 |
PF17201 | Cache_3-Cache_2 | 5.16 |
PF01740 | STAS | 3.44 |
PF00916 | Sulfate_transp | 2.29 |
PF00027 | cNMP_binding | 2.01 |
PF00196 | GerE | 1.72 |
PF04773 | FecR | 1.72 |
PF08241 | Methyltransf_11 | 1.15 |
PF00583 | Acetyltransf_1 | 0.86 |
PF05226 | CHASE2 | 0.86 |
PF00067 | p450 | 0.86 |
PF09955 | DUF2189 | 0.86 |
PF00072 | Response_reg | 0.57 |
PF07690 | MFS_1 | 0.57 |
PF00036 | EF-hand_1 | 0.29 |
PF12244 | DUF3606 | 0.29 |
PF02515 | CoA_transf_3 | 0.29 |
PF00216 | Bac_DNA_binding | 0.29 |
PF04116 | FA_hydroxylase | 0.29 |
PF03330 | DPBB_1 | 0.29 |
PF00753 | Lactamase_B | 0.29 |
PF05099 | TerB | 0.29 |
PF02796 | HTH_7 | 0.29 |
PF03858 | Crust_neuro_H | 0.29 |
PF00239 | Resolvase | 0.29 |
PF00248 | Aldo_ket_red | 0.29 |
PF01323 | DSBA | 0.29 |
PF12728 | HTH_17 | 0.29 |
PF14659 | Phage_int_SAM_3 | 0.29 |
PF00156 | Pribosyltran | 0.29 |
PF09769 | ApoO | 0.29 |
PF13660 | DUF4147 | 0.29 |
PF00440 | TetR_N | 0.29 |
PF13472 | Lipase_GDSL_2 | 0.29 |
PF05239 | PRC | 0.29 |
PF17200 | sCache_2 | 0.29 |
COG ID | Name | Functional Category | % Frequency in 349 Family Scaffolds |
---|---|---|---|
COG0659 | Sulfate permease or related transporter, MFS superfamily | Inorganic ion transport and metabolism [P] | 2.29 |
COG2233 | Xanthine/uracil permease | Nucleotide transport and metabolism [F] | 2.29 |
COG2252 | Xanthine/guanine/uracil/vitamin C permease GhxP/GhxQ, nucleobase:cation symporter 2 ( NCS2) family | Nucleotide transport and metabolism [F] | 2.29 |
COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.86 |
COG4252 | Extracytoplasmic sensor domain CHASE2 (specificity unknown) | Signal transduction mechanisms [T] | 0.86 |
COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 0.29 |
COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.29 |
COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.29 |
COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.29 |
COG3000 | Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamily | Lipid transport and metabolism [I] | 0.29 |
COG3793 | Tellurite resistance protein TerB | Inorganic ion transport and metabolism [P] | 0.29 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 64.39 % |
All Organisms | root | All Organisms | 35.61 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2088090014|GPIPI_16572514 | Not Available | 1502 | Open in IMG/M |
2088090014|GPIPI_17318162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1692 | Open in IMG/M |
2088090015|GPICI_9142986 | Not Available | 1350 | Open in IMG/M |
2088090015|GPICI_9232634 | All Organisms → cellular organisms → Bacteria | 3237 | Open in IMG/M |
2088090015|GPICI_9249424 | Not Available | 1423 | Open in IMG/M |
2170459019|G14TP7Y01DBGGU | Not Available | 556 | Open in IMG/M |
2170459020|G1P06HT02GLE1F | Not Available | 633 | Open in IMG/M |
3300000033|ICChiseqgaiiDRAFT_c0593837 | Not Available | 629 | Open in IMG/M |
3300000550|F24TB_10409898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1651 | Open in IMG/M |
3300000787|JGI11643J11755_11771342 | Not Available | 942 | Open in IMG/M |
3300000787|JGI11643J11755_11788680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1601 | Open in IMG/M |
3300000881|JGI10215J12807_1072835 | Not Available | 1101 | Open in IMG/M |
3300000881|JGI10215J12807_1439462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1060 | Open in IMG/M |
3300000890|JGI11643J12802_10157152 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
3300000890|JGI11643J12802_10396537 | Not Available | 908 | Open in IMG/M |
3300000890|JGI11643J12802_10895886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 871 | Open in IMG/M |
3300000955|JGI1027J12803_102264174 | All Organisms → cellular organisms → Bacteria | 2327 | Open in IMG/M |
3300000956|JGI10216J12902_101871619 | Not Available | 1325 | Open in IMG/M |
3300000956|JGI10216J12902_112505885 | Not Available | 595 | Open in IMG/M |
3300001978|JGI24747J21853_1017614 | Not Available | 762 | Open in IMG/M |
3300002077|JGI24744J21845_10104128 | Not Available | 525 | Open in IMG/M |
3300004114|Ga0062593_100595582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1053 | Open in IMG/M |
3300004114|Ga0062593_100816170 | Not Available | 930 | Open in IMG/M |
3300004114|Ga0062593_101066548 | Not Available | 835 | Open in IMG/M |
3300004156|Ga0062589_100831569 | Not Available | 841 | Open in IMG/M |
3300004156|Ga0062589_101532943 | Not Available | 657 | Open in IMG/M |
3300004157|Ga0062590_100968536 | Not Available | 805 | Open in IMG/M |
3300004479|Ga0062595_101976781 | Not Available | 562 | Open in IMG/M |
3300004480|Ga0062592_101275613 | Not Available | 692 | Open in IMG/M |
3300004643|Ga0062591_101014083 | Not Available | 791 | Open in IMG/M |
3300004643|Ga0062591_102509855 | Not Available | 542 | Open in IMG/M |
3300004803|Ga0058862_12644429 | Not Available | 535 | Open in IMG/M |
3300005093|Ga0062594_103393904 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300005294|Ga0065705_10028241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1735 | Open in IMG/M |
3300005294|Ga0065705_10040154 | Not Available | 1151 | Open in IMG/M |
3300005294|Ga0065705_10283843 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
3300005294|Ga0065705_11052080 | Not Available | 534 | Open in IMG/M |
3300005295|Ga0065707_10485024 | Not Available | 762 | Open in IMG/M |
3300005327|Ga0070658_10128429 | All Organisms → cellular organisms → Bacteria | 2111 | Open in IMG/M |
3300005329|Ga0070683_100228298 | Not Available | 1770 | Open in IMG/M |
3300005329|Ga0070683_101618314 | Not Available | 623 | Open in IMG/M |
3300005330|Ga0070690_100037405 | Not Available | 3058 | Open in IMG/M |
3300005330|Ga0070690_100064431 | All Organisms → cellular organisms → Bacteria | 2367 | Open in IMG/M |
3300005330|Ga0070690_100073773 | Not Available | 2221 | Open in IMG/M |
3300005330|Ga0070690_100126747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1719 | Open in IMG/M |
3300005330|Ga0070690_101760504 | Not Available | 504 | Open in IMG/M |
3300005331|Ga0070670_100288181 | Not Available | 1434 | Open in IMG/M |
3300005331|Ga0070670_100699336 | Not Available | 911 | Open in IMG/M |
3300005332|Ga0066388_101323223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1244 | Open in IMG/M |
3300005332|Ga0066388_101538171 | Not Available | 1166 | Open in IMG/M |
3300005332|Ga0066388_104242157 | Not Available | 731 | Open in IMG/M |
3300005332|Ga0066388_104698739 | Not Available | 695 | Open in IMG/M |
3300005332|Ga0066388_105847567 | Not Available | 622 | Open in IMG/M |
3300005332|Ga0066388_107266361 | Not Available | 556 | Open in IMG/M |
3300005334|Ga0068869_100687082 | Not Available | 872 | Open in IMG/M |
3300005335|Ga0070666_10053234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2729 | Open in IMG/M |
3300005335|Ga0070666_10486786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 893 | Open in IMG/M |
3300005336|Ga0070680_100065601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2976 | Open in IMG/M |
3300005337|Ga0070682_100023325 | Not Available | 3672 | Open in IMG/M |
3300005337|Ga0070682_100052959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter marginalis | 2541 | Open in IMG/M |
3300005339|Ga0070660_100053959 | Not Available | 3101 | Open in IMG/M |
3300005339|Ga0070660_101534321 | Not Available | 566 | Open in IMG/M |
3300005340|Ga0070689_101505356 | Not Available | 609 | Open in IMG/M |
3300005341|Ga0070691_10537637 | Not Available | 681 | Open in IMG/M |
3300005343|Ga0070687_100033549 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2535 | Open in IMG/M |
3300005343|Ga0070687_100274263 | Not Available | 1059 | Open in IMG/M |
3300005344|Ga0070661_100001670 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 15382 | Open in IMG/M |
3300005344|Ga0070661_100735686 | Not Available | 806 | Open in IMG/M |
3300005345|Ga0070692_10639671 | Not Available | 709 | Open in IMG/M |
3300005345|Ga0070692_10928559 | Not Available | 604 | Open in IMG/M |
3300005347|Ga0070668_100041942 | Not Available | 3506 | Open in IMG/M |
3300005354|Ga0070675_100156092 | Not Available | 1959 | Open in IMG/M |
3300005356|Ga0070674_100240635 | Not Available | 1417 | Open in IMG/M |
3300005364|Ga0070673_100800024 | Not Available | 870 | Open in IMG/M |
3300005366|Ga0070659_100000518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 28356 | Open in IMG/M |
3300005366|Ga0070659_101658014 | Not Available | 571 | Open in IMG/M |
3300005367|Ga0070667_100120811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2278 | Open in IMG/M |
3300005367|Ga0070667_100318698 | Not Available | 1403 | Open in IMG/M |
3300005406|Ga0070703_10141021 | Not Available | 896 | Open in IMG/M |
3300005406|Ga0070703_10260996 | Not Available | 707 | Open in IMG/M |
3300005434|Ga0070709_10290192 | Not Available | 1192 | Open in IMG/M |
3300005435|Ga0070714_101031923 | Not Available | 801 | Open in IMG/M |
3300005436|Ga0070713_100586894 | Not Available | 1058 | Open in IMG/M |
3300005438|Ga0070701_10003731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 6080 | Open in IMG/M |
3300005438|Ga0070701_10008798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4387 | Open in IMG/M |
3300005439|Ga0070711_100002939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 9821 | Open in IMG/M |
3300005444|Ga0070694_101494449 | Not Available | 572 | Open in IMG/M |
3300005444|Ga0070694_101916349 | Not Available | 506 | Open in IMG/M |
3300005445|Ga0070708_100923935 | Not Available | 819 | Open in IMG/M |
3300005455|Ga0070663_100874464 | Not Available | 775 | Open in IMG/M |
3300005456|Ga0070678_100056251 | All Organisms → cellular organisms → Bacteria | 2876 | Open in IMG/M |
3300005456|Ga0070678_100079946 | Not Available | 2474 | Open in IMG/M |
3300005456|Ga0070678_101959839 | Not Available | 554 | Open in IMG/M |
3300005457|Ga0070662_100200599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium | 1583 | Open in IMG/M |
3300005466|Ga0070685_10026502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3195 | Open in IMG/M |
3300005535|Ga0070684_100004432 | All Organisms → cellular organisms → Bacteria | 10688 | Open in IMG/M |
3300005536|Ga0070697_100335134 | Not Available | 1305 | Open in IMG/M |
3300005536|Ga0070697_100424588 | Not Available | 1155 | Open in IMG/M |
3300005539|Ga0068853_101536984 | Not Available | 644 | Open in IMG/M |
3300005543|Ga0070672_100234273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Filomicrobium → Candidatus Filomicrobium marinum | 1543 | Open in IMG/M |
3300005545|Ga0070695_101007951 | Not Available | 677 | Open in IMG/M |
3300005548|Ga0070665_100822496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 942 | Open in IMG/M |
3300005549|Ga0070704_100030704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3603 | Open in IMG/M |
3300005563|Ga0068855_100630171 | Not Available | 1154 | Open in IMG/M |
3300005564|Ga0070664_100029998 | All Organisms → cellular organisms → Bacteria | 4535 | Open in IMG/M |
3300005564|Ga0070664_100118548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2315 | Open in IMG/M |
3300005615|Ga0070702_100046862 | All Organisms → cellular organisms → Bacteria | 2452 | Open in IMG/M |
3300005615|Ga0070702_100941048 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 679 | Open in IMG/M |
3300005616|Ga0068852_100228542 | All Organisms → cellular organisms → Bacteria | 1773 | Open in IMG/M |
3300005616|Ga0068852_100843356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 932 | Open in IMG/M |
3300005618|Ga0068864_101860228 | Not Available | 607 | Open in IMG/M |
3300005719|Ga0068861_102242405 | Not Available | 548 | Open in IMG/M |
3300005764|Ga0066903_100187115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3067 | Open in IMG/M |
3300005764|Ga0066903_101052738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloligella → unclassified Methyloligella → Methyloligella sp. GL2 | 1494 | Open in IMG/M |
3300005764|Ga0066903_102115062 | Not Available | 1084 | Open in IMG/M |
3300005764|Ga0066903_105825085 | Not Available | 647 | Open in IMG/M |
3300005764|Ga0066903_107320767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 570 | Open in IMG/M |
3300005764|Ga0066903_107507137 | Not Available | 562 | Open in IMG/M |
3300005844|Ga0068862_100104311 | Not Available | 2484 | Open in IMG/M |
3300005983|Ga0081540_1227091 | Not Available | 661 | Open in IMG/M |
3300006049|Ga0075417_10056522 | Not Available | 1709 | Open in IMG/M |
3300006049|Ga0075417_10126491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR65 | 1176 | Open in IMG/M |
3300006175|Ga0070712_102030827 | Not Available | 503 | Open in IMG/M |
3300006358|Ga0068871_100250451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1543 | Open in IMG/M |
3300006804|Ga0079221_10916953 | Not Available | 645 | Open in IMG/M |
3300006847|Ga0075431_101745225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 579 | Open in IMG/M |
3300006853|Ga0075420_101785749 | Not Available | 526 | Open in IMG/M |
3300006854|Ga0075425_100297900 | All Organisms → cellular organisms → Bacteria | 1856 | Open in IMG/M |
3300006854|Ga0075425_100444960 | Not Available | 1492 | Open in IMG/M |
3300006871|Ga0075434_100483220 | Not Available | 1260 | Open in IMG/M |
3300006871|Ga0075434_100810073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 953 | Open in IMG/M |
3300006880|Ga0075429_101128710 | Not Available | 685 | Open in IMG/M |
3300006880|Ga0075429_101233386 | Not Available | 653 | Open in IMG/M |
3300006904|Ga0075424_100101423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3034 | Open in IMG/M |
3300006914|Ga0075436_100074224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 2355 | Open in IMG/M |
3300006954|Ga0079219_10145554 | All Organisms → cellular organisms → Bacteria | 1255 | Open in IMG/M |
3300006954|Ga0079219_10909574 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
3300009036|Ga0105244_10344785 | Not Available | 687 | Open in IMG/M |
3300009093|Ga0105240_11226023 | Not Available | 794 | Open in IMG/M |
3300009094|Ga0111539_10354319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1708 | Open in IMG/M |
3300009098|Ga0105245_10372949 | Not Available | 1419 | Open in IMG/M |
3300009098|Ga0105245_11853100 | Not Available | 656 | Open in IMG/M |
3300009100|Ga0075418_10056855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 4182 | Open in IMG/M |
3300009100|Ga0075418_12017340 | Not Available | 628 | Open in IMG/M |
3300009101|Ga0105247_10033115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3142 | Open in IMG/M |
3300009101|Ga0105247_10659715 | Not Available | 783 | Open in IMG/M |
3300009101|Ga0105247_10867970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 694 | Open in IMG/M |
3300009147|Ga0114129_10093907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4155 | Open in IMG/M |
3300009147|Ga0114129_10854053 | Not Available | 1157 | Open in IMG/M |
3300009147|Ga0114129_11658080 | Not Available | 781 | Open in IMG/M |
3300009148|Ga0105243_10892919 | Not Available | 883 | Open in IMG/M |
3300009156|Ga0111538_10049533 | Not Available | 5388 | Open in IMG/M |
3300009162|Ga0075423_10206422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2060 | Open in IMG/M |
3300009162|Ga0075423_11800657 | Not Available | 660 | Open in IMG/M |
3300009174|Ga0105241_12698114 | Not Available | 500 | Open in IMG/M |
3300009176|Ga0105242_10008017 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8135 | Open in IMG/M |
3300009176|Ga0105242_10251943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1591 | Open in IMG/M |
3300009177|Ga0105248_10197447 | Not Available | 2267 | Open in IMG/M |
3300009177|Ga0105248_10197447 | Not Available | 2267 | Open in IMG/M |
3300009177|Ga0105248_10459185 | Not Available | 1436 | Open in IMG/M |
3300009177|Ga0105248_10643461 | Not Available | 1196 | Open in IMG/M |
3300009177|Ga0105248_10755799 | Not Available | 1097 | Open in IMG/M |
3300009177|Ga0105248_12417903 | Not Available | 598 | Open in IMG/M |
3300009488|Ga0114925_11344911 | Not Available | 527 | Open in IMG/M |
3300009545|Ga0105237_11203356 | Not Available | 764 | Open in IMG/M |
3300009553|Ga0105249_11408845 | Not Available | 769 | Open in IMG/M |
3300010047|Ga0126382_10775250 | Not Available | 814 | Open in IMG/M |
3300010362|Ga0126377_13361718 | Not Available | 517 | Open in IMG/M |
3300010371|Ga0134125_10256590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1942 | Open in IMG/M |
3300010373|Ga0134128_11197703 | Not Available | 838 | Open in IMG/M |
3300010373|Ga0134128_13046021 | Not Available | 515 | Open in IMG/M |
3300010375|Ga0105239_10195017 | Not Available | 2268 | Open in IMG/M |
3300010375|Ga0105239_10331375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1717 | Open in IMG/M |
3300010375|Ga0105239_10576137 | Not Available | 1283 | Open in IMG/M |
3300010375|Ga0105239_11349602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 823 | Open in IMG/M |
3300010376|Ga0126381_103160080 | Not Available | 652 | Open in IMG/M |
3300010396|Ga0134126_11299389 | Not Available | 806 | Open in IMG/M |
3300010397|Ga0134124_10288268 | Not Available | 1525 | Open in IMG/M |
3300010397|Ga0134124_10874834 | Not Available | 903 | Open in IMG/M |
3300010398|Ga0126383_12831975 | Not Available | 566 | Open in IMG/M |
3300010401|Ga0134121_10007634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 8686 | Open in IMG/M |
3300010401|Ga0134121_10276778 | Not Available | 1477 | Open in IMG/M |
3300010403|Ga0134123_10470504 | Not Available | 1174 | Open in IMG/M |
3300012882|Ga0157304_1025326 | Not Available | 784 | Open in IMG/M |
3300012897|Ga0157285_10055564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 979 | Open in IMG/M |
3300012899|Ga0157299_10006309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1865 | Open in IMG/M |
3300012903|Ga0157289_10313562 | Not Available | 559 | Open in IMG/M |
3300012905|Ga0157296_10010239 | Not Available | 1589 | Open in IMG/M |
3300012905|Ga0157296_10055551 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
3300012907|Ga0157283_10012063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1471 | Open in IMG/M |
3300012907|Ga0157283_10021218 | Not Available | 1234 | Open in IMG/M |
3300012908|Ga0157286_10260386 | Not Available | 616 | Open in IMG/M |
3300012911|Ga0157301_10010100 | Not Available | 1865 | Open in IMG/M |
3300012912|Ga0157306_10197029 | Not Available | 674 | Open in IMG/M |
3300012913|Ga0157298_10132494 | Not Available | 722 | Open in IMG/M |
3300012914|Ga0157297_10021027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1461 | Open in IMG/M |
3300012955|Ga0164298_10211971 | Not Available | 1141 | Open in IMG/M |
3300012958|Ga0164299_10165515 | Not Available | 1241 | Open in IMG/M |
3300012961|Ga0164302_10066573 | All Organisms → cellular organisms → Bacteria | 1861 | Open in IMG/M |
3300012964|Ga0153916_10991298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 921 | Open in IMG/M |
3300012971|Ga0126369_10726017 | Not Available | 1072 | Open in IMG/M |
3300013096|Ga0157307_1011594 | Not Available | 1368 | Open in IMG/M |
3300013096|Ga0157307_1106500 | Not Available | 603 | Open in IMG/M |
3300013102|Ga0157371_10442562 | Not Available | 955 | Open in IMG/M |
3300013102|Ga0157371_10825153 | Not Available | 700 | Open in IMG/M |
3300013104|Ga0157370_10240912 | All Organisms → cellular organisms → Bacteria | 1673 | Open in IMG/M |
3300013105|Ga0157369_10304213 | Not Available | 1658 | Open in IMG/M |
3300013296|Ga0157374_10034271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4636 | Open in IMG/M |
3300013296|Ga0157374_10917954 | Not Available | 893 | Open in IMG/M |
3300013297|Ga0157378_10374353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1397 | Open in IMG/M |
3300013306|Ga0163162_10152222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter marginalis | 2431 | Open in IMG/M |
3300013307|Ga0157372_10092561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3439 | Open in IMG/M |
3300013307|Ga0157372_11093469 | Not Available | 922 | Open in IMG/M |
3300013308|Ga0157375_10285093 | Not Available | 1815 | Open in IMG/M |
3300013308|Ga0157375_11608477 | Not Available | 768 | Open in IMG/M |
3300014325|Ga0163163_10059228 | Not Available | 3787 | Open in IMG/M |
3300014325|Ga0163163_10112075 | All Organisms → cellular organisms → Bacteria | 2757 | Open in IMG/M |
3300014325|Ga0163163_11399143 | Not Available | 761 | Open in IMG/M |
3300014325|Ga0163163_12014842 | Not Available | 637 | Open in IMG/M |
3300014325|Ga0163163_12050228 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 632 | Open in IMG/M |
3300014326|Ga0157380_10013003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6053 | Open in IMG/M |
3300014745|Ga0157377_10056224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2234 | Open in IMG/M |
3300014968|Ga0157379_11660261 | Not Available | 625 | Open in IMG/M |
3300015077|Ga0173483_10012764 | All Organisms → cellular organisms → Bacteria | 2889 | Open in IMG/M |
3300015077|Ga0173483_10014487 | Not Available | 2724 | Open in IMG/M |
3300015077|Ga0173483_10373580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 723 | Open in IMG/M |
3300015077|Ga0173483_10380196 | Not Available | 718 | Open in IMG/M |
3300015200|Ga0173480_10638149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 659 | Open in IMG/M |
3300015371|Ga0132258_12832692 | Not Available | 1207 | Open in IMG/M |
3300015373|Ga0132257_101211231 | Not Available | 956 | Open in IMG/M |
3300015374|Ga0132255_100340227 | All Organisms → cellular organisms → Bacteria | 2170 | Open in IMG/M |
3300015374|Ga0132255_103779734 | Not Available | 643 | Open in IMG/M |
3300016270|Ga0182036_11087657 | Not Available | 662 | Open in IMG/M |
3300016341|Ga0182035_12176585 | Not Available | 503 | Open in IMG/M |
3300016357|Ga0182032_10924443 | Not Available | 742 | Open in IMG/M |
3300016371|Ga0182034_10128693 | Not Available | 1868 | Open in IMG/M |
3300016387|Ga0182040_11940039 | Not Available | 505 | Open in IMG/M |
3300017792|Ga0163161_10023202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4374 | Open in IMG/M |
3300017792|Ga0163161_10048270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3075 | Open in IMG/M |
3300019356|Ga0173481_10005240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3456 | Open in IMG/M |
3300019356|Ga0173481_10039776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1562 | Open in IMG/M |
3300019356|Ga0173481_10084507 | All Organisms → cellular organisms → Bacteria | 1182 | Open in IMG/M |
3300019356|Ga0173481_10092360 | Not Available | 1145 | Open in IMG/M |
3300019356|Ga0173481_10799652 | Not Available | 521 | Open in IMG/M |
3300019362|Ga0173479_10070388 | Not Available | 1212 | Open in IMG/M |
3300019362|Ga0173479_10132412 | Not Available | 972 | Open in IMG/M |
3300019362|Ga0173479_10350049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 694 | Open in IMG/M |
3300021560|Ga0126371_10833339 | Not Available | 1068 | Open in IMG/M |
3300022886|Ga0247746_1093540 | Not Available | 729 | Open in IMG/M |
3300022889|Ga0247785_1007358 | Not Available | 1103 | Open in IMG/M |
3300022889|Ga0247785_1021207 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
3300022898|Ga0247745_1035146 | Not Available | 759 | Open in IMG/M |
3300022899|Ga0247795_1023795 | Not Available | 993 | Open in IMG/M |
3300023064|Ga0247801_1013372 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
3300023064|Ga0247801_1066601 | Not Available | 571 | Open in IMG/M |
3300023072|Ga0247799_1024215 | Not Available | 936 | Open in IMG/M |
3300025711|Ga0207696_1162167 | Not Available | 595 | Open in IMG/M |
3300025728|Ga0207655_1232242 | Not Available | 532 | Open in IMG/M |
3300025885|Ga0207653_10096141 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
3300025885|Ga0207653_10196291 | Not Available | 760 | Open in IMG/M |
3300025900|Ga0207710_10090407 | Not Available | 1432 | Open in IMG/M |
3300025901|Ga0207688_10038666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2649 | Open in IMG/M |
3300025903|Ga0207680_10074521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Filomicrobium → Candidatus Filomicrobium marinum | 2114 | Open in IMG/M |
3300025903|Ga0207680_10649444 | Not Available | 755 | Open in IMG/M |
3300025907|Ga0207645_10133226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1618 | Open in IMG/M |
3300025907|Ga0207645_10212620 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
3300025911|Ga0207654_10161557 | Not Available | 1448 | Open in IMG/M |
3300025911|Ga0207654_10371950 | Not Available | 988 | Open in IMG/M |
3300025911|Ga0207654_11312369 | Not Available | 528 | Open in IMG/M |
3300025911|Ga0207654_11443713 | Not Available | 502 | Open in IMG/M |
3300025914|Ga0207671_10711366 | Not Available | 799 | Open in IMG/M |
3300025914|Ga0207671_11142872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 611 | Open in IMG/M |
3300025915|Ga0207693_10030860 | Not Available | 4233 | Open in IMG/M |
3300025915|Ga0207693_10092858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2365 | Open in IMG/M |
3300025915|Ga0207693_10275552 | Not Available | 1318 | Open in IMG/M |
3300025918|Ga0207662_10057350 | All Organisms → cellular organisms → Bacteria | 2327 | Open in IMG/M |
3300025918|Ga0207662_10102200 | All Organisms → cellular organisms → Bacteria | 1777 | Open in IMG/M |
3300025918|Ga0207662_10117862 | Not Available | 1662 | Open in IMG/M |
3300025919|Ga0207657_10008464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 10434 | Open in IMG/M |
3300025919|Ga0207657_10041181 | Not Available | 4086 | Open in IMG/M |
3300025919|Ga0207657_10361456 | Not Available | 1144 | Open in IMG/M |
3300025920|Ga0207649_10050747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 2567 | Open in IMG/M |
3300025921|Ga0207652_10433520 | Not Available | 1185 | Open in IMG/M |
3300025925|Ga0207650_10161938 | Not Available | 1773 | Open in IMG/M |
3300025926|Ga0207659_11138871 | Not Available | 671 | Open in IMG/M |
3300025927|Ga0207687_10771723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 819 | Open in IMG/M |
3300025928|Ga0207700_10381482 | Not Available | 1233 | Open in IMG/M |
3300025931|Ga0207644_10090806 | Not Available | 2276 | Open in IMG/M |
3300025933|Ga0207706_10106942 | Not Available | 2462 | Open in IMG/M |
3300025933|Ga0207706_10177929 | Not Available | 1868 | Open in IMG/M |
3300025934|Ga0207686_11763053 | Not Available | 512 | Open in IMG/M |
3300025935|Ga0207709_10119886 | Not Available | 1774 | Open in IMG/M |
3300025935|Ga0207709_11524609 | Not Available | 555 | Open in IMG/M |
3300025939|Ga0207665_10005272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 8637 | Open in IMG/M |
3300025940|Ga0207691_11149170 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
3300025941|Ga0207711_10760186 | Not Available | 903 | Open in IMG/M |
3300025941|Ga0207711_11916800 | Not Available | 535 | Open in IMG/M |
3300025944|Ga0207661_10407223 | Not Available | 1234 | Open in IMG/M |
3300025944|Ga0207661_12152511 | Not Available | 504 | Open in IMG/M |
3300025949|Ga0207667_10093046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3113 | Open in IMG/M |
3300025949|Ga0207667_10975180 | Not Available | 836 | Open in IMG/M |
3300025960|Ga0207651_10176725 | Not Available | 1689 | Open in IMG/M |
3300025960|Ga0207651_10793793 | Not Available | 839 | Open in IMG/M |
3300025960|Ga0207651_11308894 | Not Available | 651 | Open in IMG/M |
3300025960|Ga0207651_11470154 | Not Available | 614 | Open in IMG/M |
3300025960|Ga0207651_11989986 | Not Available | 522 | Open in IMG/M |
3300025961|Ga0207712_10042981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Filomicrobium → Candidatus Filomicrobium marinum | 3115 | Open in IMG/M |
3300025961|Ga0207712_10646461 | Not Available | 919 | Open in IMG/M |
3300025972|Ga0207668_10154746 | All Organisms → cellular organisms → Bacteria | 1780 | Open in IMG/M |
3300025981|Ga0207640_10119148 | All Organisms → cellular organisms → Bacteria | 1887 | Open in IMG/M |
3300026023|Ga0207677_10205044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1570 | Open in IMG/M |
3300026035|Ga0207703_10431786 | Not Available | 1227 | Open in IMG/M |
3300026067|Ga0207678_10023211 | All Organisms → cellular organisms → Bacteria | 5427 | Open in IMG/M |
3300026078|Ga0207702_11938161 | Not Available | 580 | Open in IMG/M |
3300026089|Ga0207648_11483505 | Not Available | 637 | Open in IMG/M |
3300026116|Ga0207674_10362334 | Not Available | 1401 | Open in IMG/M |
3300026121|Ga0207683_10070947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3078 | Open in IMG/M |
3300026121|Ga0207683_10648915 | Not Available | 978 | Open in IMG/M |
3300026142|Ga0207698_10788589 | Not Available | 951 | Open in IMG/M |
3300026884|Ga0207455_1002117 | Not Available | 874 | Open in IMG/M |
3300027717|Ga0209998_10022690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1355 | Open in IMG/M |
3300028380|Ga0268265_10267851 | Not Available | 1522 | Open in IMG/M |
3300028381|Ga0268264_10341369 | Not Available | 1423 | Open in IMG/M |
3300028381|Ga0268264_10367357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1374 | Open in IMG/M |
3300031545|Ga0318541_10582419 | Not Available | 626 | Open in IMG/M |
3300031547|Ga0310887_10137694 | All Organisms → cellular organisms → Bacteria | 1264 | Open in IMG/M |
3300031547|Ga0310887_10218598 | Not Available | 1046 | Open in IMG/M |
3300031562|Ga0310886_10482510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 745 | Open in IMG/M |
3300031573|Ga0310915_10717927 | Not Available | 705 | Open in IMG/M |
3300031677|Ga0307480_1021525 | Not Available | 523 | Open in IMG/M |
3300031719|Ga0306917_10634894 | Not Available | 840 | Open in IMG/M |
3300031820|Ga0307473_10910754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 636 | Open in IMG/M |
3300031847|Ga0310907_10567615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 615 | Open in IMG/M |
3300031854|Ga0310904_10071451 | All Organisms → cellular organisms → Bacteria | 1812 | Open in IMG/M |
3300031892|Ga0310893_10196310 | Not Available | 811 | Open in IMG/M |
3300031908|Ga0310900_10908343 | Not Available | 719 | Open in IMG/M |
3300031913|Ga0310891_10395065 | Not Available | 503 | Open in IMG/M |
3300031942|Ga0310916_11509123 | Not Available | 548 | Open in IMG/M |
3300031944|Ga0310884_10702994 | Not Available | 612 | Open in IMG/M |
3300031945|Ga0310913_11306779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 503 | Open in IMG/M |
3300032003|Ga0310897_10381264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 663 | Open in IMG/M |
3300032076|Ga0306924_10762280 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1082 | Open in IMG/M |
3300032211|Ga0310896_10019734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2373 | Open in IMG/M |
3300032211|Ga0310896_10136026 | Not Available | 1147 | Open in IMG/M |
3300032211|Ga0310896_10317202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 811 | Open in IMG/M |
3300033289|Ga0310914_11263175 | Not Available | 641 | Open in IMG/M |
3300033412|Ga0310810_10554723 | Not Available | 1121 | Open in IMG/M |
3300033475|Ga0310811_11287300 | Not Available | 585 | Open in IMG/M |
3300033551|Ga0247830_10140780 | Not Available | 1752 | Open in IMG/M |
3300033551|Ga0247830_10140780 | Not Available | 1752 | Open in IMG/M |
3300034681|Ga0370546_045758 | Not Available | 664 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.69% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.69% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.98% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 5.41% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 5.13% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.56% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 4.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.27% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.70% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.42% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.42% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 3.42% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.13% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.56% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.28% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.99% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.99% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.99% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.71% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.71% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.71% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.42% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.42% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.42% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.42% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.14% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.85% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.85% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.85% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.85% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.57% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.57% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.57% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.28% |
Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.28% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.28% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.28% |
Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.28% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.28% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.28% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.28% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
2088090015 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
2170459020 | Litter degradation NP2 | Engineered | Open in IMG/M |
3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000881 | Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soil | Environmental | Open in IMG/M |
3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Host-Associated | Open in IMG/M |
3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Host-Associated | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Host-Associated | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009488 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG | Environmental | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300012882 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 | Environmental | Open in IMG/M |
3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
3300012905 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2 | Environmental | Open in IMG/M |
3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
3300012913 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2 | Environmental | Open in IMG/M |
3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300013096 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 | Environmental | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022886 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5 | Environmental | Open in IMG/M |
3300022889 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S096-311B-4 | Environmental | Open in IMG/M |
3300022898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5 | Environmental | Open in IMG/M |
3300022899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6 | Environmental | Open in IMG/M |
3300023064 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S001-104B-6 | Environmental | Open in IMG/M |
3300023072 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S151-409C-6 | Environmental | Open in IMG/M |
3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026884 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05K5-12 (SPAdes) | Environmental | Open in IMG/M |
3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031677 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
3300034681 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_121 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
GPIPI_00079160 | 2088090014 | Soil | MAPQSDTNTLYVLVCSLAGTILSLAATWIVVAQSTQSMVA |
GPIPI_02633370 | 2088090014 | Soil | MLEIGSNKEIGGSAMAPQSDTNTLYVLVCSLAGTVLSLAGTWIVVAHSFVQPIVA |
GPICI_02706710 | 2088090015 | Soil | MLKTGLGQELGGSVMAPQSDTSSLYVLVCSLAGTIVGLAATWIVVAHSFVQPMVA |
GPICI_01995160 | 2088090015 | Soil | MLKIGLSRQIGGSAMTPQSDTRTLYVLVSSLAGTVLSLAATWIFVAHSVQPLVA |
GPICI_00214830 | 2088090015 | Soil | LGGSVMAPQSDTSSLYVLICSLAGTVLSLAATWIVVAHSFVQPMVA |
4MG_02137490 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | QSDTNTLYVLICSLAGTVLSLAATWIVVAHSFVQPMVA |
2NP_03985580 | 2170459020 | Switchgrass, Maize And Mischanthus Litter | MLKKGLGGNFGGSVMAPQSDTNTLYVLICSLAGTVLSLAATWIVVAHSFVQPMVA |
ICChiseqgaiiDRAFT_05938371 | 3300000033 | Soil | VMLKISIGHEFGGSVMAPQSDTNTLYVLVCSLAGTVLSLGSTLIFVAHSFAQPMVS* |
F24TB_104098981 | 3300000550 | Soil | APQSDTSTLYVLVCSLAGTVLSLAATWIVVAHSFVQPMVA* |
JGI11643J11755_117713421 | 3300000787 | Soil | SDKNTLYVLICSLAGTILSLAATWFFVAHSFAQPMVA* |
JGI11643J11755_117886804 | 3300000787 | Soil | MAPQSDTTTLYVLVCSLASTVLSLATTWIVVAXSFVQPMVA* |
JGI10215J12807_10728351 | 3300000881 | Soil | LGQELGGSVMAPQSDTTSLYVLVCSLAGTIVGLAATWIVVAHSLVQPMVA* |
JGI10215J12807_14394621 | 3300000881 | Soil | GRNFGGSVMAPQSDTTTLYVLVCSLAGTVLSLATTWIVVAHSYVQPMVA* |
JGI11643J12802_101571521 | 3300000890 | Soil | MTPQSDTRTLYVLVSSLAGTVLSLAATWIFVAHSVQPLVA* |
JGI11643J12802_103965371 | 3300000890 | Soil | CSRKVLGGNFGGSVMAPQSDTNTLYVLVCSLAGTILSLAATWIVVAQSTQSMVA* |
JGI11643J12802_108958861 | 3300000890 | Soil | LGGSVMAPQSDTSSLYVLVCSLAGTVVGLAATWIVVAHSFVQPMVA* |
JGI1027J12803_1022641745 | 3300000955 | Soil | MLKIGLSRQIGGSAMTPQSDTRTLYVLVSSLAGTVLSLAATWIFVAHSVQPLVA* |
JGI10216J12902_1018716196 | 3300000956 | Soil | LGQEFGGSVMAPQSDTSSLYVLACSMAGTIVGLAATWIVVAHTFVQPMVA* |
JGI10216J12902_1125058851 | 3300000956 | Soil | MLKIGLSSQIGGSAMATQSDTRTLYVLVSSLAGSVLSLAATWIFVAHSVQ |
JGI24747J21853_10176141 | 3300001978 | Corn, Switchgrass And Miscanthus Rhizosphere | TTSLYVLVCSLAGTIVGLAATWIVVAHSFVQPMVA* |
JGI24744J21845_101041281 | 3300002077 | Corn, Switchgrass And Miscanthus Rhizosphere | TSLYVLVCSLAGTIVGLAATWIVVAHSFVQPMVA* |
Ga0062593_1005955821 | 3300004114 | Soil | MFEIGSNKLIGGSPMAPHSDARTLYVLVSSLAGTVLSLAATWIFVAHSVQPLVA* |
Ga0062593_1008161702 | 3300004114 | Soil | MVEIGSNKEIGGSAMAPQSDARTLYVLVSSLAGTVLSLAATWIFVAHSLQPMVA* |
Ga0062593_1010665482 | 3300004114 | Soil | MAPQSDTRTLYVLVSSLAGTVLSLGATWIIVAPSVQSMVA* |
Ga0062589_1008315692 | 3300004156 | Soil | MTTQLEASTLYVLVSSLAGTILSLAVTWFFVAHSFVQPIVA* |
Ga0062589_1015329431 | 3300004156 | Soil | MLEIGSNKEIGGSAMAPQSDTNTLYVLVCSLGGTVLSLAGTWIVVAHSFVQPIVA* |
Ga0062590_1009685361 | 3300004157 | Soil | SVMAPQSDTTSLYVLVCSLAGTIVGLAATWIVVAHSLVQPMVA* |
Ga0062595_1019767811 | 3300004479 | Soil | MASQSDARTLYVLVSSLAGTVLSLAGTWIVVAHSFVQPMVS* |
Ga0062592_1012756131 | 3300004480 | Soil | GGSVMAPQSDTSSLYVLVCSLAGTIVGLAATWMVVAHSFVQPMVA* |
Ga0062591_1010140832 | 3300004643 | Soil | MAPQSDTRTLYVLVSSLAGTVLSLAATWIFVVHSVQPLVA* |
Ga0062591_1025098551 | 3300004643 | Soil | MAPQSDTTSLYVLVCSMAGTIVGLAATWIVVAHTFVQPMVA* |
Ga0058862_126444291 | 3300004803 | Host-Associated | MAPQSDATSLYVLVCSLAGTIVGLAATWIVVAHSFVQPMVA* |
Ga0062594_1033939041 | 3300005093 | Soil | EGLGQELGGSVMAPQSDTTSLYVLVCSLAGTIVGLAATWIVVAHSLVQPMVA* |
Ga0065705_100282412 | 3300005294 | Switchgrass Rhizosphere | MLKKGLGQKLGGSVMAPQSDTTTLYVLVCSLAGTVLSLATTWIVVAHSFVQPMVA* |
Ga0065705_100401542 | 3300005294 | Switchgrass Rhizosphere | MAPQSDTTTVYVLVCSLAGTILSLAATWIVVAHSFVQPMVA* |
Ga0065705_102838432 | 3300005294 | Switchgrass Rhizosphere | KVLGGNFGGSVMAPQSDTNTLYVLICSLAGTVLSLAATWIVVAHSFVQPMVA* |
Ga0065705_110520801 | 3300005294 | Switchgrass Rhizosphere | MAPQSDTSSLYVLVCSLAGTIVGLAATWMVVAHSFVQPMVA* |
Ga0065707_104850241 | 3300005295 | Switchgrass Rhizosphere | MAPQSDTNTLYVLVCSLAGTILSLAATWIVVAQSTQSMVA* |
Ga0070658_101284293 | 3300005327 | Corn Rhizosphere | ELGGSVMAPQPDTSSLYVLVCSLAGTVVGLAATWIVVAHSFVQPMVA* |
Ga0070683_1002282981 | 3300005329 | Corn Rhizosphere | FGGSVMAPQSDTTTLYVLVCSLAGTVLSLAATWIVIAQSTHSMIA* |
Ga0070683_1016183142 | 3300005329 | Corn Rhizosphere | MLKIDLGQQLGGSVMAPQSDTSSLYVLVCSMAGTIVGLAATWIVVAHTFVQPMVA* |
Ga0070690_1000374051 | 3300005330 | Switchgrass Rhizosphere | MAPQSDTSSLYVLICSLAGTVLSLAATWIVVAHSAQAMIA* |
Ga0070690_1000644311 | 3300005330 | Switchgrass Rhizosphere | MAPQSDTSSLYVLVCSLAGTVVGLAATWIVVAHSFVQPMVA* |
Ga0070690_1000737732 | 3300005330 | Switchgrass Rhizosphere | FTILLMLKKGLGQDFGGSVMAPQSDTTTLYVLVCSLAGTVLSLATTWIVVAHSYVQPMVA |
Ga0070690_1001267471 | 3300005330 | Switchgrass Rhizosphere | VMAPQSDTSTLYVLVCSLAGTVLSLATTWIVVAHSFVQPMVA* |
Ga0070690_1017605041 | 3300005330 | Switchgrass Rhizosphere | RKVLGGNFGGSVMAPQSDTTTLYVLVCSLAGTVLSLAATWIVIAQSTHSMIA* |
Ga0070670_1002881811 | 3300005331 | Switchgrass Rhizosphere | MLYDSPHAQEGLGQKLGGSVMAPQSDTSSLYVLICSLAGTVLSLAATWIVVSHSFVQPMVA* |
Ga0070670_1006993362 | 3300005331 | Switchgrass Rhizosphere | MAPQSDARTLYVLVSSLAGAVLSLAPTWIFAAHSVQPIVA* |
Ga0066388_1013232232 | 3300005332 | Tropical Forest Soil | MAPQSEARTLYVLVSSLAGTVLSLPPRIFVAHSVQPMVA* |
Ga0066388_1015381712 | 3300005332 | Tropical Forest Soil | MSPQSEARTLYVLVSSLAGTVLSLAFTWIFVAHSVQPMVA* |
Ga0066388_1042421571 | 3300005332 | Tropical Forest Soil | MAPQSDTNTLYVLVCSLAGTVLSLGSTLIFVAHSFAQPMIS* |
Ga0066388_1046987391 | 3300005332 | Tropical Forest Soil | FGGSVMAPQSDTSSLYVLACSMAGTIVGLAATWIVVAHTFVQPMVA* |
Ga0066388_1058475671 | 3300005332 | Tropical Forest Soil | MAPESEARTLYVLVSSLARTVLSLAITWVFVAHSVQPMVA* |
Ga0066388_1072663611 | 3300005332 | Tropical Forest Soil | MAPQSDTSSLYVLVYSMAGTIVGLAATWIVVAHSFVQPMVA* |
Ga0068869_1006870822 | 3300005334 | Miscanthus Rhizosphere | MAPQSDTSSLYVLICSLAGTVLSLAATWIVVSHSFVQPMVA* |
Ga0070666_100532345 | 3300005335 | Switchgrass Rhizosphere | MAPQSDARTLYVLVSSLAGAVLSLAATWIFVAHSVQPIVA* |
Ga0070666_104867862 | 3300005335 | Switchgrass Rhizosphere | MFEIGSNKLIGGSPMAPHSDARTLYVLVSSLAGTVLSLAATWIFVARSVQPLVA* |
Ga0070680_1000656016 | 3300005336 | Corn Rhizosphere | MAPQSDTTSLYVLVCSLAGTIVGLAATWIVVAHSFVQPMVA* |
Ga0070682_1000233253 | 3300005337 | Corn Rhizosphere | MAPQSDTTTLYVLVCSLAGTVLSLATTWIVVAHSYVQPMVA* |
Ga0070682_1000529592 | 3300005337 | Corn Rhizosphere | MAPQSDARTLYVLVSSLAGAVLSLAATWIFAAHSVQPIVA* |
Ga0070660_1000539591 | 3300005339 | Corn Rhizosphere | MLKKVLGRKLGGSVMAPQSDTSSLYVLICSLAGTVLSLAATWIVVSHSFVQPMVA* |
Ga0070660_1015343211 | 3300005339 | Corn Rhizosphere | MLKTGLGQELGGSVMAPQSDTSSLYVLVCSLAGTIVGLAATWIVVAHTFVQPMVA* |
Ga0070689_1015053562 | 3300005340 | Switchgrass Rhizosphere | MAPQSDTTTLYVLLCSLAGTVLSLAATWIVIAQSTHSMIA* |
Ga0070691_105376371 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MFEIGSNKLIGGSPMAPHSDARTLYVLVSSLAGTVLSLAATWIFVAH |
Ga0070687_1000335491 | 3300005343 | Switchgrass Rhizosphere | SVMAPQSDTSSLYVLVCSLAGTVVGLAATWIVVAHSFVQPMVA* |
Ga0070687_1002742632 | 3300005343 | Switchgrass Rhizosphere | MLKKVLGRKLGGSVMAPQSDTSSLYVLICSLAGTVLSLAATWIVVAHSAQAMIA* |
Ga0070661_1000016704 | 3300005344 | Corn Rhizosphere | MAPQSDTSTLYVLVCSLAGTVLSLATTWIVVAHSFVQPMVA* |
Ga0070661_1007356861 | 3300005344 | Corn Rhizosphere | MAPQSDTSTLYVLVCSLAGTIVGLAATWIVVAHSFVQPMVA* |
Ga0070692_106396711 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MAPQSDTSSLYVLVCSMAGTIVGLAATWIVVAHTFVQPMVA* |
Ga0070692_109285592 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | HAQEGLGQELGGSVMAPQSDTSSLYVLVCSLAGTVVGLAATWIVVAHSFVQPMVA* |
Ga0070668_1000419421 | 3300005347 | Switchgrass Rhizosphere | MLYDSPHAQEGLGQKLGGSVMAPQSDTSSLYVLICSLAGTVLSLAATWIVV |
Ga0070675_1001560921 | 3300005354 | Miscanthus Rhizosphere | MLYDSPHAQEGLGQKLGGSVMAPQSDTSSLYVLICSLAGTVLSLAATWIVVAHSAQA |
Ga0070674_1002406351 | 3300005356 | Miscanthus Rhizosphere | MAPQADTTTLYVLVCSLAGTILSLAATWIVIAQSTHSMVA* |
Ga0070673_1008000243 | 3300005364 | Switchgrass Rhizosphere | KLGGSVMAPQSDTSSLYVLICSLAGTVLSLAATWIVVANSAQAMIA* |
Ga0070659_10000051832 | 3300005366 | Corn Rhizosphere | MAPQSDATSLYVLVCSLAGTIVGLGATWIVVAHSFVQPMVA* |
Ga0070659_1016580141 | 3300005366 | Corn Rhizosphere | MAPQSDTSTLYVLVCSLAGTVLTLATTWIVVAHSYVQPMVA* |
Ga0070667_1001208113 | 3300005367 | Switchgrass Rhizosphere | MAPQSDTTTLYVLVCSLAGTVLSLATTWIVVAHSFVQPMVA* |
Ga0070667_1003186981 | 3300005367 | Switchgrass Rhizosphere | YDSPHAQEGLGQKLGGSVMAPQSDTSSLYVLICSLAGTVLSLAATWIVVSHSFVQPMVA* |
Ga0070703_101410211 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | ELGGSVMAPQSDTSSLYVLVCSLAGTVVGLAATWIVVAHSFVQPMVA* |
Ga0070703_102609961 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MLKIDLGQQLGGSVMAPQSDTSSLYVLVCSMAGTIVGLAATWIVVAHSLVQPMVA* |
Ga0070709_102901923 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MAPQSDTTTLYVLVCSLAGTILSLAATWIVIAQSTHSMVA* |
Ga0070714_1010319232 | 3300005435 | Agricultural Soil | MAPQSDTSSLYVLVCSMAGTIVGLGATWIVVAHTFVQPMVA* |
Ga0070713_1005868943 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MAPQSDTNTLYVLVCSLAGTILSLAATWIVIAQSTHSMVA* |
Ga0070701_100037319 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | AQEGLGQELGGSVMAPQSDTSSLYVLVCSLAGTVVGLAATWIVVAHSFVQPMVA* |
Ga0070701_100087986 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | PQSDTSTLYVLVCSLAGTVLSLATTWIVVAHSFVQPMVA* |
Ga0070711_1000029398 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MAPQSDTTTLYVLVCSLAGTVLSLAATWIVIAQSTHSMIA* |
Ga0070694_1014944491 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | EGLGQELGGSVMAPQSDTSSLYVLICSLAGTVLSLAATWIVVAHSAQAMIA* |
Ga0070694_1019163491 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MAPQSDTNTLYVLVCSLGGTVLSLAGTWIVVAHSFVQPIV |
Ga0070708_1009239353 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | LGGSVMAPQSDTTSLYVLVCSLAGTIVGLGATWIVVAHSFVQPMVA* |
Ga0070663_1008744642 | 3300005455 | Corn Rhizosphere | MAPQSDTNTLYVLVCSLAGTVLSLAGTWIVVAHSFVQPIVA* |
Ga0070678_1000562515 | 3300005456 | Miscanthus Rhizosphere | MAPQSDARTLYVLVSSLAGTVLSLAATWIFVAHSVQPIVA* |
Ga0070678_1000799465 | 3300005456 | Miscanthus Rhizosphere | MLKIDLGQQLGGSVMAPQSDTSSLYVLVCSMAGTIVGLGATWIVVAHTFVQPMVA* |
Ga0070678_1019598391 | 3300005456 | Miscanthus Rhizosphere | GLGQELGGSVMAPQSDTSSLYVLVCSLAGTIVGLAATWMVVAHSFVQPMVA* |
Ga0070662_1002005993 | 3300005457 | Corn Rhizosphere | GQELGGSVMAPQSDTSSLYVLVCSLAGTIVGLAATWMVVAHSFVQPMVA* |
Ga0070685_100265021 | 3300005466 | Switchgrass Rhizosphere | LYDSPHAQEGLGQELGGSVMAPQSDTSSLYVLVCSLAGTVVGLAATWIVVAHSFVQPMVA |
Ga0070684_1000044328 | 3300005535 | Corn Rhizosphere | MAPQSDTSTLYVLVCSLAGTVLSLATTWIVVARSFVQPMVA* |
Ga0070697_1003351343 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | EGLGQELGGSVMAPQSDTSSLYVLICSLAGTVLSLAATWIVVAHSFVQPMVA* |
Ga0070697_1004245882 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MLKIDLGQQLGGSVMAPQSDTSSLYVLVCSMAGTIVGLAATWIVVAHSFVQPMVA* |
Ga0068853_1015369841 | 3300005539 | Corn Rhizosphere | MLKTGLGQELGGSVMAPQSDTSSLYVLVCSLAGTIVGLGATWIVVAHSFVQPM |
Ga0070672_1002342735 | 3300005543 | Miscanthus Rhizosphere | PQSDTTSLYVLVCSLAGTIVGLAATWIVVAHSFVQPMVA* |
Ga0070695_1010079511 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | GLGQELGGSVMAPQSDTSSLYVLVCSLAGTIVGLAATWIVVAHTFVQPMVA* |
Ga0070665_1008224961 | 3300005548 | Switchgrass Rhizosphere | TSSLYVLVCSLAGTVVGLAATWIVVAHSFVQPMVA* |
Ga0070704_1000307041 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | EGLGQELGGSVMAPQSDTSSLYVLVCSLAGTVVGLAATWIVVAHSFVQPMVA* |
Ga0068855_1006301713 | 3300005563 | Corn Rhizosphere | MLKTGLGQELGGSVMAPQSDTSSLYVLVCSMAGTIVGLGATWIVVAHTFVQPMVA* |
Ga0070664_1000299983 | 3300005564 | Corn Rhizosphere | MAPQSDTTTLYVLVCSLAGTILSLAATWIVIAHSFVQPMVA* |
Ga0070664_1001185483 | 3300005564 | Corn Rhizosphere | MAPQSDTSSLYVLICSLAGTVLSLAATWIVVANSAQAMIA* |
Ga0070702_1000468623 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | YDSPHAQEGLGQELGGSVMAPQSDTSSLYVLVCSLAGTVVGLAATWIVVAHSFVQPMVA* |
Ga0070702_1009410481 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | PQSDTSTLYVLVCSLAGTVLSLATTWIVVARSFVQPMVA* |
Ga0068852_1002285421 | 3300005616 | Corn Rhizosphere | LPMLKTGLGQELGGSVMAPQSDTSSLYVLVCSLAGTVVGLAATWIVVAHSFVQPMVA* |
Ga0068852_1008433563 | 3300005616 | Corn Rhizosphere | MAPQSDTTSLYVLVCSLAGTIVGLAATWIVVAHSFVQPMVASF |
Ga0068864_1018602281 | 3300005618 | Switchgrass Rhizosphere | MAPQSDTSSLYVLVCSLAGTIVGLAATWIVVAHTFVQPMVA* |
Ga0068861_1022424052 | 3300005719 | Switchgrass Rhizosphere | TGLGQELGGSVMAPQSDTSSLYVLVCSLAGTIVGLAATWMVVAHSFVQPMVA* |
Ga0066903_1001871156 | 3300005764 | Tropical Forest Soil | MAPQSDTRTLYVLVSSLAGTVLSLAFTWIFVAHSVQPLVA* |
Ga0066903_1010527385 | 3300005764 | Tropical Forest Soil | MAPQSEARTLYVLVSSLAGTVLSLAFTWIFVAHSVQPLVA* |
Ga0066903_1021150621 | 3300005764 | Tropical Forest Soil | MLKIGLSNQIGGSPMAPQSEARTLYVLVSSLAGTVLSLAFTWIFVAHSAQAMVA* |
Ga0066903_1058250851 | 3300005764 | Tropical Forest Soil | MAPQSDTNTLYVLVCSLAGAVLSLGSTLIFVAHSFAQPMAS* |
Ga0066903_1073207671 | 3300005764 | Tropical Forest Soil | PMATQSEARTLNVLVSSLAGTVLSLAATWIFVAHSVQPMVA* |
Ga0066903_1075071371 | 3300005764 | Tropical Forest Soil | MLEIGSNEQIGGSPMAPQSDTRTLYVLVSSLAGTVLSLAFTWIYVAHSVQPLVA* |
Ga0068862_1001043114 | 3300005844 | Switchgrass Rhizosphere | FTILLMLKKGLGQDFGGSVMAPQSDTTTLYVLVCSLAGTVLSLATTWIVVAHSFVQPMVA |
Ga0081540_12270912 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MAPQSDTSSLYVLVCSLAGTVVGLAATWIVVAHSFAQPMVA* |
Ga0075417_100565223 | 3300006049 | Populus Rhizosphere | MLEIGSNKEIGGSAMAPQSDTNTLYVLVCSLAGTVLSLAGTWIVVAHSFVQPIVA* |
Ga0075417_101264911 | 3300006049 | Populus Rhizosphere | FGGSVMAPQSDTTSLYVLVCSLAGTIVGLAATWIVVAHSFVQPMVA* |
Ga0070712_1020308272 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTQLEASTLYVLVSSLAGTILSLAVTWLFVAHSFVQPIVA* |
Ga0068871_1002504513 | 3300006358 | Miscanthus Rhizosphere | MLYDSPHAQEGLGQELGGSVMAPQSDTSSLYVLVCSLAGTVVGLAATWIVVAHSFVQPMVA* |
Ga0079221_109169531 | 3300006804 | Agricultural Soil | MLEIGSNKEIGGPAMAPQSDTNTLYVLVCSLAGTVLSLAGTWVVVAHSFVQPIVA* |
Ga0075431_1017452251 | 3300006847 | Populus Rhizosphere | SDARTLYVLVSSLAGTVLSLAATWIFVAHSVQPLVA* |
Ga0075420_1017857491 | 3300006853 | Populus Rhizosphere | MAPQSDTNTLYVLVCSLAGTVLSLAGTWIVVAHSFVQPIV |
Ga0075425_1002979003 | 3300006854 | Populus Rhizosphere | MLYDSPHAQEGLGQELGGSVMAPQSDTSSLYVLVCSLAGTIVGLAATWIVVAHSFVQPMVA* |
Ga0075425_1004449605 | 3300006854 | Populus Rhizosphere | GSVMAPQSDTSSLYVLVCSMAGTIVGLAATWIVVAHTFVQPMVA* |
Ga0075434_1004832201 | 3300006871 | Populus Rhizosphere | DTSSLYVLICSLAGTVLSLAATWIVVAHSFVQPMVA* |
Ga0075434_1008100731 | 3300006871 | Populus Rhizosphere | DTSSLYVLICSLAGTVLSLAATWIVVANSAQAMIA* |
Ga0075429_1011287102 | 3300006880 | Populus Rhizosphere | HAQEGLGQELGGSVMAPQSDTSSLYVLICSLAGTVLSLAATWIVVSHSFVQPMVA* |
Ga0075429_1012333861 | 3300006880 | Populus Rhizosphere | APQSDTSSLYVLICSLAGTVLSLAATWIVVAHSAQAMIA* |
Ga0075424_1001014235 | 3300006904 | Populus Rhizosphere | MAPQSDTTSLYVLVCSLAGTIVGLAATWIIVAHSFVQPMVA* |
Ga0075436_1000742242 | 3300006914 | Populus Rhizosphere | MAPQSDTNTLYVLVCSLAGTVLSLAGTWVVVAHSFVQPIVA* |
Ga0079219_101455541 | 3300006954 | Agricultural Soil | QSDTNTLYVLVCSLGGTVLSLAGTWIVVAHSFVQPIVA* |
Ga0079219_109095742 | 3300006954 | Agricultural Soil | MAPQSDTSSLYVLICSLAGTVLSLAATWIVIAHSFVQPMVA* |
Ga0105244_103447851 | 3300009036 | Miscanthus Rhizosphere | MLKKVLGRKLGGSVMAPQSDTSSLYVLICSLAGTVLSLAATWIVVAHSFVQPMVA* |
Ga0105240_112260231 | 3300009093 | Corn Rhizosphere | MAPQSDTTTLYVLVCSLAGTVLSLATTWIVVAHSYVQP |
Ga0111539_103543194 | 3300009094 | Populus Rhizosphere | MAPQSDTTTLYVLVCSLAGTVLSLATTCIVVAHSYV |
Ga0105245_103729491 | 3300009098 | Miscanthus Rhizosphere | GNFGGSVMAPQSDTTTLYVLVCSLAGTVLSLAATWIVIAQSTHSMIA* |
Ga0105245_118531001 | 3300009098 | Miscanthus Rhizosphere | LKTGLGQELGGSVMAPQSDTSSLYVLVCSLAGTIVGLAATWMVVAHSFVQPMVA* |
Ga0075418_100568558 | 3300009100 | Populus Rhizosphere | MAPQSDTNTLYVLVCSLAGTVLSLAGTWIVVAHSFVQPIVG* |
Ga0075418_120173401 | 3300009100 | Populus Rhizosphere | MAPQSDTSSLYVLVCSLAGTVLSLAATWIVIAHSFVQ |
Ga0105247_100331154 | 3300009101 | Switchgrass Rhizosphere | MLKTGLGQEPGGSVMAPQSDTSSLYVLVCSLAGTIVGLAATWMVVAHSFVQPMVA* |
Ga0105247_106597151 | 3300009101 | Switchgrass Rhizosphere | PHAQEGLGQELGGSVMAPQSDTSSLYVLVCSMAGTIVGLGATWIVVAHTFVQPMVA* |
Ga0105247_108679702 | 3300009101 | Switchgrass Rhizosphere | GLSRQIGRSAMATQSDTNTLYVLVCSLAGTVLSLAATWIFVALAARPMVA* |
Ga0114129_100939074 | 3300009147 | Populus Rhizosphere | MAPQSDTSTLYVLVCSLAGTVLTLATTWIVVAHSFVQPMVA* |
Ga0114129_108540531 | 3300009147 | Populus Rhizosphere | MAPQSDARTLYVLVSSLAGTVLSLAATWIFVAHSVQPMVA* |
Ga0114129_116580801 | 3300009147 | Populus Rhizosphere | MLKTVLGQELGGSVMAPQSDTSSLYVLVCSLAGTIVGLAATWIVVAHSFVQPMVA* |
Ga0105243_108929192 | 3300009148 | Miscanthus Rhizosphere | MLKTGLGQELGGSVMAPQSDTSSLYVLVCSMAGTIVGLAATWIVVAHSFVQPM |
Ga0111538_100495336 | 3300009156 | Populus Rhizosphere | MLEIDLGQQLGGSVMAPQSDTSSLYVLVCSMAGTIVGLAATWIVVAHTFVQPMVA* |
Ga0075423_102064223 | 3300009162 | Populus Rhizosphere | MLYDSPHAQEGLGQELGGSVMAPQSDTSSLYVLICSLAGTVLSLAATWIVIAHSFVQP |
Ga0075423_118006571 | 3300009162 | Populus Rhizosphere | QSDTSSLYVLICSLAGTVLSLAATWIVVAHSFVQPMVA* |
Ga0105241_126981141 | 3300009174 | Corn Rhizosphere | MLKIDLGQQLGGSVMAPQSDTSSLYVLVCSLAGTIVGLAATWMVVAHSFVQPMVA* |
Ga0105242_100080171 | 3300009176 | Miscanthus Rhizosphere | MAPQSDARTLYVLVSSLASAVLSLAATWIFVAHSVQPIVA* |
Ga0105242_102519435 | 3300009176 | Miscanthus Rhizosphere | DVLRFSHAHEGLGQELGGSVIAPQSDTSSLYVLICSLAGTVLSLAATWIVVAHSAQAMIA |
Ga0105248_101974471 | 3300009177 | Switchgrass Rhizosphere | MAPQSDTSTLYVLVCSLAGTVLSLATTWIVVAHSYVQPMVA* |
Ga0105248_101974475 | 3300009177 | Switchgrass Rhizosphere | LLMLKKVLGRKLGGSVMAPQSDTTTLYVLVCSLAGTVLSLAATWIVIAQSTHSMIA* |
Ga0105248_104591854 | 3300009177 | Switchgrass Rhizosphere | GLGQKLGGSVMAPQSDTSSLYVLICSLAGTVLSLAATWIVVSHSFVQPMVA* |
Ga0105248_106434613 | 3300009177 | Switchgrass Rhizosphere | MAPQSDTTSLYVLVCSMAGTIVGLAATWIVVAHSFVQPMVA* |
Ga0105248_107557993 | 3300009177 | Switchgrass Rhizosphere | LLMLKTGLGQELGGSVMAPQSYTSSLYVLVCSMAGTIVGLGATWIVVAHTFVQPMVA* |
Ga0105248_124179031 | 3300009177 | Switchgrass Rhizosphere | LGGSVMAPQSDTSSLYVLVCSLAGTIMGLAATWIVVGHTFVQPMVA* |
Ga0114925_113449112 | 3300009488 | Deep Subsurface | MMMEDHMEDRTDTHSLYVLAISLLGTVLSLGGTLIVVAHSFVQPMVA* |
Ga0105237_112033561 | 3300009545 | Corn Rhizosphere | RKILGGNFGGSVMAPQSDTSTLYVLVCSLAGTIVGLAATWIVVAHSFVQPMVA* |
Ga0105249_114088451 | 3300009553 | Switchgrass Rhizosphere | LMLKRKSWAGTFGGSVMAPQSDTTSLYVLVCSLAGTIVGLAATWIVVAHSLVQPMVA* |
Ga0126382_107752502 | 3300010047 | Tropical Forest Soil | MAPQSDTNTLYVLICSLAGTVLSLAVTWIVVAHSFVQPMVA* |
Ga0126377_133617182 | 3300010362 | Tropical Forest Soil | MLKIGLGQEFGGSVMAPQSDTNTLYVLICSLAGTILSLAATWIVVAHSFVQPMVA* |
Ga0134125_102565901 | 3300010371 | Terrestrial Soil | LMLKTGLGQELGGSVMAPQSDTSSLYVLVCSMAGTIVGLGATWIVVAHTFVQPMVA* |
Ga0134128_111977032 | 3300010373 | Terrestrial Soil | MLYDSPHAQEGLGQELGGSVMAPQSDTTSLYVLVCSLAGTIVGLAATWIVVAHSLVQPMVA* |
Ga0134128_130460211 | 3300010373 | Terrestrial Soil | GGSVMAPQSDTSSLYVLVCSMAGTIVGLAATWIVVAHSFVQPMVA* |
Ga0105239_101950173 | 3300010375 | Corn Rhizosphere | MAPQSDTTSLYVLVCSLAGTIVGLAATWIVVAHSLVQPMVA* |
Ga0105239_103313751 | 3300010375 | Corn Rhizosphere | MLYDSPHAQEGLGQELGGSVMAPQSDTSSLYVLVCSLAGTIVGLAATWIVVAHTFVQPMVA* |
Ga0105239_105761371 | 3300010375 | Corn Rhizosphere | MLKTGLGQELGGSVMAPQSDTSSLYVLVCSLAGTIVGLAATWMVVAHSFVQPMVA* |
Ga0105239_113496021 | 3300010375 | Corn Rhizosphere | CSRKVLGRNFGGSVMAPQSDTTTLYVLVCSLAGTVLSLATTWIVVAHSYVQPMVA* |
Ga0126381_1031600801 | 3300010376 | Tropical Forest Soil | MAPQSEARTLYVLVSSLAGTVLSLALTWIFVAHSVQQMVA* |
Ga0134126_112993891 | 3300010396 | Terrestrial Soil | GLGQELGGSVMAPQSDTSSLYVLVCSMAGTIVGLGATWIVVAHTFVQPMVA* |
Ga0134124_102882683 | 3300010397 | Terrestrial Soil | LKIDLGQQLGGSVMAPQSDTSSLYVLVCSMAGTIVGLAATWIVVAHTFVQPMVA* |
Ga0134124_108748342 | 3300010397 | Terrestrial Soil | GQQLGGSVMAPQSDTSSLYVLVCSMAGTIVGLAATWIVVAHSFVQPMVA* |
Ga0126383_128319751 | 3300010398 | Tropical Forest Soil | MAPQSEARTLYVLVSSLAGTVLGLAATWIFVAHSVQPLVA* |
Ga0134121_100076345 | 3300010401 | Terrestrial Soil | MAPQSDTTSLYVLVCSLAGTIVGLGATWIVVAHSFVQPMVA* |
Ga0134121_102767782 | 3300010401 | Terrestrial Soil | MLKIDLGQQLGGSVMAPQSDTSSLYVLVCSMAGTIVGLAATWIVVAYTFVQPMVA* |
Ga0134123_104705043 | 3300010403 | Terrestrial Soil | MAPQSDTTTLYVLVCSLAGTVLSLAPTWIVVAHSFVQPMVA* |
Ga0157304_10253261 | 3300012882 | Soil | MAPQSDTNTIYVLICSLAGTVLRLAATWIVVAHSFVQPMVA* |
Ga0157285_100555641 | 3300012897 | Soil | GLGQELGGSVMAPQSDTSSLYVLVCSLAGTVVGLAATWIVVAHSFVQPMVA* |
Ga0157299_100063092 | 3300012899 | Soil | MAPQSDTTTLYVLVCSLAGTVLSLAATWIVVAHSFVQPMVA* |
Ga0157289_103135621 | 3300012903 | Soil | VMAPQSDTSSLYVLVCSLAGTVVGLAATWIVVAHSFVQPMVA* |
Ga0157296_100102391 | 3300012905 | Soil | MAPQSDARTLYVLVSSLAGTVLSLAATWIFVAHSVHPIV* |
Ga0157296_100555512 | 3300012905 | Soil | MLYDSPHAQEGLGQELGGSVMAPQSDTSSLYVLVCSLAGTIVGLAATWMVVAHSFVQPMVA* |
Ga0157283_100120634 | 3300012907 | Soil | ELGGSVMAPQSDTSSLYVLICSLAGTVLSLAATWIVVAHSAQAMIA* |
Ga0157283_100212183 | 3300012907 | Soil | SDTSSLYVLICSLAGTVLSLAATWIVVSHSFVQPMVA* |
Ga0157286_102603861 | 3300012908 | Soil | MLKTGLEQELGGSVMAPQSDTSSLYVLVCSLAGTILSLAATWIVVAHSF |
Ga0157301_100101002 | 3300012911 | Soil | MAPQSDTSSLYVLACSLAGTIVGLAATWIVVAHSFVQPMVA* |
Ga0157306_101970291 | 3300012912 | Soil | AHEGLGQELGGSVMAPQSDTSSLYVLICSLAGTVLSLAATWIVIAHSFVQPMVA* |
Ga0157298_101324943 | 3300012913 | Soil | DTSSLYVLICSLAGTVLSLAATWIVVSHSFVQPMVA* |
Ga0157297_100210271 | 3300012914 | Soil | FGGSVMAPQSDTTTLYVLVCSLAGTVLSLATTWIVVAHSFVQPMVA* |
Ga0164298_102119713 | 3300012955 | Soil | MLKIDLGQQLGGSVMAPQSDTSSLYVMVCSMAGTIVGLAATWIVVAHTFVQPMVA* |
Ga0164299_101655152 | 3300012958 | Soil | MLKIDLGQQLGGSVMAPQSDTSSLYVLVCSMAGTIVGLAATWIVVAHTFVQPMIA* |
Ga0164302_100665735 | 3300012961 | Soil | GGSVMAPQSDTTSLYVLVCSLAGTIVGLAATWIVVAHSFVQPMVA* |
Ga0153916_109912982 | 3300012964 | Freshwater Wetlands | MLKTSLGQEIGGSVMAPQSDTNTLYVLICSLAGTVLSLAATWIVVAHSFVQPMVA* |
Ga0126369_107260171 | 3300012971 | Tropical Forest Soil | SPMTPQSDTRTLYVLVSSLAGTVLSLAFTWIFVAHSVQPLVA* |
Ga0157307_10115942 | 3300013096 | Soil | MAPQSDASSLYVLVCSLAGTIVGLGATWIVVAHSFVQPMVA* |
Ga0157307_11065002 | 3300013096 | Soil | IGLSRQIGGSAMATQSDTRTLYVLVSSLAGSVLSLAATWIFVAHSVQPMVA* |
Ga0157371_104425621 | 3300013102 | Corn Rhizosphere | CFTILLMLKIDLGQQLGGSVMAPQSDTSSLYVLVCSMAGTIVGLAATWIVVAHTFVQPMVA* |
Ga0157371_108251531 | 3300013102 | Corn Rhizosphere | MLYDSPHAQEGLGQGLGGSVMAPQSDTSSLYVLVCSLAGTIVGLAATWIVVAHSFVQPMVA* |
Ga0157370_102409122 | 3300013104 | Corn Rhizosphere | CSRKVLGGNFGGSVMAPQSDTTTLYVLVCSLAGTVLSLAATWIVIAQSTHSMVA* |
Ga0157369_103042131 | 3300013105 | Corn Rhizosphere | LGGSVMAPQSDTSSLYVLVCSMAGTIVGLAATWIVVAHTFVQPMVA* |
Ga0157374_100342714 | 3300013296 | Miscanthus Rhizosphere | AMLYDSPHAQEGLGQELGGSVMAPQSDTSSLYVLVCSLAGTVVGLAATWIVVAHSFVQPMVA* |
Ga0157374_109179542 | 3300013296 | Miscanthus Rhizosphere | MAPQSDTTSLYVLVCSLAGTVLSLATTWIVVAHSYVQPMVA |
Ga0157378_103743531 | 3300013297 | Miscanthus Rhizosphere | MLYDSPHAQEGLGQKLGGSVMAPQSDTSSLYVLMCSLAGTVLSLAATWIVVANSAQAMIA |
Ga0163162_101522223 | 3300013306 | Switchgrass Rhizosphere | MAPQSDARTLYVLVSSLAGKVLSLAATWIFVAHSVQPIVA* |
Ga0157372_100925613 | 3300013307 | Corn Rhizosphere | AQEGLGQELGGSVMAPQSDTSSLYVLVCSLAGTIVGLAATWIVVAHTFVQPMVA* |
Ga0157372_110934692 | 3300013307 | Corn Rhizosphere | GGSVMAPQSDTSSLYVLVCSMAGTIVGLAATWIVVAHSLVQPMVA* |
Ga0157375_102850935 | 3300013308 | Miscanthus Rhizosphere | GQQLGGSVMAPQSDTSSLYVLVCSMAGTIVGLAATWIVVAHTFVQPMVA* |
Ga0157375_116084772 | 3300013308 | Miscanthus Rhizosphere | SVMAPQSDTSSLYVLICSLAGTVLSLAATWIVVSHSFVQPMVA* |
Ga0163163_100592281 | 3300014325 | Switchgrass Rhizosphere | QLGGSVMAPQSDTSSLYVLVCSMAGTIVGLAATWIVVAHTFVQPMVA* |
Ga0163163_101120752 | 3300014325 | Switchgrass Rhizosphere | DTSSLYVLVCSLAGTVVGLAATWIVVAHSFVQPMVA* |
Ga0163163_113991431 | 3300014325 | Switchgrass Rhizosphere | MVEIGSNKEIGGSAMAPQSDARTLYVLVSSLAGTVLSLAATWIFVAHSVQPMVA* |
Ga0163163_120148422 | 3300014325 | Switchgrass Rhizosphere | MLKIDLGQQLGGSVMAPQSDTSSLYVLVCSMAGTIVGLAATWIV |
Ga0163163_120502283 | 3300014325 | Switchgrass Rhizosphere | SDTSSLYVLVCSMAGTIVGLAATWIVVAHSFVQPMVA* |
Ga0157380_100130035 | 3300014326 | Switchgrass Rhizosphere | MAPQSDTSSLYVLVCSLARTVVGLAATWIVVAHSFVQPMVA* |
Ga0157377_100562241 | 3300014745 | Miscanthus Rhizosphere | MASQSDTTTLYVLVCSLAGTVLSLATTCIVVAHSFVQPMVA* |
Ga0157379_116602611 | 3300014968 | Switchgrass Rhizosphere | LGGSVMAPQSDTSSLYVLVCSLAGTIVGLAATWMVVAHSFVQPMVA* |
Ga0173483_100127641 | 3300015077 | Soil | NTLYVLVCSLAGTILSLAATWIVVAHTFVQPMVA* |
Ga0173483_100144872 | 3300015077 | Soil | DTTTLYVLVCSLAGTVLSLATTWIVVAHSYVQPMVA* |
Ga0173483_103735801 | 3300015077 | Soil | PMATQSDARTLYVLVSSLAGTILSLAATLIFAHSVQPMVA* |
Ga0173483_103801962 | 3300015077 | Soil | MLYDSPHAQDRSGQELGGSVMAPQSDTSSLYVLVCSLAGTIVGLAATWMVVAHSFVQPMVA* |
Ga0173480_106381492 | 3300015200 | Soil | ALRFSSCSRKVLGRNFGGSVMAPQSDTTTLYVLGCSLAGTVLSLATTWIVVAHSYVQPMVA* |
Ga0132258_128326921 | 3300015371 | Arabidopsis Rhizosphere | QSDTSSLYVLVCSLAGTVVGLAATWIVVAHSFVQPMVA* |
Ga0132257_1012112311 | 3300015373 | Arabidopsis Rhizosphere | MAPQSNTTTLYVLVCSLAGTILSLAATWIVIAQSTHSMVA* |
Ga0132255_1003402271 | 3300015374 | Arabidopsis Rhizosphere | MLKTGLGQELGGLDMAPQSDTSSLYVLVCSLAGAIVGLAATWMVVAHSFVQPMVA* |
Ga0132255_1037797341 | 3300015374 | Arabidopsis Rhizosphere | MLKKVLGRKLGGSVMAPQSDTSSLYVLVCSLAGTVLSLAATWIVIAQSTHS |
Ga0182036_110876571 | 3300016270 | Soil | MATQSEARTLYVLVSSLAGTVLSLAATWIVVAHSAQAMVA |
Ga0182035_121765851 | 3300016341 | Soil | MLEIGSNKQIGGSPMAPQSEARTLYVLVSSLAGTVLSLAATWLFVALSVQPMVA |
Ga0182032_109244432 | 3300016357 | Soil | QLGGSVMAPQSDANTLYVLLCSLAGTILSLAATWTVVAHSFVQPMVT |
Ga0182034_101286934 | 3300016371 | Soil | MAPQSDTRTLYVLLSSLAGTVLSLAFTWIFVAHSVQPMVA |
Ga0182040_119400391 | 3300016387 | Soil | MAPQSEARTLYVLVSSLAGTVLSLAATWIFIAHSVQPMVA |
Ga0163161_100232025 | 3300017792 | Switchgrass Rhizosphere | MAPQSDARTLYVLVSSLAGALLSLAATWIFAAHSVQPIVA |
Ga0163161_100482701 | 3300017792 | Switchgrass Rhizosphere | PHAQEGLGQELGGSVMAPQSDTSSLYVLVCSLAGTIVGLAATWIVVAHTFVQPMVA |
Ga0173481_100052404 | 3300019356 | Soil | MAPQSDTSSLYVLVCSLAGTIVGLAATWIVVAHTFVQPMVA |
Ga0173481_100397763 | 3300019356 | Soil | MAPQSDTSSLYVLICSLAGTVLSLAATWIVVAHSAQAMIA |
Ga0173481_100845071 | 3300019356 | Soil | MLKVLGRNFGGSVMAPQSDTNTLYVLICSLAGTVLSLAATWIVVAHSFVQPMVA |
Ga0173481_100923601 | 3300019356 | Soil | LLMLKKVLGRKLGGSVMAPQSDTSSLYVLICSLAGTVLSLAATWIVVAHSFVQPMVA |
Ga0173481_107996521 | 3300019356 | Soil | MTTQLEASTLYVLVSSLAGTILSLAVTWFFVAHSF |
Ga0173479_100703883 | 3300019362 | Soil | MILLMLKTGLGQQLGGSVMAPQSDTSSLYVLACSLAGTIVGLAATWIVVAHSFVQPMVA |
Ga0173479_101324122 | 3300019362 | Soil | MTTPSDKNTLYVLLYSLAGTVLSLAATWFFVAHSFAQQMVA |
Ga0173479_103500491 | 3300019362 | Soil | MAPQSDTSTLYVLVCSLAGTVLSLAATWIVVAHSFVQPMVA |
Ga0126371_108333391 | 3300021560 | Tropical Forest Soil | MAPQSEARTLYVLVSSLAGTVLSLAFTWIFVAHSVQPLVA |
Ga0247746_10935401 | 3300022886 | Soil | AGTFGGSVMAPQSDATSLYVLVCSLAGTIVGLGATWIVVAHSFVQPMVA |
Ga0247785_10073583 | 3300022889 | Soil | MLKRKSWAGTFGGSVMAPQSDATSLYVLVCSLAGTIVGLGATWIVVAHSFVQPMVA |
Ga0247785_10212071 | 3300022889 | Soil | MAPQSDATSLYVLVCSLAGTIVGLGATWIVVAHSFVQ |
Ga0247745_10351463 | 3300022898 | Soil | MAPQSDTTSLYVLVCSLAGTIVGLGATWIVVAHSFVQPMVA |
Ga0247795_10237952 | 3300022899 | Soil | MAPQSDTGSLYVLVCSMAGTIVGLGATWIVVAHTFVQPMVA |
Ga0247801_10133722 | 3300023064 | Soil | MAPQSDTTTLYVLVCSLAGTVLSLAATWIVVAHSFVQPMVA |
Ga0247801_10666011 | 3300023064 | Soil | MAPQSDTTTLYVLVCSLAGTVLSLATTWIVVAHSYVQ |
Ga0247799_10242151 | 3300023072 | Soil | PQSDTSSLYVLVCSLAGTIVGLAATWMVVAHSFVQPMVA |
Ga0207696_11621671 | 3300025711 | Switchgrass Rhizosphere | IDLGQQLGGSVMAPQSDTSSLYVLVCSMAGTIVGLAATWIVVAHTFVQPMVA |
Ga0207655_12322421 | 3300025728 | Miscanthus Rhizosphere | MAPQSDTSTLYVLVCSLAGTVLSLATTWIVVAHSYVQPMVA |
Ga0207653_100961411 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | ELGGSVMAPQSDTSSLYVLVCSLAGTVVGLAATWIVVAHSFVQPMVA |
Ga0207653_101962911 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | LGGSVMAPQSDTSSLYVLVCSLAGTIVGLAATWIVVAHTFVQPMVA |
Ga0207710_100904072 | 3300025900 | Switchgrass Rhizosphere | MAPQSDARTLYVLVSSLAGTVLSLAATWIFVAHSVQPIV |
Ga0207688_100386663 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MAPQSDTTTLYVLVCSLAGTVLSLATTWIVVAHSFVQPMVA |
Ga0207680_100745211 | 3300025903 | Switchgrass Rhizosphere | MAPQSDTTSLYVLVCSLAGTIVGLAATWIVVAHSFVQPMVA |
Ga0207680_106494443 | 3300025903 | Switchgrass Rhizosphere | QSDTSSLYVLICSLAGTVLSLAATWIVVAHSAQAMIA |
Ga0207645_101332261 | 3300025907 | Miscanthus Rhizosphere | HAQEGLGQKLGGSVMAPQSDTSSLYVLICSLAGTVLSLAATWIVIAHSFVQPMVA |
Ga0207645_102126201 | 3300025907 | Miscanthus Rhizosphere | QEGLGQKLGGSVMAPQSDTSSLYVLICSLAGTVLSLAATWIVVAHSAQAMIA |
Ga0207654_101615572 | 3300025911 | Corn Rhizosphere | MLKTGLGQELGGSVMAPQSDTSSLYVLVCSLAGTIVGLAATWIVVAHTFVQPMVA |
Ga0207654_103719502 | 3300025911 | Corn Rhizosphere | MAPQSDTSTLYVLVCSLAGTVLSLATTCIVVAHSFVQPMVA |
Ga0207654_113123691 | 3300025911 | Corn Rhizosphere | KEIGGSAMAPQSDTNTLYVLVCSLAGTVLSLAGTWIVVAHSFVQPIVA |
Ga0207654_114437131 | 3300025911 | Corn Rhizosphere | DTSSLYVLICSLAGTVLSLAATWIVVAHSFVQPMVA |
Ga0207671_107113662 | 3300025914 | Corn Rhizosphere | MAPQSDTTTLYVLVCSLAGTILSLAATWIVIAQSTHSMVA |
Ga0207671_111428721 | 3300025914 | Corn Rhizosphere | FGGSVMAPQSDTTTLYVLVCSLAGTVLSLATTWIVVAHSYVQPMVA |
Ga0207693_100308601 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | SDTTTLYVLVCSLAGTVLSLATTWIVVAHSYVQPMVA |
Ga0207693_100928581 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MAPQSDTTTLYVLVCSLAGTVLSLATTWIVVAHSYVQSMVA |
Ga0207693_102755522 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTQLEASTLYVLVSSLAGTILSLAVTWLFVAHSFVQPIVA |
Ga0207662_100573503 | 3300025918 | Switchgrass Rhizosphere | MLKKVLGRKLGGSVMAPQSDTSSLYVLICSLAGTVLSLAATWIVVAHSFVQPMVA |
Ga0207662_101022001 | 3300025918 | Switchgrass Rhizosphere | LGGSVMAPQSDTSSLYVLVCSLAGTVVGLAATWIVVAHSFVQPMVA |
Ga0207662_101178622 | 3300025918 | Switchgrass Rhizosphere | MAPQSDARTLYVLVSSLAGAVLSLAATWIFVAHSVQP |
Ga0207657_100084648 | 3300025919 | Corn Rhizosphere | MAPQSDTTTLYVLVCSLAGTVLSLAATWIVIAQSTHSMIA |
Ga0207657_100411816 | 3300025919 | Corn Rhizosphere | QEGLGQKLGGSVMAPQSDTSSLYVLICSLAGTVLSLAATWIVIAHSFVQPMVA |
Ga0207657_103614563 | 3300025919 | Corn Rhizosphere | GLGQELGGSVMAPQSDTSSLYVLVCSMAGTIVGLGATWIVVAHTFVQPMVA |
Ga0207649_100507471 | 3300025920 | Corn Rhizosphere | KVLGRNFGGSVMAPQSDTSTLYVLVCSLAGTVLSLATTWIVVAHSFVQPMVA |
Ga0207652_104335201 | 3300025921 | Corn Rhizosphere | MLKIDLGQQLGGSVMAPQSDTSSLYVLVCSMAGTIVGLAATWIVVAHTFVQPMVA |
Ga0207650_101619381 | 3300025925 | Switchgrass Rhizosphere | MAPQSDARTLYVLVSSLAGAVLSLAPTWIFAAHSVQPIVA |
Ga0207659_111388712 | 3300025926 | Miscanthus Rhizosphere | SVMAKESDTSHRVLVCGLAGTVLSLAATWFFVAHSFL |
Ga0207687_107717231 | 3300025927 | Miscanthus Rhizosphere | PQSDTTTLYVLVCSLAGTVLSLATTWIVVAHSYVQPMVA |
Ga0207700_103814823 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MAPQSDTNTLYVLVCSLAGTILSLAATWIVIAQSTHSMVA |
Ga0207644_100908061 | 3300025931 | Switchgrass Rhizosphere | LKIDLGQQLGGSVMAPQSDTSSLYVLVCSMAGTIVGLAATWIVVAHTFVQPMVA |
Ga0207706_101069425 | 3300025933 | Corn Rhizosphere | QSDTSSLYVLVCSMAGTIVGLGATWIVVAHTFVQPMVA |
Ga0207706_101779293 | 3300025933 | Corn Rhizosphere | MAPQSDTSSLYVLVCSLAGTIVGLAATWMVVAHSFVQPMVA |
Ga0207686_117630531 | 3300025934 | Miscanthus Rhizosphere | TSSLYVLICSLAGTVLSLAATWIVVSHSFVQPMVA |
Ga0207709_101198864 | 3300025935 | Miscanthus Rhizosphere | QVLGRNFGGSVMAPQSDTSSLYVLVCSMAGTIVGLAATWIVVAHTFVQPMVA |
Ga0207709_115246091 | 3300025935 | Miscanthus Rhizosphere | MAPQSDTTTLYVLVCSLAGTVLSLATTWIVVAHSYVQPMV |
Ga0207665_1000527215 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MAPQSDARTLYVLVSSLAGAVLSLAATWIFVAHSVQPIVA |
Ga0207691_111491703 | 3300025940 | Miscanthus Rhizosphere | MLYDSPHAQEGLGQELGGSVMAPQSDTSSLYVLVCSMAGTIVGLAATWIVVAHTFVQPMV |
Ga0207711_107601861 | 3300025941 | Switchgrass Rhizosphere | LKTGLGQELGGSVMAPQSYTSSLYVLVCSMAGTIVGLGATWIVVAHTFVQPMVA |
Ga0207711_119168001 | 3300025941 | Switchgrass Rhizosphere | RKVLGRKLGGSVMAPQSDTTTLYVLVCSLAGTVLSLAATWIVIAQSTHSMIA |
Ga0207661_104072233 | 3300025944 | Corn Rhizosphere | KVLGGNFGGSVMAPQSDTTTLYVLVCSLAGTVLSLAATWIVIAQSTHSMVA |
Ga0207661_121525111 | 3300025944 | Corn Rhizosphere | CFTILLMLKKVLGRKLGGSVMAPQSDTSSLYVLICSLAGTVLSLAATWIVVAHSFVQPMV |
Ga0207667_100930461 | 3300025949 | Corn Rhizosphere | MAPQSDTTTLYVLVCSLAGTVLSLAATWIVIAQSTHSMVA |
Ga0207667_109751803 | 3300025949 | Corn Rhizosphere | KVLGRKLGGSVMAPQSDTSSLYVLICSLAGTVLSLAATWIVVANSAQAMIA |
Ga0207651_101767251 | 3300025960 | Switchgrass Rhizosphere | MAPQSDARTLYVLVSSLAGAVLSLAATWIFAAHSVQ |
Ga0207651_107937931 | 3300025960 | Switchgrass Rhizosphere | MAPQSDTSSLYVLICSLAGTVLSLAATWIVVSHSFV |
Ga0207651_113088941 | 3300025960 | Switchgrass Rhizosphere | MAPQSDTTSLYVLVCSLAGTIVGLAATWIVVAHSFV |
Ga0207651_114701542 | 3300025960 | Switchgrass Rhizosphere | EGLGQKLGGSVMAPQSDTSSLYVLICSLAGTVLSLAATWIVVANSAQAMIA |
Ga0207651_119899861 | 3300025960 | Switchgrass Rhizosphere | MAPQSDTTTLYVLVCSLAGTVLSLATTWIVVAHSYVQPM |
Ga0207712_100429811 | 3300025961 | Switchgrass Rhizosphere | APQSDTTSLYVLVCSLAGTIVGLAATWIVVAHSFVQPMVA |
Ga0207712_106464611 | 3300025961 | Switchgrass Rhizosphere | TILPMLKTGLGQELGGSDMAPQSDTSSLYVLVCSLAGTIVGLAATWMVVAHSFVQPMVA |
Ga0207668_101547461 | 3300025972 | Switchgrass Rhizosphere | MTTQLEASTLYVLVSSLAGTILSLAVTWFFVTHSFVQPMVA |
Ga0207640_101191482 | 3300025981 | Corn Rhizosphere | AMLYDSPHAQEGLGQELGGSVMAPQSDTSSLYVLVCSLAGTVVGLAATWIVVAHSFVQPMVA |
Ga0207677_102050441 | 3300026023 | Miscanthus Rhizosphere | SETTTLYVLVCSLAGTVLSLATTWIVVAHSYVQPMVA |
Ga0207703_104317862 | 3300026035 | Switchgrass Rhizosphere | QLGGSVMAPQSDTSSLYVLVCSMAGTIVGLAATWIVVAHTFVQPMVA |
Ga0207678_100232116 | 3300026067 | Corn Rhizosphere | MLYDSPHAQEGLGQKLGGSVMAPQSDTSSLYVLICSLAGTVLSLAATWIVVAHSAQAMIA |
Ga0207702_119381611 | 3300026078 | Corn Rhizosphere | MLKIDLGQQLGGSVMAPQSDTSSLYVLVCSMAGTIVGLAATWIVVAHTFVQPIVA |
Ga0207648_114835052 | 3300026089 | Miscanthus Rhizosphere | MAPQSDTTSLYVLVCSLAGTIVGLAATWIVVAHSLVQPMVA |
Ga0207674_103623341 | 3300026116 | Corn Rhizosphere | SVMAPQSDTSSLYVLICSLAGTVLSLAATWIVVSHSFVQPMVA |
Ga0207683_100709471 | 3300026121 | Miscanthus Rhizosphere | MAPQSDTTTLYVLVCSLAGTVLSLATTWIVVAHSYV |
Ga0207683_106489152 | 3300026121 | Miscanthus Rhizosphere | SDTSSLYVLVCSLAGTIVGLAATWMVVAHSFVQPMVA |
Ga0207698_107885891 | 3300026142 | Corn Rhizosphere | DSPHAQEGLGQELGGSVMAPQSDTSSLYVLVCSMAGTIVGLGATWIVVAHTFVQPMVA |
Ga0207455_10021172 | 3300026884 | Soil | MAPQSDTSSLYVLVCSLAGTIVGLAATWIVVAHSFVQPMVA |
Ga0209998_100226902 | 3300027717 | Arabidopsis Thaliana Rhizosphere | MAPQSDTTTLYVLVCSMAGTVLSLATTWIVVAHSFVQPMVA |
Ga0268265_102678512 | 3300028380 | Switchgrass Rhizosphere | MAPQSDTSTLYVLVCSMAGTIVGLAATWIVVAHTFVQPMVA |
Ga0268264_103413691 | 3300028381 | Switchgrass Rhizosphere | MLKTGLGQELGGSVMAPQSDTSSLYVLVCSMAGTIVGLGATWIVVAHTFVQPMVA |
Ga0268264_103673571 | 3300028381 | Switchgrass Rhizosphere | GRNFGGSVMAPQSDTTTLYVLVCSLAGTVLSLATTWIVVAHSFVQPMVA |
Ga0318541_105824191 | 3300031545 | Soil | MAPQSDTNTLYVLVSSLAGTVLSLAATWIFVAHSAQAMVA |
Ga0310887_101376941 | 3300031547 | Soil | RNFGGSVMAPQSDTTTLYVLVCSLAGTVLSLATTWIVVAHSFVQPMVA |
Ga0310887_102185981 | 3300031547 | Soil | MAPQSDARTLYVLVSSLAGAVLSLAATWIFVAHSV |
Ga0310886_104825102 | 3300031562 | Soil | APQSDTTTLYVLVCSLAGTVLSLATTWIVVAHSFVQPMVA |
Ga0310915_107179272 | 3300031573 | Soil | MLKIGLSNQIGGSPMATQSEVRTLYVLVSSLAGTVLSLAATWIVVAHSAQAMVA |
Ga0307480_10215251 | 3300031677 | Hardwood Forest Soil | GGSVMAPQSDTSSLYVLVCSMAGTIVGLAATWIVVAHTFVQPMVA |
Ga0306917_106348941 | 3300031719 | Soil | MATQSEVRTLYVLVSSLAGTVLSLAATWIVVAHSAQAMVA |
Ga0307473_109107541 | 3300031820 | Hardwood Forest Soil | SDTSTLYVLVCSLAGTVLSLATTWIVVAHSYVQPMVA |
Ga0310907_105676151 | 3300031847 | Soil | PQSDTSSLYVLVCSLAGTVVGLAATWIVVAHSFVQPMVA |
Ga0310904_100714511 | 3300031854 | Soil | RAMLYDSPHAQEGLGQELGGSVMAPQSDTSSLYVLVCSLAGTVVGLAATWIVVAHSFVQPMVA |
Ga0310893_101963101 | 3300031892 | Soil | VMAPQSDTTSLYVLVCSLAGTIVGLAATWIVVAHSFVQPMVA |
Ga0310900_109083433 | 3300031908 | Soil | QSDTSSLYVLICSWAGTVLSLAATWIVVAHSAQAMIA |
Ga0310891_103950651 | 3300031913 | Soil | SDARTLYVLVSSLAGAVLSLAATWIFVAHSVQPIVA |
Ga0310916_115091231 | 3300031942 | Soil | MAEARTLYVLVTSLAGTVLSLAATWLFVALSVQPMVA |
Ga0310884_107029941 | 3300031944 | Soil | MAPQSDTSSLYVLICSLAGTVLSLAATWIVVSHSFVQ |
Ga0310913_113067792 | 3300031945 | Soil | MATQSEARTLYVLVSSLAGTVLSLVATWIFVAHSVQPVVA |
Ga0310897_103812642 | 3300032003 | Soil | SCSRKVLGRNFGGSVMASQSDTTTLYVLVCSLAGTVLSLATTWIVVAHSYVQPMVA |
Ga0306924_107622801 | 3300032076 | Soil | MAPQPDTHTLYVLVSSLAGTVLSLAATWIFVAHSVQ |
Ga0310896_100197343 | 3300032211 | Soil | MLYDSPHAQEGLGQELGGSVMAPQSDTSSLYVLVCSLAGTVVGLAATWIVVAHSFVQPMV |
Ga0310896_101360261 | 3300032211 | Soil | CFTILLMLKIDLGQQLGGSVMAPQSDTSSLYVLVCSMAGTIVGLAATWIVVAHTFVQPMV |
Ga0310896_103172023 | 3300032211 | Soil | MAPQSDTSSLYVLIFSWAGTVLSLAATWIVFAHSAQAMIA |
Ga0310914_112631751 | 3300033289 | Soil | MATQSEVRTLYVLVSSLAGTVLSLAATWIVVAHSVQPMVA |
Ga0310810_105547231 | 3300033412 | Soil | LGQKLGGSVMAPQSDTSSLYVLICSLAGTVLSLAATWIVAAHSFVQPMVA |
Ga0310811_112873001 | 3300033475 | Soil | MLEIGSNKEIGGSAMAPQSDTNTLYVLVCSLGGTVLSLAGTWIVVAHSFVQPIVA |
Ga0247830_101407802 | 3300033551 | Soil | MAPQSDTSSLHVLICSLAGTVLSLAATWIVVAHSAQPMIA |
Ga0247830_101407805 | 3300033551 | Soil | VMAPQSDTSSLYVLICSLAGTVLSLAATWIVVAHSFVQPMVA |
Ga0370546_045758_2_148 | 3300034681 | Soil | RNFGGSVMAPQSDTNSLYVLVCSLAGTILSLAATWIVVAHSFVQPMVA |
⦗Top⦘ |