| Basic Information | |
|---|---|
| Family ID | F007423 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 351 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MDAKYNWLIDNGAIRVTLNTVAFALWIAIAVGLLELAAKV |
| Number of Associated Samples | 208 |
| Number of Associated Scaffolds | 351 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 84.86 % |
| % of genes near scaffold ends (potentially truncated) | 19.94 % |
| % of genes from short scaffolds (< 2000 bps) | 76.92 % |
| Associated GOLD sequencing projects | 185 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.59 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (70.370 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (14.530 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.647 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.131 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.94% β-sheet: 0.00% Coil/Unstructured: 47.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 351 Family Scaffolds |
|---|---|---|
| PF01904 | DUF72 | 14.53 |
| PF01245 | Ribosomal_L19 | 11.40 |
| PF11253 | DUF3052 | 5.70 |
| PF01746 | tRNA_m1G_MT | 3.13 |
| PF14520 | HHH_5 | 2.28 |
| PF00160 | Pro_isomerase | 1.99 |
| PF00486 | Trans_reg_C | 1.71 |
| PF07642 | BBP2 | 1.42 |
| PF13083 | KH_4 | 1.42 |
| PF00886 | Ribosomal_S16 | 1.14 |
| PF02148 | zf-UBP | 1.14 |
| PF00188 | CAP | 0.85 |
| PF02585 | PIG-L | 0.85 |
| PF15780 | ASH | 0.57 |
| PF02321 | OEP | 0.57 |
| PF00872 | Transposase_mut | 0.28 |
| PF01844 | HNH | 0.28 |
| PF09335 | SNARE_assoc | 0.28 |
| PF00005 | ABC_tran | 0.28 |
| PF00128 | Alpha-amylase | 0.28 |
| PF10067 | DUF2306 | 0.28 |
| PF01336 | tRNA_anti-codon | 0.28 |
| PF14312 | FG-GAP_2 | 0.28 |
| PF13563 | 2_5_RNA_ligase2 | 0.28 |
| PF02784 | Orn_Arg_deC_N | 0.28 |
| PF01058 | Oxidored_q6 | 0.28 |
| PF03704 | BTAD | 0.28 |
| PF09604 | Potass_KdpF | 0.28 |
| PF01625 | PMSR | 0.28 |
| PF12704 | MacB_PCD | 0.28 |
| PF13231 | PMT_2 | 0.28 |
| PF01370 | Epimerase | 0.28 |
| PF00543 | P-II | 0.28 |
| PF13701 | DDE_Tnp_1_4 | 0.28 |
| PF05593 | RHS_repeat | 0.28 |
| PF13548 | DUF4126 | 0.28 |
| PF01979 | Amidohydro_1 | 0.28 |
| PF06418 | CTP_synth_N | 0.28 |
| PF10633 | NPCBM_assoc | 0.28 |
| PF07786 | HGSNAT_cat | 0.28 |
| PF00909 | Ammonium_transp | 0.28 |
| PF13545 | HTH_Crp_2 | 0.28 |
| PF04107 | GCS2 | 0.28 |
| PF00378 | ECH_1 | 0.28 |
| PF04773 | FecR | 0.28 |
| PF07238 | PilZ | 0.28 |
| PF11737 | DUF3300 | 0.28 |
| PF02954 | HTH_8 | 0.28 |
| PF01782 | RimM | 0.28 |
| PF04337 | DUF480 | 0.28 |
| PF13975 | gag-asp_proteas | 0.28 |
| PF03814 | KdpA | 0.28 |
| COG ID | Name | Functional Category | % Frequency in 351 Family Scaffolds |
|---|---|---|---|
| COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 14.53 |
| COG0335 | Ribosomal protein L19 | Translation, ribosomal structure and biogenesis [J] | 11.40 |
| COG0652 | Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family | Posttranslational modification, protein turnover, chaperones [O] | 1.99 |
| COG5207 | Uncharacterized Zn-finger protein, UBP-type | General function prediction only [R] | 1.14 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.14 |
| COG0228 | Ribosomal protein S16 | Translation, ribosomal structure and biogenesis [J] | 1.14 |
| COG2340 | Spore germination protein YkwD and related proteins with CAP (CSP/antigen 5/PR1) domain | Cell cycle control, cell division, chromosome partitioning [D] | 0.85 |
| COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 0.85 |
| COG3629 | DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domain | Transcription [K] | 0.28 |
| COG3503 | Uncharacterized membrane protein, DUF1624 family | Function unknown [S] | 0.28 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.28 |
| COG3280 | Maltooligosyltrehalose synthase | Carbohydrate transport and metabolism [G] | 0.28 |
| COG3260 | Ni,Fe-hydrogenase III small subunit | Energy production and conversion [C] | 0.28 |
| COG3209 | Uncharacterized conserved protein RhaS, contains 28 RHS repeats | General function prediction only [R] | 0.28 |
| COG3132 | Uncharacterized conserved protein YceH, UPF0502 family | Function unknown [S] | 0.28 |
| COG2060 | K+-transporting ATPase, KdpA subunit | Inorganic ion transport and metabolism [P] | 0.28 |
| COG1941 | Coenzyme F420-reducing hydrogenase, gamma subunit | Energy production and conversion [C] | 0.28 |
| COG3947 | Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains | Transcription [K] | 0.28 |
| COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 0.28 |
| COG1740 | Ni,Fe-hydrogenase I small subunit | Energy production and conversion [C] | 0.28 |
| COG0004 | Ammonia channel protein AmtB | Inorganic ion transport and metabolism [P] | 0.28 |
| COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 0.28 |
| COG1166 | Arginine decarboxylase (spermidine biosynthesis) | Amino acid transport and metabolism [E] | 0.28 |
| COG0806 | Ribosomal 30S subunit maturation factor RimM, required for 16S rRNA processing | Translation, ribosomal structure and biogenesis [J] | 0.28 |
| COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 0.28 |
| COG0504 | CTP synthase (UTP-ammonia lyase) | Nucleotide transport and metabolism [F] | 0.28 |
| COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 0.28 |
| COG0377 | NADH:ubiquinone oxidoreductase 20 kD subunit (chain B) or related Fe-S oxidoreductase | Energy production and conversion [C] | 0.28 |
| COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 0.28 |
| COG0347 | Nitrogen regulatory protein PII | Signal transduction mechanisms [T] | 0.28 |
| COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 0.28 |
| COG0225 | Peptide methionine sulfoxide reductase MsrA | Posttranslational modification, protein turnover, chaperones [O] | 0.28 |
| COG0019 | Diaminopimelate decarboxylase | Amino acid transport and metabolism [E] | 0.28 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 70.37 % |
| Unclassified | root | N/A | 29.63 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459003|FZ032L002FMUTC | Not Available | 529 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100478663 | All Organisms → cellular organisms → Bacteria | 1438 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_105007267 | Not Available | 734 | Open in IMG/M |
| 3300001385|JGI20193J14888_1034970 | Not Available | 666 | Open in IMG/M |
| 3300001394|JGI20191J14862_1007251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 2586 | Open in IMG/M |
| 3300003218|JGI26339J46600_10025436 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1696 | Open in IMG/M |
| 3300003218|JGI26339J46600_10043697 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1221 | Open in IMG/M |
| 3300003218|JGI26339J46600_10078131 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300003219|JGI26341J46601_10080566 | Not Available | 973 | Open in IMG/M |
| 3300003219|JGI26341J46601_10107098 | Not Available | 810 | Open in IMG/M |
| 3300003219|JGI26341J46601_10153615 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
| 3300003368|JGI26340J50214_10070470 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300003368|JGI26340J50214_10136445 | Not Available | 617 | Open in IMG/M |
| 3300003369|JGI24140J50213_10039769 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1704 | Open in IMG/M |
| 3300003369|JGI24140J50213_10064880 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1265 | Open in IMG/M |
| 3300003369|JGI24140J50213_10235714 | Not Available | 564 | Open in IMG/M |
| 3300003432|JGI20214J51088_10599054 | Not Available | 698 | Open in IMG/M |
| 3300003861|Ga0031654_10212918 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300004080|Ga0062385_10241136 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1002 | Open in IMG/M |
| 3300004080|Ga0062385_10408416 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300004080|Ga0062385_10414409 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 809 | Open in IMG/M |
| 3300004080|Ga0062385_10933632 | Not Available | 578 | Open in IMG/M |
| 3300004080|Ga0062385_10934661 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300004091|Ga0062387_100114456 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1482 | Open in IMG/M |
| 3300004091|Ga0062387_100386771 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 937 | Open in IMG/M |
| 3300004092|Ga0062389_100577881 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1284 | Open in IMG/M |
| 3300004092|Ga0062389_100820079 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1110 | Open in IMG/M |
| 3300004092|Ga0062389_102006640 | Not Available | 755 | Open in IMG/M |
| 3300004092|Ga0062389_104599055 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 519 | Open in IMG/M |
| 3300004152|Ga0062386_100042728 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3396 | Open in IMG/M |
| 3300004152|Ga0062386_100196858 | All Organisms → cellular organisms → Bacteria | 1584 | Open in IMG/M |
| 3300004152|Ga0062386_100392119 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1117 | Open in IMG/M |
| 3300004152|Ga0062386_100769052 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 792 | Open in IMG/M |
| 3300004152|Ga0062386_101634574 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 537 | Open in IMG/M |
| 3300004268|Ga0066398_10105680 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 658 | Open in IMG/M |
| 3300004633|Ga0066395_10034181 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2144 | Open in IMG/M |
| 3300004635|Ga0062388_102381115 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 554 | Open in IMG/M |
| 3300004635|Ga0062388_102531031 | Not Available | 538 | Open in IMG/M |
| 3300005332|Ga0066388_106455166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 591 | Open in IMG/M |
| 3300005439|Ga0070711_100322262 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1235 | Open in IMG/M |
| 3300005524|Ga0070737_10023045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 4172 | Open in IMG/M |
| 3300005529|Ga0070741_10017837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 11594 | Open in IMG/M |
| 3300005529|Ga0070741_10775713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 839 | Open in IMG/M |
| 3300005529|Ga0070741_11322785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 602 | Open in IMG/M |
| 3300005533|Ga0070734_10506968 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300005538|Ga0070731_10024619 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 4124 | Open in IMG/M |
| 3300005541|Ga0070733_10859184 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300005542|Ga0070732_10976878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 518 | Open in IMG/M |
| 3300005602|Ga0070762_10180631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1281 | Open in IMG/M |
| 3300005764|Ga0066903_101967293 | All Organisms → cellular organisms → Bacteria | 1122 | Open in IMG/M |
| 3300005764|Ga0066903_102055766 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
| 3300005842|Ga0068858_100640560 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1032 | Open in IMG/M |
| 3300005938|Ga0066795_10086973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 928 | Open in IMG/M |
| 3300005994|Ga0066789_10098947 | All Organisms → cellular organisms → Bacteria | 1254 | Open in IMG/M |
| 3300005994|Ga0066789_10439497 | Not Available | 545 | Open in IMG/M |
| 3300005995|Ga0066790_10347336 | Not Available | 633 | Open in IMG/M |
| 3300006052|Ga0075029_100045740 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2524 | Open in IMG/M |
| 3300006052|Ga0075029_100105490 | All Organisms → cellular organisms → Bacteria | 1696 | Open in IMG/M |
| 3300006052|Ga0075029_100185417 | All Organisms → cellular organisms → Bacteria | 1294 | Open in IMG/M |
| 3300006052|Ga0075029_100382039 | Not Available | 912 | Open in IMG/M |
| 3300006055|Ga0097691_1000876 | All Organisms → cellular organisms → Bacteria | 24017 | Open in IMG/M |
| 3300006176|Ga0070765_100628965 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300006176|Ga0070765_101545469 | Not Available | 624 | Open in IMG/M |
| 3300006176|Ga0070765_101740194 | Not Available | 585 | Open in IMG/M |
| 3300006642|Ga0075521_10016734 | All Organisms → cellular organisms → Bacteria | 2927 | Open in IMG/M |
| 3300006642|Ga0075521_10039693 | All Organisms → cellular organisms → Bacteria | 2018 | Open in IMG/M |
| 3300006755|Ga0079222_11458465 | Not Available | 638 | Open in IMG/M |
| 3300006864|Ga0066797_1126839 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300009518|Ga0116128_1054863 | Not Available | 1248 | Open in IMG/M |
| 3300009518|Ga0116128_1181654 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300009552|Ga0116138_1194765 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300009616|Ga0116111_1000605 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 28450 | Open in IMG/M |
| 3300009617|Ga0116123_1078606 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300009623|Ga0116133_1015026 | All Organisms → cellular organisms → Bacteria | 1916 | Open in IMG/M |
| 3300009623|Ga0116133_1126437 | Not Available | 660 | Open in IMG/M |
| 3300009628|Ga0116125_1196856 | Not Available | 572 | Open in IMG/M |
| 3300009629|Ga0116119_1151774 | Not Available | 578 | Open in IMG/M |
| 3300009639|Ga0116122_1036292 | All Organisms → cellular organisms → Bacteria | 1703 | Open in IMG/M |
| 3300009644|Ga0116121_1124068 | Not Available | 813 | Open in IMG/M |
| 3300009644|Ga0116121_1192501 | Not Available | 648 | Open in IMG/M |
| 3300009665|Ga0116135_1017268 | All Organisms → cellular organisms → Bacteria | 2501 | Open in IMG/M |
| 3300009826|Ga0123355_10724154 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
| 3300010048|Ga0126373_11141458 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300010048|Ga0126373_11200187 | Not Available | 825 | Open in IMG/M |
| 3300010048|Ga0126373_11554509 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300010048|Ga0126373_11836352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 669 | Open in IMG/M |
| 3300010162|Ga0131853_10867465 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 715 | Open in IMG/M |
| 3300010339|Ga0074046_10021196 | All Organisms → cellular organisms → Bacteria | 4555 | Open in IMG/M |
| 3300010339|Ga0074046_10029881 | All Organisms → cellular organisms → Bacteria | 3725 | Open in IMG/M |
| 3300010339|Ga0074046_10059854 | All Organisms → cellular organisms → Bacteria | 2508 | Open in IMG/M |
| 3300010339|Ga0074046_10073473 | All Organisms → cellular organisms → Bacteria | 2229 | Open in IMG/M |
| 3300010339|Ga0074046_10138893 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1554 | Open in IMG/M |
| 3300010339|Ga0074046_10394586 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300010341|Ga0074045_10031883 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3967 | Open in IMG/M |
| 3300010341|Ga0074045_10106408 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1936 | Open in IMG/M |
| 3300010341|Ga0074045_10994810 | Not Available | 528 | Open in IMG/M |
| 3300010343|Ga0074044_10178267 | All Organisms → cellular organisms → Bacteria | 1416 | Open in IMG/M |
| 3300010361|Ga0126378_10569529 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
| 3300010361|Ga0126378_11879804 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300010366|Ga0126379_10292519 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1630 | Open in IMG/M |
| 3300010371|Ga0134125_11644478 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300010376|Ga0126381_101015197 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1197 | Open in IMG/M |
| 3300010376|Ga0126381_101356487 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1028 | Open in IMG/M |
| 3300010379|Ga0136449_100000950 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 84910 | Open in IMG/M |
| 3300010379|Ga0136449_100909281 | Not Available | 1433 | Open in IMG/M |
| 3300010379|Ga0136449_102476259 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300010379|Ga0136449_103466268 | Not Available | 602 | Open in IMG/M |
| 3300011418|Ga0153954_1134352 | Not Available | 615 | Open in IMG/M |
| 3300012209|Ga0137379_11686977 | Not Available | 530 | Open in IMG/M |
| 3300014155|Ga0181524_10208637 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300014155|Ga0181524_10324350 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300014158|Ga0181521_10276147 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300014162|Ga0181538_10479586 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300014164|Ga0181532_10033233 | All Organisms → cellular organisms → Bacteria | 3551 | Open in IMG/M |
| 3300014164|Ga0181532_10039724 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3184 | Open in IMG/M |
| 3300014164|Ga0181532_10232586 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_20CM_4_70_13 | 1066 | Open in IMG/M |
| 3300014164|Ga0181532_10758786 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300014169|Ga0181531_10007185 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6510 | Open in IMG/M |
| 3300014492|Ga0182013_10001356 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 33552 | Open in IMG/M |
| 3300014495|Ga0182015_10093109 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 2101 | Open in IMG/M |
| 3300014501|Ga0182024_10450728 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1650 | Open in IMG/M |
| 3300015206|Ga0167644_1009707 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4856 | Open in IMG/M |
| 3300016270|Ga0182036_10875410 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 735 | Open in IMG/M |
| 3300016404|Ga0182037_10296205 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1298 | Open in IMG/M |
| 3300016445|Ga0182038_11076380 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 714 | Open in IMG/M |
| 3300016702|Ga0181511_1098426 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
| 3300017823|Ga0187818_10169780 | Not Available | 950 | Open in IMG/M |
| 3300017925|Ga0187856_1194189 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300017931|Ga0187877_1260128 | Not Available | 668 | Open in IMG/M |
| 3300017931|Ga0187877_1273204 | Not Available | 649 | Open in IMG/M |
| 3300017934|Ga0187803_10288593 | Not Available | 654 | Open in IMG/M |
| 3300017935|Ga0187848_10079729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae | 1520 | Open in IMG/M |
| 3300017935|Ga0187848_10089110 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1419 | Open in IMG/M |
| 3300017938|Ga0187854_10059642 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1878 | Open in IMG/M |
| 3300017939|Ga0187775_10018414 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1882 | Open in IMG/M |
| 3300017940|Ga0187853_10476910 | Not Available | 546 | Open in IMG/M |
| 3300017941|Ga0187850_10124478 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1228 | Open in IMG/M |
| 3300017943|Ga0187819_10362631 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300017943|Ga0187819_10472843 | Not Available | 716 | Open in IMG/M |
| 3300017946|Ga0187879_10076650 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1935 | Open in IMG/M |
| 3300017946|Ga0187879_10227640 | Not Available | 1042 | Open in IMG/M |
| 3300017946|Ga0187879_10480849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 689 | Open in IMG/M |
| 3300017948|Ga0187847_10026812 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3473 | Open in IMG/M |
| 3300017955|Ga0187817_10788432 | Not Available | 607 | Open in IMG/M |
| 3300017959|Ga0187779_10563776 | Not Available | 759 | Open in IMG/M |
| 3300017970|Ga0187783_10016601 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5436 | Open in IMG/M |
| 3300017970|Ga0187783_10507271 | Not Available | 874 | Open in IMG/M |
| 3300017972|Ga0187781_10981930 | Not Available | 617 | Open in IMG/M |
| 3300017973|Ga0187780_10269120 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1196 | Open in IMG/M |
| 3300017995|Ga0187816_10401285 | Not Available | 610 | Open in IMG/M |
| 3300018018|Ga0187886_1102191 | All Organisms → cellular organisms → Bacteria | 1193 | Open in IMG/M |
| 3300018022|Ga0187864_10201131 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
| 3300018030|Ga0187869_10408554 | Not Available | 647 | Open in IMG/M |
| 3300018033|Ga0187867_10443243 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_20CM_4_70_13 | 717 | Open in IMG/M |
| 3300018034|Ga0187863_10733499 | Not Available | 559 | Open in IMG/M |
| 3300018040|Ga0187862_10013633 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6669 | Open in IMG/M |
| 3300018040|Ga0187862_10173283 | Not Available | 1437 | Open in IMG/M |
| 3300018040|Ga0187862_10881269 | Not Available | 513 | Open in IMG/M |
| 3300018042|Ga0187871_10012781 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5654 | Open in IMG/M |
| 3300018042|Ga0187871_10365258 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300018042|Ga0187871_10816751 | Not Available | 520 | Open in IMG/M |
| 3300018047|Ga0187859_10030537 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2917 | Open in IMG/M |
| 3300018060|Ga0187765_11017103 | Not Available | 569 | Open in IMG/M |
| 3300018062|Ga0187784_10176433 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1746 | Open in IMG/M |
| 3300018086|Ga0187769_10389148 | Not Available | 1048 | Open in IMG/M |
| 3300019082|Ga0187852_1004860 | All Organisms → cellular organisms → Bacteria | 8882 | Open in IMG/M |
| 3300019787|Ga0182031_1085359 | Not Available | 621 | Open in IMG/M |
| 3300019787|Ga0182031_1152501 | Not Available | 738 | Open in IMG/M |
| 3300020579|Ga0210407_11277212 | Not Available | 549 | Open in IMG/M |
| 3300021181|Ga0210388_10119376 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2272 | Open in IMG/M |
| 3300021401|Ga0210393_10185908 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1677 | Open in IMG/M |
| 3300021405|Ga0210387_11898432 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300021407|Ga0210383_10399503 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1185 | Open in IMG/M |
| 3300021433|Ga0210391_10895202 | Not Available | 693 | Open in IMG/M |
| 3300021433|Ga0210391_11322771 | Not Available | 555 | Open in IMG/M |
| 3300021444|Ga0213878_10165210 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300021475|Ga0210392_10263397 | Not Available | 1225 | Open in IMG/M |
| 3300021477|Ga0210398_10124898 | All Organisms → cellular organisms → Bacteria | 2091 | Open in IMG/M |
| 3300021478|Ga0210402_11689067 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 560 | Open in IMG/M |
| 3300021559|Ga0210409_11539169 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300021560|Ga0126371_10281231 | All Organisms → cellular organisms → Bacteria | 1786 | Open in IMG/M |
| 3300021560|Ga0126371_10633995 | All Organisms → cellular organisms → Bacteria | 1217 | Open in IMG/M |
| 3300021560|Ga0126371_12083223 | Not Available | 683 | Open in IMG/M |
| 3300021560|Ga0126371_12134163 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300021560|Ga0126371_13544839 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300022524|Ga0224534_1058385 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300024295|Ga0224556_1005662 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3440 | Open in IMG/M |
| 3300025427|Ga0208077_1000199 | All Organisms → cellular organisms → Bacteria | 7061 | Open in IMG/M |
| 3300025457|Ga0208850_1071856 | Not Available | 560 | Open in IMG/M |
| 3300025464|Ga0208076_1000810 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4223 | Open in IMG/M |
| 3300025473|Ga0208190_1005527 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3444 | Open in IMG/M |
| 3300025481|Ga0208079_1000208 | All Organisms → cellular organisms → Bacteria | 33485 | Open in IMG/M |
| 3300025481|Ga0208079_1003090 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 7795 | Open in IMG/M |
| 3300025482|Ga0208715_1010428 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1861 | Open in IMG/M |
| 3300025484|Ga0208587_1065961 | Not Available | 802 | Open in IMG/M |
| 3300025579|Ga0207927_1019381 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2099 | Open in IMG/M |
| 3300025650|Ga0209385_1004111 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6240 | Open in IMG/M |
| 3300025878|Ga0209584_10291632 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
| 3300025878|Ga0209584_10402714 | Not Available | 528 | Open in IMG/M |
| 3300026078|Ga0207702_12112055 | Not Available | 553 | Open in IMG/M |
| 3300026271|Ga0209880_1019264 | All Organisms → cellular organisms → Bacteria | 1691 | Open in IMG/M |
| 3300026273|Ga0209881_1106170 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300026291|Ga0209890_10156885 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 753 | Open in IMG/M |
| 3300026833|Ga0207728_104165 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1477 | Open in IMG/M |
| 3300026854|Ga0207727_103167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 1774 | Open in IMG/M |
| 3300027654|Ga0209799_1093302 | Not Available | 682 | Open in IMG/M |
| 3300027680|Ga0207826_1004474 | All Organisms → cellular organisms → Bacteria | 3817 | Open in IMG/M |
| 3300027680|Ga0207826_1106179 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300027698|Ga0209446_1000896 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6897 | Open in IMG/M |
| 3300027698|Ga0209446_1016043 | Not Available | 1846 | Open in IMG/M |
| 3300027698|Ga0209446_1016094 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1843 | Open in IMG/M |
| 3300027698|Ga0209446_1024047 | All Organisms → cellular organisms → Bacteria | 1519 | Open in IMG/M |
| 3300027698|Ga0209446_1199753 | Not Available | 514 | Open in IMG/M |
| 3300027783|Ga0209448_10015675 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2465 | Open in IMG/M |
| 3300027783|Ga0209448_10043548 | All Organisms → cellular organisms → Bacteria | 1509 | Open in IMG/M |
| 3300027783|Ga0209448_10070465 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1175 | Open in IMG/M |
| 3300027812|Ga0209656_10042977 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2602 | Open in IMG/M |
| 3300027812|Ga0209656_10044526 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2547 | Open in IMG/M |
| 3300027812|Ga0209656_10044641 | All Organisms → cellular organisms → Bacteria | 2542 | Open in IMG/M |
| 3300027812|Ga0209656_10051316 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2327 | Open in IMG/M |
| 3300027812|Ga0209656_10054343 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2246 | Open in IMG/M |
| 3300027812|Ga0209656_10066580 | All Organisms → cellular organisms → Bacteria | 1976 | Open in IMG/M |
| 3300027812|Ga0209656_10392725 | Not Available | 623 | Open in IMG/M |
| 3300027824|Ga0209040_10011075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6253 | Open in IMG/M |
| 3300027824|Ga0209040_10040647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas fluorescens group → Pseudomonas fluorescens | 2868 | Open in IMG/M |
| 3300027824|Ga0209040_10057814 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2311 | Open in IMG/M |
| 3300027824|Ga0209040_10163909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium 13_1_40CM_3_65_7 | 1188 | Open in IMG/M |
| 3300027825|Ga0209039_10065836 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1614 | Open in IMG/M |
| 3300027825|Ga0209039_10420794 | Not Available | 508 | Open in IMG/M |
| 3300027826|Ga0209060_10040327 | All Organisms → cellular organisms → Bacteria | 2296 | Open in IMG/M |
| 3300027855|Ga0209693_10357796 | Not Available | 708 | Open in IMG/M |
| 3300027867|Ga0209167_10289939 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 884 | Open in IMG/M |
| 3300027867|Ga0209167_10567553 | Not Available | 621 | Open in IMG/M |
| 3300027869|Ga0209579_10019056 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3911 | Open in IMG/M |
| 3300027894|Ga0209068_10438709 | Not Available | 748 | Open in IMG/M |
| 3300027902|Ga0209048_10041912 | All Organisms → cellular organisms → Bacteria | 3797 | Open in IMG/M |
| 3300027902|Ga0209048_10447888 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 879 | Open in IMG/M |
| 3300027965|Ga0209062_1045221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2176 | Open in IMG/M |
| 3300028649|Ga0302162_10055736 | Not Available | 894 | Open in IMG/M |
| 3300028651|Ga0302171_10116184 | Not Available | 646 | Open in IMG/M |
| 3300028800|Ga0265338_10165518 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_20CM_4_70_13 | 1702 | Open in IMG/M |
| 3300028906|Ga0308309_11109444 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300028906|Ga0308309_11780280 | Not Available | 521 | Open in IMG/M |
| 3300029923|Ga0311347_10183351 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1291 | Open in IMG/M |
| 3300029987|Ga0311334_10628720 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 873 | Open in IMG/M |
| 3300029999|Ga0311339_11025946 | Not Available | 771 | Open in IMG/M |
| 3300030001|Ga0302272_1036568 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1563 | Open in IMG/M |
| 3300030047|Ga0302286_10074483 | All Organisms → cellular organisms → Bacteria | 1767 | Open in IMG/M |
| 3300030339|Ga0311360_10195357 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1656 | Open in IMG/M |
| 3300030617|Ga0311356_11873412 | Not Available | 533 | Open in IMG/M |
| 3300031090|Ga0265760_10164742 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300031231|Ga0170824_122442184 | Not Available | 559 | Open in IMG/M |
| 3300031251|Ga0265327_10136340 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1150 | Open in IMG/M |
| 3300031344|Ga0265316_10063187 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2872 | Open in IMG/M |
| 3300031474|Ga0170818_107443435 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300031525|Ga0302326_12795159 | Not Available | 603 | Open in IMG/M |
| 3300031545|Ga0318541_10690134 | Not Available | 570 | Open in IMG/M |
| 3300031546|Ga0318538_10300527 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 865 | Open in IMG/M |
| 3300031546|Ga0318538_10596759 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300031573|Ga0310915_10577588 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 797 | Open in IMG/M |
| 3300031669|Ga0307375_10000316 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 64188 | Open in IMG/M |
| 3300031669|Ga0307375_10000415 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 54628 | Open in IMG/M |
| 3300031679|Ga0318561_10731246 | Not Available | 544 | Open in IMG/M |
| 3300031681|Ga0318572_10738815 | Not Available | 586 | Open in IMG/M |
| 3300031682|Ga0318560_10721163 | Not Available | 539 | Open in IMG/M |
| 3300031708|Ga0310686_100492057 | Not Available | 1188 | Open in IMG/M |
| 3300031708|Ga0310686_101670706 | Not Available | 740 | Open in IMG/M |
| 3300031708|Ga0310686_114433740 | Not Available | 715 | Open in IMG/M |
| 3300031708|Ga0310686_115167991 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1829 | Open in IMG/M |
| 3300031708|Ga0310686_118033711 | Not Available | 905 | Open in IMG/M |
| 3300031736|Ga0318501_10826589 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300031744|Ga0306918_10365495 | Not Available | 1121 | Open in IMG/M |
| 3300031770|Ga0318521_10743399 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
| 3300031820|Ga0307473_10954317 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
| 3300031890|Ga0306925_12271344 | Not Available | 502 | Open in IMG/M |
| 3300031896|Ga0318551_10278148 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300031910|Ga0306923_10874907 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300031910|Ga0306923_11670202 | Not Available | 659 | Open in IMG/M |
| 3300031912|Ga0306921_10485956 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1437 | Open in IMG/M |
| 3300031912|Ga0306921_10720539 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
| 3300031939|Ga0308174_10685358 | Not Available | 854 | Open in IMG/M |
| 3300031941|Ga0310912_10015299 | All Organisms → cellular organisms → Bacteria | 4960 | Open in IMG/M |
| 3300031942|Ga0310916_10084391 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2518 | Open in IMG/M |
| 3300031945|Ga0310913_10752145 | Not Available | 688 | Open in IMG/M |
| 3300031945|Ga0310913_11219514 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300031954|Ga0306926_10856270 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1092 | Open in IMG/M |
| 3300032001|Ga0306922_11263607 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300032055|Ga0318575_10580050 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300032059|Ga0318533_10333777 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1103 | Open in IMG/M |
| 3300032160|Ga0311301_10005775 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 42850 | Open in IMG/M |
| 3300032160|Ga0311301_12266239 | Not Available | 620 | Open in IMG/M |
| 3300032160|Ga0311301_12309388 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300032261|Ga0306920_101453107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 981 | Open in IMG/M |
| 3300032261|Ga0306920_103759653 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300032770|Ga0335085_10000174 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 205761 | Open in IMG/M |
| 3300032770|Ga0335085_10013143 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 12146 | Open in IMG/M |
| 3300032770|Ga0335085_10014325 | All Organisms → cellular organisms → Bacteria | 11576 | Open in IMG/M |
| 3300032770|Ga0335085_10111763 | All Organisms → cellular organisms → Bacteria | 3505 | Open in IMG/M |
| 3300032770|Ga0335085_10126717 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3247 | Open in IMG/M |
| 3300032770|Ga0335085_10142005 | All Organisms → cellular organisms → Bacteria | 3027 | Open in IMG/M |
| 3300032770|Ga0335085_10174999 | All Organisms → cellular organisms → Bacteria | 2658 | Open in IMG/M |
| 3300032770|Ga0335085_10630707 | Not Available | 1202 | Open in IMG/M |
| 3300032770|Ga0335085_11069933 | Not Available | 866 | Open in IMG/M |
| 3300032770|Ga0335085_12082995 | Not Available | 573 | Open in IMG/M |
| 3300032782|Ga0335082_10043091 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4718 | Open in IMG/M |
| 3300032782|Ga0335082_10173306 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2070 | Open in IMG/M |
| 3300032782|Ga0335082_11486300 | Not Available | 549 | Open in IMG/M |
| 3300032783|Ga0335079_10243553 | All Organisms → cellular organisms → Bacteria | 1980 | Open in IMG/M |
| 3300032783|Ga0335079_10352305 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1597 | Open in IMG/M |
| 3300032783|Ga0335079_10425225 | All Organisms → cellular organisms → Bacteria | 1428 | Open in IMG/M |
| 3300032783|Ga0335079_10655753 | All Organisms → cellular organisms → Bacteria | 1101 | Open in IMG/M |
| 3300032783|Ga0335079_10818981 | Not Available | 963 | Open in IMG/M |
| 3300032783|Ga0335079_11386816 | Not Available | 698 | Open in IMG/M |
| 3300032805|Ga0335078_10386969 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1842 | Open in IMG/M |
| 3300032805|Ga0335078_10407961 | Not Available | 1781 | Open in IMG/M |
| 3300032805|Ga0335078_10446714 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1680 | Open in IMG/M |
| 3300032805|Ga0335078_10454991 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1660 | Open in IMG/M |
| 3300032805|Ga0335078_11121085 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 918 | Open in IMG/M |
| 3300032829|Ga0335070_10038017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5399 | Open in IMG/M |
| 3300032829|Ga0335070_10042873 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 5037 | Open in IMG/M |
| 3300032829|Ga0335070_10318341 | All Organisms → cellular organisms → Bacteria | 1503 | Open in IMG/M |
| 3300032829|Ga0335070_10534378 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
| 3300032892|Ga0335081_10011127 | All Organisms → cellular organisms → Bacteria | 14551 | Open in IMG/M |
| 3300032892|Ga0335081_10454043 | All Organisms → cellular organisms → Bacteria | 1629 | Open in IMG/M |
| 3300032892|Ga0335081_10583793 | Not Available | 1383 | Open in IMG/M |
| 3300032892|Ga0335081_10677303 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1256 | Open in IMG/M |
| 3300032892|Ga0335081_11263209 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 836 | Open in IMG/M |
| 3300032893|Ga0335069_10121962 | All Organisms → cellular organisms → Bacteria | 3264 | Open in IMG/M |
| 3300032893|Ga0335069_10216127 | All Organisms → cellular organisms → Bacteria | 2325 | Open in IMG/M |
| 3300032893|Ga0335069_10526273 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1367 | Open in IMG/M |
| 3300032893|Ga0335069_11545386 | Not Available | 713 | Open in IMG/M |
| 3300032895|Ga0335074_10007010 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 15621 | Open in IMG/M |
| 3300032895|Ga0335074_10015016 | All Organisms → cellular organisms → Bacteria | 10871 | Open in IMG/M |
| 3300032898|Ga0335072_11715528 | Not Available | 523 | Open in IMG/M |
| 3300032954|Ga0335083_11536977 | Not Available | 504 | Open in IMG/M |
| 3300032955|Ga0335076_10757205 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
| 3300032955|Ga0335076_10791721 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300032955|Ga0335076_11047608 | Not Available | 698 | Open in IMG/M |
| 3300032955|Ga0335076_11386695 | Not Available | 589 | Open in IMG/M |
| 3300033004|Ga0335084_10383817 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1448 | Open in IMG/M |
| 3300033004|Ga0335084_11418645 | Not Available | 688 | Open in IMG/M |
| 3300033004|Ga0335084_12342554 | Not Available | 515 | Open in IMG/M |
| 3300033134|Ga0335073_10083183 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4176 | Open in IMG/M |
| 3300033158|Ga0335077_10011501 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 11068 | Open in IMG/M |
| 3300033158|Ga0335077_10258969 | All Organisms → cellular organisms → Bacteria | 1923 | Open in IMG/M |
| 3300033289|Ga0310914_10229256 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1665 | Open in IMG/M |
| 3300033289|Ga0310914_10232607 | All Organisms → cellular organisms → Bacteria | 1653 | Open in IMG/M |
| 3300033289|Ga0310914_10287124 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1482 | Open in IMG/M |
| 3300033290|Ga0318519_10196233 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1150 | Open in IMG/M |
| 3300033887|Ga0334790_000106 | All Organisms → cellular organisms → Bacteria | 85767 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 14.53% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 13.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.12% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 7.41% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 5.41% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.99% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.99% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.70% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.56% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.56% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 2.28% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 2.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.85% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.99% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.99% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.71% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.42% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.42% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.85% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.85% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.85% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.85% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.57% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.57% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.57% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.57% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.57% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.28% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.28% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.28% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.28% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.28% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.28% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.28% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.28% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.28% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.28% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.28% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.28% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.28% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.28% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.28% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001385 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-092012 | Environmental | Open in IMG/M |
| 3300001394 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 deep-092012 | Environmental | Open in IMG/M |
| 3300003218 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 | Environmental | Open in IMG/M |
| 3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
| 3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
| 3300003369 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 002-22A | Environmental | Open in IMG/M |
| 3300003432 | Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk | Environmental | Open in IMG/M |
| 3300003861 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005524 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006055 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006864 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 | Environmental | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
| 3300009616 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 | Environmental | Open in IMG/M |
| 3300009617 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300009629 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 | Environmental | Open in IMG/M |
| 3300009639 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 | Environmental | Open in IMG/M |
| 3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010162 | Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011418 | Attine ant fungus gardens microbial communities from Florida, USA - TSFL038 MetaG | Host-Associated | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015206 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8B, Adjacent to main proglacial river, end of transect (Watson river)) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300019082 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40 | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022524 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 20-24 | Environmental | Open in IMG/M |
| 3300024295 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5 | Environmental | Open in IMG/M |
| 3300025427 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025457 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025464 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025473 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025481 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025482 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025484 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025579 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025650 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B (SPAdes) | Environmental | Open in IMG/M |
| 3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026271 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 (SPAdes) | Environmental | Open in IMG/M |
| 3300026273 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 (SPAdes) | Environmental | Open in IMG/M |
| 3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
| 3300026833 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 54 (SPAdes) | Environmental | Open in IMG/M |
| 3300026854 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 48 (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
| 3300027965 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028649 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_2 | Environmental | Open in IMG/M |
| 3300028651 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_2 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029923 | II_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030001 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N1_2 | Environmental | Open in IMG/M |
| 3300030047 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_3 | Environmental | Open in IMG/M |
| 3300030339 | III_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Host-Associated | Open in IMG/M |
| 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033887 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E4A_05937180 | 2170459003 | Grass Soil | MNANYNWLMDNVAIRVTLNTVAFALWMAATVGILAAAVKL |
| INPhiseqgaiiFebDRAFT_1004786632 | 3300000364 | Soil | MDAKYNWVIDSVSVRVTLNTVAFALWIATAVALLEVAAKL* |
| INPhiseqgaiiFebDRAFT_1050072672 | 3300000364 | Soil | MDAKYNWLIDNVSIRVTLNTVAFALWMAAAVALLELAAKL* |
| JGI20193J14888_10349702 | 3300001385 | Arctic Peat Soil | MDAKYNWLIDNGAIRLTLNTVAFALWIAMAVGLMELAVKI* |
| JGI20191J14862_10072512 | 3300001394 | Arctic Peat Soil | MDAKYNWLIDNGAIRLALNTVAFALWIAMAVGLMELAVKI* |
| JGI26339J46600_100254362 | 3300003218 | Bog Forest Soil | MDAKYNWLIDNGAVRVTLNTVAFALWIALAMGILELAAKSS* |
| JGI26339J46600_100436972 | 3300003218 | Bog Forest Soil | MDAKYNWLIDNVAIRVTLNTVAFALWIATAVALLEVAAKL* |
| JGI26339J46600_100781311 | 3300003218 | Bog Forest Soil | EINMDAKYNWLIDNGAIRVTLNTVAFALWIAMAVGILELATKAS* |
| JGI26341J46601_100805661 | 3300003219 | Bog Forest Soil | MDAKYNWLIDNGAVRVTLNTLAFALWVALAMGVLELAAKAS* |
| JGI26341J46601_101070982 | 3300003219 | Bog Forest Soil | MDAKYNWLIDNGAVRVTLNTVAFALWVALAMGILELAAKAS* |
| JGI26341J46601_101536151 | 3300003219 | Bog Forest Soil | MDAKYNWLIDNGAVRVALNTAAFALWMATAVALLELATKL* |
| JGI26340J50214_100704701 | 3300003368 | Bog Forest Soil | INMDAKYNWLIDNGAVRVTLNTVAFALWVALAMGILELAAKAS* |
| JGI26340J50214_101364451 | 3300003368 | Bog Forest Soil | MDAKYNWLIDNGAIRVTLNVVALALFIATAFGILELATKTS* |
| JGI24140J50213_100397692 | 3300003369 | Arctic Peat Soil | MDAKYNWLIDNGAIRLTLNTVAFALWIAMAVGLMELAIKI* |
| JGI24140J50213_100648802 | 3300003369 | Arctic Peat Soil | MDAKYNWLIDNITIRVTLNTVAFALWMATAVGLLEIASKL* |
| JGI24140J50213_102357141 | 3300003369 | Arctic Peat Soil | MDAKYNWLIDNVTIRVTLNTVAFALWIATAVGLLEVASKL* |
| JGI20214J51088_105990541 | 3300003432 | Wetland | MSANYNWIMDNVAIRVTLNTVAFALWMAASIGLLAAAVKL* |
| Ga0031654_102129181 | 3300003861 | Freshwater Lake Sediment | MDAKYNWLIDNPTVRVTLNTAALALWIALAIGLLELATKA* |
| Ga0062385_102411362 | 3300004080 | Bog Forest Soil | MDANYNWLIDSAAVRITLNTVVWALWIAVAVGLLDLAVKV* |
| Ga0062385_104084161 | 3300004080 | Bog Forest Soil | KEMVMDAKYNWLIDNGAIRVTLNVVALALFIATAFGILELATKTS* |
| Ga0062385_104144092 | 3300004080 | Bog Forest Soil | MDAKYNWLIDNGAIRVTLNTVAFALWMVMALGLLELAAKV* |
| Ga0062385_109336322 | 3300004080 | Bog Forest Soil | MDAKYNWLIDNGAVRVTLNVVALALWIAMAMGILELATKAS* |
| Ga0062385_109346612 | 3300004080 | Bog Forest Soil | RRSIMDAKYNWLIDNGAIRVTLNVVAIALWVATAFGILELATKAS* |
| Ga0062387_1001144562 | 3300004091 | Bog Forest Soil | MDAKYNWLIDNVAVRVTLNTVAFALWIATAVALLEVAAKL* |
| Ga0062387_1003867711 | 3300004091 | Bog Forest Soil | FRPLLRRSIMDAKYNWMIDSPAIRVTLNTAAFALWIVMAIGIMELAAKL* |
| Ga0062389_1005778811 | 3300004092 | Bog Forest Soil | ERKETVMGAKYNWLIDSVAVRLTLNTVALAIWIAVSVGLLELAVKL* |
| Ga0062389_1008200791 | 3300004092 | Bog Forest Soil | RAFRPLLRRSIMDAKYNWMIDSPAIRVTLNTAAFALWIVMAIGIMELAAKL* |
| Ga0062389_1020066402 | 3300004092 | Bog Forest Soil | MDAKYNWLIDNGAIRVTLNTVAFALWIALAVGILELATKVS* |
| Ga0062389_1045990551 | 3300004092 | Bog Forest Soil | MDAKFNWLIDNAAVRVTLNTVALAVWIAMAVGLLELAGKV* |
| Ga0062386_1000427282 | 3300004152 | Bog Forest Soil | MDAKYNWLIDNGAIRVTLNTVAFALWIALAVGILELATKAS* |
| Ga0062386_1001968581 | 3300004152 | Bog Forest Soil | MDAKYNWLIDNGAVRLTLNTVALALWAAMAIGLLEIASKV* |
| Ga0062386_1003921191 | 3300004152 | Bog Forest Soil | IDMDAKYNWLIDNPTIRVTLNTVAFALWIAMAIGLLEIAVKA* |
| Ga0062386_1007690521 | 3300004152 | Bog Forest Soil | MDAKYNWIIDSTAVRVTLNTAAFALWIATAIALLEVAAKL* |
| Ga0062386_1016345741 | 3300004152 | Bog Forest Soil | MDAKYNWLMDNGAIRVTLNVVAIALWIATAVGILELAAKAS* |
| Ga0066398_101056801 | 3300004268 | Tropical Forest Soil | MDAKYNWLIDSVSVRVTLNTVAFALWIATAVGLLEVAVKL* |
| Ga0066395_100341813 | 3300004633 | Tropical Forest Soil | MDAKYNWLIDSTSVRVALNTMAFALWMATAVALLEVASKF* |
| Ga0062388_1023811151 | 3300004635 | Bog Forest Soil | MDAKYNWLIDNVSVRVTLNTVAFALWIAATVAFLELATKF* |
| Ga0062388_1025310311 | 3300004635 | Bog Forest Soil | MDAKYNWLIDNTAIRVTLNTVAFALWIATAIALLELAAKL* |
| Ga0066388_1064551661 | 3300005332 | Tropical Forest Soil | MDAKYNWLIDNGAIRVTLNVVALALFIATAFGILELATKIS* |
| Ga0070711_1003222622 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAKYNWLIDNPAIRVTLNTAAFALWIAMAIGIMELASRA* |
| Ga0070737_100230453 | 3300005524 | Surface Soil | MDAKYNWMIDNGAIRVTLNTVAFALWLAMAVGLLELAAKL* |
| Ga0070741_1001783715 | 3300005529 | Surface Soil | MDAKYNWLIDNGAVRLTLNTLALALWLATAVGLLEIASKV* |
| Ga0070741_107757131 | 3300005529 | Surface Soil | MDAKYNWLIDNGAIRVTLNMVAFALWIAMAVGLLELAGKAV* |
| Ga0070741_113227851 | 3300005529 | Surface Soil | MDAKYNWLIDNPAIRVTLNTAAFALWIATAIGIMELAARL* |
| Ga0070734_105069681 | 3300005533 | Surface Soil | WLIDNGAVRVTLNTVALALWLAMAVGLLEIASKV* |
| Ga0070731_100246192 | 3300005538 | Surface Soil | MDSKYNWLIDNTSVRVTLNAVAFAVWIALSVGILELAAKIR* |
| Ga0070733_108591842 | 3300005541 | Surface Soil | MDAKYNWLIDNGAVRLTLNTLALALWAVMAVGLLEIAAKL* |
| Ga0070732_109768781 | 3300005542 | Surface Soil | MDAKYNWLIDNGAVRMTLNTVGLALWIGVAVGLLELAAKI* |
| Ga0070762_101806312 | 3300005602 | Soil | MDAKYNWLIDNPAIRVTLNTAAFALWIAMAIGIMELAARV* |
| Ga0066903_1019672932 | 3300005764 | Tropical Forest Soil | MDAKYNWLIDSASVRVTLNTVAFALWITTAVALLELATKL* |
| Ga0066903_1020557662 | 3300005764 | Tropical Forest Soil | MDAKYNWLIDSVSIRVTLNTVAFALWIATAVALLEVAAKL* |
| Ga0068858_1006405603 | 3300005842 | Switchgrass Rhizosphere | MNANYNWLMDNVAIRVTLNTVAFALWMAATVGILAAAVKL* |
| Ga0066795_100869732 | 3300005938 | Soil | MDAKYNWLIDNGAVRLTLTAVAFALWIAMTVGLMELAVKI* |
| Ga0066789_100989472 | 3300005994 | Soil | MDAKYNWMIDNVTIRVTLNTVAFALWIATAVGLLEVASKL* |
| Ga0066789_104394972 | 3300005994 | Soil | MDAKYNWLIDNGAIRLTLNTVAFALWIAMAVGLMELATKL* |
| Ga0066790_103473362 | 3300005995 | Soil | MDAKYNWLIDNVSVRVTLNTVAFALWVAASIAFLELATKF* |
| Ga0075029_1000457403 | 3300006052 | Watersheds | MDAKYNWLIDSGAVRVALNTMAFALWMATTVALLELATKL* |
| Ga0075029_1001054902 | 3300006052 | Watersheds | MDAKYNWMIDSATFRVTLNTVAFALWMATAVALLEVATKF* |
| Ga0075029_1001854172 | 3300006052 | Watersheds | MDAKYNWLIDNGAVRVALNTMAFALWMATAVALLELATKL* |
| Ga0075029_1003820392 | 3300006052 | Watersheds | MDAKYNWLIDNGAVRVTLNTVAFALWIALAMGLMELAAKSS* |
| Ga0097691_100087612 | 3300006055 | Arctic Peat Soil | MDAKYNWMIDNVTIRVTLNTVAFALWIATAVGLLEVAAKL* |
| Ga0070765_1006289653 | 3300006176 | Soil | MDAKYNWLIDNAAIRVTLNTVALALWIGLAVGLLELASKV* |
| Ga0070765_1015454692 | 3300006176 | Soil | MNANYNWLMDNVAIRVTLNTVAFALWMAASIGLLAAAVKM* |
| Ga0070765_1017401942 | 3300006176 | Soil | MDTKYNWLIDSAAARITLNATAFALWMAMALGLLELAVKV* |
| Ga0075521_100167343 | 3300006642 | Arctic Peat Soil | MDAKYNWLIDNVTIRVTLNTVAFALWIATAVALLEVASKL* |
| Ga0075521_100396934 | 3300006642 | Arctic Peat Soil | MDAKYNWLIDNGAVRLTLTAVAFALWIGMTVGLMELAVKI* |
| Ga0079222_114584653 | 3300006755 | Agricultural Soil | MDSKYNWLIDNGAVRVTLNTVALALWLALAVGLLELAAKV* |
| Ga0066797_11268391 | 3300006864 | Soil | MDAKYNWLIDNGPIRLTLNTVAFALWIAMAVGLIELATKL* |
| Ga0116128_10548631 | 3300009518 | Peatland | MDAKYDWLIDSVAIRLTLNAVALAIWIAVSVGLLELAVKA* |
| Ga0116128_11816541 | 3300009518 | Peatland | KYNWLIDNGAVRVTLNTVAFALWMVMALGLLELAAKV* |
| Ga0116138_11947652 | 3300009552 | Peatland | MDAKYNWLIDNGAVRVTLNTVAFALWMVMALGLLELAAKV* |
| Ga0116111_100060522 | 3300009616 | Peatland | MDAKYNWLIDNGAIRLTLTAVAFALWIAMAVGLMELAVKI* |
| Ga0116123_10786062 | 3300009617 | Peatland | MDAKYNWLIDNGAIRVTLNTVAFALWMVIALGLLELAAKV* |
| Ga0116133_10150263 | 3300009623 | Peatland | YDWLIDSVAIRLTLNAVALAIWIAVSVGLLELAVKA* |
| Ga0116133_11264372 | 3300009623 | Peatland | MDAKYDWLIDSVAIRLTLNAVALAIWIAVSVGLLELAVKV* |
| Ga0116125_11968562 | 3300009628 | Peatland | EATSKGEPIMDAKYNWLIDNGAIRVTLNTVAFALWMVMALGLLELAAKV* |
| Ga0116119_11517742 | 3300009629 | Peatland | MDAKDDWLIDSVAIRLTLNAVALAIWIAVSVGLLELAVKA* |
| Ga0116122_10362922 | 3300009639 | Peatland | MDAKYNWLIDNGAVRFTLNAVAFALWIAMTVGLMELAAKL* |
| Ga0116121_11240682 | 3300009644 | Peatland | MDAKYDWLIDSMAFRLTLNTVALALWIAMSVGLLELAVKI* |
| Ga0116121_11925012 | 3300009644 | Peatland | YDWLIDSVAIRLTLNAVALAIWIAVSVGLLELAVKV* |
| Ga0116135_10172682 | 3300009665 | Peatland | MDAKYNWMIDSPAIRVTLNTAAFAIWIAMAFGILQLAAKL* |
| Ga0123355_107241542 | 3300009826 | Termite Gut | MDAKYNWLIDSASVRVTLNTVAFALWIATAVALLELATKL* |
| Ga0126373_111414581 | 3300010048 | Tropical Forest Soil | PMDAKYNWLIDSASVRVTLNTVAFALWITTAVALLELATKL* |
| Ga0126373_112001872 | 3300010048 | Tropical Forest Soil | MDSKFNWLIDNTAVRVTLNTVALALWIAMAVGLLELAAKA* |
| Ga0126373_115545092 | 3300010048 | Tropical Forest Soil | MDAKYNWLIDNGAVRVALNTAVFALWIATAIALLEAATKL* |
| Ga0126373_118363522 | 3300010048 | Tropical Forest Soil | MDAKYNWLIDNPAIRVTLNTAAFALWIAMAVGIMELASRA* |
| Ga0131853_108674652 | 3300010162 | Termite Gut | MDAKYNWLIDSASVRVTLNTVAFALWIGTAVALLELATKL* |
| Ga0074046_100211965 | 3300010339 | Bog Forest Soil | MDAKYNWLIDNVSVRVTLNTVAFALWMATAVALLEVAAKL* |
| Ga0074046_100298813 | 3300010339 | Bog Forest Soil | MDAKYNWLIDNPTIRVTLNTVAFALWIAMAIGLLEIAVKA* |
| Ga0074046_100598544 | 3300010339 | Bog Forest Soil | MFMDAKYNWLIDNGAIRVTLNVVALALFIATAFGILELATKTS* |
| Ga0074046_100734735 | 3300010339 | Bog Forest Soil | MDAKYNWLIDNGAIRVTLNMVAFALWIALAVGILELATKAG* |
| Ga0074046_101388932 | 3300010339 | Bog Forest Soil | MDAKYNWLIDSVTIRVTLNTVAFALWIATAVGLLEIAAKL* |
| Ga0074046_103945861 | 3300010339 | Bog Forest Soil | KEINMDAKYNWLIDNGAVRVTLNTVAFALWVALAMGILELAAKAS* |
| Ga0074045_100318832 | 3300010341 | Bog Forest Soil | MDAKYNSLMDNGAVRVTLNTVAFALWIALSVALLELAVKI* |
| Ga0074045_101064082 | 3300010341 | Bog Forest Soil | MDAKYNWLIDNGAVRVTLNVVALALFIATAFGILELATKAS* |
| Ga0074045_109948101 | 3300010341 | Bog Forest Soil | MDAKYDWLIDSVAVRLTLNTVALAIWIAVSVGLLELAAKT* |
| Ga0074044_101782671 | 3300010343 | Bog Forest Soil | MDAKYNWLIDNGAIRVTLNVVAIALWIATAVGILELAAKAS* |
| Ga0126378_105695291 | 3300010361 | Tropical Forest Soil | MDAKFNWLIDSVVVRVGLNTLAFAAWVAAAVALLELGSRG* |
| Ga0126378_118798041 | 3300010361 | Tropical Forest Soil | PMDAKYNWLIDSASVRVTLNTVAFALWIATAVALLELATKL* |
| Ga0126379_102925193 | 3300010366 | Tropical Forest Soil | MDAKFNWLIDNGAIRVTLNTVALALWIAMAVGLLELAARA* |
| Ga0134125_116444782 | 3300010371 | Terrestrial Soil | MNANYNWLMDNVAIRVTLNTVAFALWMAASVGLLAAAVKL* |
| Ga0126381_1010151972 | 3300010376 | Tropical Forest Soil | MDAKYNWLIDNPAIRVTLNTAALALWIALAIGIMELAARV* |
| Ga0126381_1013564872 | 3300010376 | Tropical Forest Soil | MDAKYNWLIDSVSIRVTLNTVAFALWIGTAVALLELAAKL* |
| Ga0136449_10000095021 | 3300010379 | Peatlands Soil | MDAKYNWLIDNGAIRVTLNTVAFALWMVMGLGLLELATKV* |
| Ga0136449_1009092813 | 3300010379 | Peatlands Soil | MKEDGMDARYNWLIDSAAVRLTLNTLALVVWIAVSVGLLELAAKA* |
| Ga0136449_1024762591 | 3300010379 | Peatlands Soil | MDAKYNWLIDNGAIRVTLNTVAFVLWIAVAVGLLEL |
| Ga0136449_1034662682 | 3300010379 | Peatlands Soil | MDAKYNGLIDIVAIRMARNTVAFAVWLAMSVALLELAVKI* |
| Ga0153954_11343521 | 3300011418 | Attine Ant Fungus Gardens | MDAKYNWLIDNPAIRVTLNTAAFALWIALAVGIMELASRA* |
| Ga0137379_116869772 | 3300012209 | Vadose Zone Soil | DAKYNWMMDNGAVRVALNVVAFALSIATFVGLLELATKL* |
| Ga0181524_102086371 | 3300014155 | Bog | MDAKYNWLIDNATIRVTLNTVAFALWIAMAIGLLEIAAKA* |
| Ga0181524_103243503 | 3300014155 | Bog | MDAKYNWLIDNAAIRVTLNTVALALWMAMAVGLLELATKV* |
| Ga0181521_102761471 | 3300014158 | Bog | KEIDMDAKYNWLIDNATIRVTLNTVAFALWIAMAIGLLEIAAKA* |
| Ga0181538_104795861 | 3300014162 | Bog | MDAKYNWLIDNTAVRVTLNTVALALWIAMAVGLLELASKV* |
| Ga0181532_100332335 | 3300014164 | Bog | MDAKYNWLIDNGAVRVTLNTVAFALWIAMSVGLLELASKAS* |
| Ga0181532_100397242 | 3300014164 | Bog | MDAKYNRLIDSVAVRLTLNAVALAIWIAVSVGLLELAVKT* |
| Ga0181532_102325862 | 3300014164 | Bog | MDAKYNWLIDNGAIRVTLNTVAFALWVVMALGLLELAAKA* |
| Ga0181532_107587861 | 3300014164 | Bog | DAKYNWLIDNGAVRVTLNVVALALFIATAFGILELATKAS* |
| Ga0181531_100071854 | 3300014169 | Bog | MDAKYNWLIDNGAVRVTLNTVAFALWMVMALGLLELAVKV* |
| Ga0182013_100013568 | 3300014492 | Bog | MDAKYNWLIDNAAVRVTLNTVAFALWIAMAVGLLELATRA* |
| Ga0182015_100931092 | 3300014495 | Palsa | MDAKYNWLIDNGAVRVTLNTVAFALWIAMSVGLLELASRAS* |
| Ga0182024_104507281 | 3300014501 | Permafrost | MDAKYNWVIDNGAIRLTLTAVAFAAWIAMAVGLMELAAKI* |
| Ga0167644_10097073 | 3300015206 | Glacier Forefield Soil | MDAKYNWMIDNPAIRVTLNTAAFALWIAMAFGIMQLATKL* |
| Ga0182036_108754102 | 3300016270 | Soil | MDAKYNWLIDSASIRVTLDTVAFAVWIATAVALLELAAKL |
| Ga0182037_102962052 | 3300016404 | Soil | MDAKYNWLIDSASIRVTLNTVAFAVWIATAIALLELAAKL |
| Ga0182038_110763802 | 3300016445 | Soil | MDAKYNWLIDNGAIRVTLNVVALALWMAMAVGILELATKAS |
| Ga0181511_10984261 | 3300016702 | Peatland | MDAKYNWLIDNATIRVTLNTVAFALWIAMAIGLLEIAAKA |
| Ga0187818_101697802 | 3300017823 | Freshwater Sediment | MDAKYNWMIDNGAVRVTLNVLALALFIATAFGILELAAKAS |
| Ga0187856_11941892 | 3300017925 | Peatland | MDAKYNWLIDNGAVRFTLNAVAFALWIAMTVGLMELAAKL |
| Ga0187877_12601282 | 3300017931 | Peatland | MDAKYNWLIDNGAIRLTLTAVAFALWIAMAVGLMELAVKI |
| Ga0187877_12732041 | 3300017931 | Peatland | MDAKYNWLTDNGAVRVTLNTVAFALWMVMALGLLELAAKV |
| Ga0187803_102885931 | 3300017934 | Freshwater Sediment | MDAKYNWLIDNGAVRLTLNTLAFALWIAMAVGLMELAAKL |
| Ga0187848_100797292 | 3300017935 | Peatland | MDAKYDWLIDSVAIRLTLNAVALAIWIAVSVGLLELAVKA |
| Ga0187848_100891101 | 3300017935 | Peatland | YNWLIDNGAVRVTLNTVAFALWMVMALGLLELAAKV |
| Ga0187854_100596423 | 3300017938 | Peatland | MDAKYNWLIDNGAVRVTLNTVAFALWMVMALGLLELAAKV |
| Ga0187775_100184142 | 3300017939 | Tropical Peatland | MDAKYNWLIDNMTVRLTMVAVAFAAWLAASAALLTLAKF |
| Ga0187853_104769102 | 3300017940 | Peatland | MDAKYNRLIDSVAVRLTLNAVALAIWIAVSVGLLELAVKT |
| Ga0187850_101244783 | 3300017941 | Peatland | MDAKYNWLIDNGAIRVTLNTVAFALWMVMALGLLELAAKV |
| Ga0187819_103626312 | 3300017943 | Freshwater Sediment | VMDAKYNWLIDNGAIRVTLNVVALALFIATAFGILELATKTG |
| Ga0187819_104728431 | 3300017943 | Freshwater Sediment | MDAKYNKLIDNGMVRVTLNTVAFALWVALAMGILELAAKSS |
| Ga0187879_100766504 | 3300017946 | Peatland | MDAKYNWMIDSPAIRVTLNTAAFAIWIAMAFGILQLAAKL |
| Ga0187879_102276402 | 3300017946 | Peatland | MDAKYDWLIDSVAIRLTLNAVALAIWIAVSVGLLELAVKV |
| Ga0187879_104808492 | 3300017946 | Peatland | MDAKYNWLIDNGAVRLALNTVALALWLAMSVGLLELAARV |
| Ga0187847_100268121 | 3300017948 | Peatland | IMDAKYNWLIDNGAIRVTLNTVAFALWMVMALGLLELAAKV |
| Ga0187817_107884321 | 3300017955 | Freshwater Sediment | MDAKYNWLIDNGAVRVTLNTVAFALWVALAMGILELAAKSS |
| Ga0187779_105637761 | 3300017959 | Tropical Peatland | MNANYNWLMDNVAIRVTLNTVAFALWMAATVGLLEAAVRL |
| Ga0187783_100166013 | 3300017970 | Tropical Peatland | MDAKYNWIIDNGAVRVTLNTVAFALWIALAMGILELAAKAS |
| Ga0187783_105072712 | 3300017970 | Tropical Peatland | MDAKYNWLIDSVAVRLTLNTVALAIWIAMSVGLLELAVKA |
| Ga0187781_109819301 | 3300017972 | Tropical Peatland | MDAKYNWLIDNAAIRVTLNTVAFALWMAIAVGLLELAVKV |
| Ga0187780_102691201 | 3300017973 | Tropical Peatland | MDAKFNWLIDNAAIRVTLNTVALALWIAMAVGLLALAAKV |
| Ga0187816_104012851 | 3300017995 | Freshwater Sediment | MDAKYNWLIDNGAVRLTLNTLALALWMAMAVGLLELAAKV |
| Ga0187886_11021912 | 3300018018 | Peatland | MDAKYNWMIDSPAIRVTLNTAAFAIWIAIAFGILQLAAKL |
| Ga0187864_102011311 | 3300018022 | Peatland | GDTMDAKYNWLIDNGAVRLTLTAVAFALWIAMTVGLMELAAKL |
| Ga0187869_104085542 | 3300018030 | Peatland | MDAKYDWLIDSMAFRLTLNTVALALWIAMSVGLLELAVKI |
| Ga0187867_104432431 | 3300018033 | Peatland | MDAKYNWLIDNGAIRVTLNTVAFALWVVMALGLLELAAKA |
| Ga0187863_107334992 | 3300018034 | Peatland | MDAKYNWLIDNGAVRLALNTVALALWLAMSVGLLELAAR |
| Ga0187862_1001363311 | 3300018040 | Peatland | LMDAKYDWLIDSVAIRLTLNAVALAIWIAVSVGLLELAVKA |
| Ga0187862_101732831 | 3300018040 | Peatland | MDAKYDWLIDSVAIRLTLNAVALAIWIAVSVGLLELAVK |
| Ga0187862_108812692 | 3300018040 | Peatland | LMDAKYDWLIDSVAIRLTLNAVALAIWIAVSVGLLELAVKV |
| Ga0187871_100127812 | 3300018042 | Peatland | MDAKYNALIDSATVRLTLNTVALALWFAMCVGLLDLAVKV |
| Ga0187871_103652581 | 3300018042 | Peatland | IMDAKYNWLIDNGAIRVTWNTVAFALWMVMALGLIELAAKV |
| Ga0187871_108167512 | 3300018042 | Peatland | ALMDAKYDWLIDSVAIRLTLNAVALAIWIAVSVGLLELAVKV |
| Ga0187859_100305371 | 3300018047 | Peatland | NWLIDNGAIRVTLNTVAFALWMVIALGLLELAAKV |
| Ga0187765_110171031 | 3300018060 | Tropical Peatland | MDAKYNWLIDNGAIRVTLNVVALALFIATAFGILELATKIS |
| Ga0187784_101764331 | 3300018062 | Tropical Peatland | MDAKYNWIIDNGAVRVTLNTVAFALWIALAMGILELAAK |
| Ga0187769_103891482 | 3300018086 | Tropical Peatland | MDARYNWLIDNGAIRVTLNVVAIALWVATAFGILELAAKAS |
| Ga0187852_100486012 | 3300019082 | Peatland | TMDAKYNWLIDNGAVRFTLNAVAFALWIAMTVGLMELAAKL |
| Ga0182031_10853591 | 3300019787 | Bog | MDAKYNWLIDNAAVRVTLNTVAFALWIAMAVGLLEGLPW |
| Ga0182031_11525011 | 3300019787 | Bog | MDAKYNWLIDNAAVRVTLNTVAFALWIAMAVGLLELATRA |
| Ga0210407_112772121 | 3300020579 | Soil | MDAKYNWLIDNVAIRVTLNTVAFALWIATAVALLEVAAKL |
| Ga0210388_101193762 | 3300021181 | Soil | MDAKYNWMIDSPAIRVTLNTAAFALWIVMAVGIMELAAKL |
| Ga0210393_101859083 | 3300021401 | Soil | MDAKYNWMIDNPAIRVTLNTAAFALWIAMAFGIMQLAAKL |
| Ga0210387_118984321 | 3300021405 | Soil | YNWMIDSPAIRVTLNTAAFALWIVMAVGIMELAAKL |
| Ga0210383_103995032 | 3300021407 | Soil | MDAKYNWLIDNTAIRVTLNTVAFALWIATAIALLEVAAKL |
| Ga0210391_108952021 | 3300021433 | Soil | MDAKYNWLIDNAGVRITLNMVALALWIAMSVGLLELAVKL |
| Ga0210391_113227712 | 3300021433 | Soil | MDAKYNGLIDNIAMRLALNTVAFALWLATAVALLELAVKG |
| Ga0213878_101652102 | 3300021444 | Bulk Soil | MDAKYNWLIDNLAIRITLNTAALALWAAVAVGLLELANKA |
| Ga0210392_102633972 | 3300021475 | Soil | MDAKYNWLIDNVSVRVTLNTVAFALWMATAIALLEAASKL |
| Ga0210398_101248982 | 3300021477 | Soil | MDAKYNWLIDNAAIRVTLNTVALALWIATAVGLLELASKV |
| Ga0210402_116890672 | 3300021478 | Soil | MDAKYNWMIDNPAIRVTLNTAAFALWIAMAFGIMQ |
| Ga0210409_115391691 | 3300021559 | Soil | MDAKYNWLIDNGPIRLTLNTVAFALWIAMAVGLMELATKL |
| Ga0126371_102812313 | 3300021560 | Tropical Forest Soil | MDAKYNWLIDSTSVRVALNTMAFALWMATAVALLEVASKF |
| Ga0126371_106339953 | 3300021560 | Tropical Forest Soil | MDAKYNWLIDNVSIRVTLNTVAFALWIGTAVALLELAARL |
| Ga0126371_120832231 | 3300021560 | Tropical Forest Soil | MDAKFNWLIDNAVIRVGLNTLAFAAWVAVAVALLELGSRG |
| Ga0126371_121341632 | 3300021560 | Tropical Forest Soil | MDAKYNWLIDSASVRVTLNTVAFALWIATAVALLELATKL |
| Ga0126371_135448391 | 3300021560 | Tropical Forest Soil | SPRRRTMDAKYNWLIDNGAVRVALNTAVFALWIATAIALLEAATKL |
| Ga0224534_10583852 | 3300022524 | Soil | FQGDTMDAKYNWLIDNGAIRLTLNTVAFALWIAMAVGLMELAVRI |
| Ga0224556_10056624 | 3300024295 | Soil | MDAKYNWLIDNGAVRVTLNTVAFALWMVMALGLLELAVKV |
| Ga0208077_10001999 | 3300025427 | Arctic Peat Soil | MDAKYNWLIDNVTIRVTLNTVAFALWIATAVALLEVASKL |
| Ga0208850_10718561 | 3300025457 | Arctic Peat Soil | MDAKYNWMIDNVTIRVTLNTVAFALWIATAVGLLEVASKL |
| Ga0208076_10008103 | 3300025464 | Arctic Peat Soil | MDAKYNWLIDNVTIRVTLNTVAFALWIATAVGLLEVASKL |
| Ga0208190_10055271 | 3300025473 | Peatland | MDAKYNWLIDNGAIRVTLNTVAFALWMVIALGLLELAAKV |
| Ga0208079_10002081 | 3300025481 | Arctic Peat Soil | MDAKYNWLIDNGAIRLTLNTVAFALWIAMAVGLMELAVKI |
| Ga0208079_10030901 | 3300025481 | Arctic Peat Soil | MDAKYNWLIDNGAIRLALNTVAFALWIAMAVGLMELAVKI |
| Ga0208715_10104282 | 3300025482 | Arctic Peat Soil | MDAKYNWLIDNGAIRLTLNTVAFALWIAMAVGLMELAIKI |
| Ga0208587_10659612 | 3300025484 | Arctic Peat Soil | MDAKYNWMIDNVTIRVTLNTVAFALWIATAVGLLEVAAKL |
| Ga0207927_10193812 | 3300025579 | Arctic Peat Soil | MDAKYNWLIDNGAVRLTLTAVAFALWIAMAVGLMELAAKL |
| Ga0209385_10041114 | 3300025650 | Arctic Peat Soil | MDAKYNWLIDNGAVRLTLTAVAFALWIGMTVGLMELAVKI |
| Ga0209584_102916321 | 3300025878 | Arctic Peat Soil | MDAKYNWMIDNVTIRVTLNTVAFALWIATAVGLLE |
| Ga0209584_104027141 | 3300025878 | Arctic Peat Soil | PLTKETLMDAKYNWLIDNVTIRVTLNTVAFALWIATAVALLEVASKL |
| Ga0207702_121120551 | 3300026078 | Corn Rhizosphere | NYNWLMDNVAIRVTLNTVAFALWMAATVGILAAAVKL |
| Ga0209880_10192643 | 3300026271 | Soil | MDAKYNWLIDNGAVRLTLTAVAFALWIAMTVGLMELAVKI |
| Ga0209881_11061702 | 3300026273 | Soil | MDAKYNWLIDNGPIRLTLNTVAFALWIAMAVGLIELATKL |
| Ga0209890_101568851 | 3300026291 | Soil | MDAKYNWMIDNVTIRVTLNTVAFALWMATAVGLLEIASKL |
| Ga0207728_1041652 | 3300026833 | Tropical Forest Soil | MDARYNWLIDNGAVRVALNTAAFALWMATTVALLELATRL |
| Ga0207727_1031672 | 3300026854 | Tropical Forest Soil | MDAKYNWLIDNGAVRVALNTAAFALWMATAVALLELATRL |
| Ga0209799_10933021 | 3300027654 | Tropical Forest Soil | MDAKYNWLIDSVSVRVTLNTVAFALWIATAVGLLEVAVKL |
| Ga0207826_10044741 | 3300027680 | Tropical Forest Soil | MDAKYNWLIDNGAVRVALNTAAFALWMATTVALLELATRL |
| Ga0207826_11061791 | 3300027680 | Tropical Forest Soil | MDAKYNWLIDNGAVRVTLNTVAFALWIALAIGILELAAKAS |
| Ga0209446_10008965 | 3300027698 | Bog Forest Soil | MDAKYNWLIDNGAVRVTLNTLAFALWVALAMGVLELAAKAS |
| Ga0209446_10160432 | 3300027698 | Bog Forest Soil | MDAKYNWLMDSMAARITFNTVVLVLWLAAAVGLLELAVKL |
| Ga0209446_10160943 | 3300027698 | Bog Forest Soil | MDAKYNWLIDNGAIRVTLNVVAIALWIATAVGILELAAKAS |
| Ga0209446_10240472 | 3300027698 | Bog Forest Soil | MDAKYNWLIDNGAIRVTLNVVALALFIATAFGILELATKTS |
| Ga0209446_11997531 | 3300027698 | Bog Forest Soil | MDAKYNWLIDNVSVRVTLNTVAFALWIALSVALLELAVRV |
| Ga0209448_100156752 | 3300027783 | Bog Forest Soil | MDANYNWLIDSAAVRITLNTVVWALWIAVAVGLLDLAVKV |
| Ga0209448_100435482 | 3300027783 | Bog Forest Soil | MDAKYNWLIDNVAVRVTLNTVAFALWIATAVALLEVAAKL |
| Ga0209448_100704651 | 3300027783 | Bog Forest Soil | MDAKYNWLIDNVSVRVTLNTVAFALWMATAVALLEVAAKL |
| Ga0209656_100429772 | 3300027812 | Bog Forest Soil | MDAKYNWLIDNGAVRVTLNTVAFALWVALAMGILELAAKAS |
| Ga0209656_100445261 | 3300027812 | Bog Forest Soil | MDAKYNWLIDSVTIRVTLNTVAFALWIATAVGLLEIAAKL |
| Ga0209656_100446413 | 3300027812 | Bog Forest Soil | MDAKYNWLIDNPTIRVTLNTVAFALWIAMAIGLLELAAKA |
| Ga0209656_100513164 | 3300027812 | Bog Forest Soil | MDAKYNWLIDNVSVRVTLNTVAFALWVAASIAFLELATKF |
| Ga0209656_100543432 | 3300027812 | Bog Forest Soil | MDAKYNWLIDNGAVRVALNTAAFALWMATAVALLELATKL |
| Ga0209656_100665803 | 3300027812 | Bog Forest Soil | MDAKYNWLIDNGAVRVTLNTVAFALWIALAMGILELAAKSS |
| Ga0209656_103927251 | 3300027812 | Bog Forest Soil | MDAKYNWLIDNGAVRVTLNVVALALFIATAFGILELATKAS |
| Ga0209040_100110755 | 3300027824 | Bog Forest Soil | MDAKYNWLIDNGAIRVTLNTVAFALWIALAVGILELATKAS |
| Ga0209040_100406472 | 3300027824 | Bog Forest Soil | MDAKYNWLIDNGAIRVTLNTVAFALWIAMAVGILELATKAS |
| Ga0209040_100578143 | 3300027824 | Bog Forest Soil | MDAKYNWLIDNPTIRVTLNTVAFALWIAMAIGLLEIAVKA |
| Ga0209040_101639092 | 3300027824 | Bog Forest Soil | MDAKYNWLIDNGAVRLTLNTVALALWLAMAVGLLELASKV |
| Ga0209039_100658363 | 3300027825 | Bog Forest Soil | KEVVMDANYNWLIDSAAVRITLNTVVWALWIAVAVGLLDLAVKV |
| Ga0209039_104207942 | 3300027825 | Bog Forest Soil | MDAKYNWVIDNGAIRVTLNTVAFALWIAMAVGILELATKA |
| Ga0209060_100403272 | 3300027826 | Surface Soil | MDAKYNWLIDNGAVRVTLNTVALALWLAMAVGLLEIASKV |
| Ga0209693_103577962 | 3300027855 | Soil | MDAKYNWLIDNPAIRVTLNTAAFALWIAMAIGIMELAARV |
| Ga0209167_102899392 | 3300027867 | Surface Soil | MDSKYNWLIDNTSVRVTLNAVAFAVWIALSVGILELAAKIR |
| Ga0209167_105675531 | 3300027867 | Surface Soil | MDAKYNWLIDNGAVRLTLNTLALALWAVMAVGLLEIAAKL |
| Ga0209579_100190563 | 3300027869 | Surface Soil | MDAKYNWLIDNGAVRLTLNTLALALWLATAVGLLEIASKV |
| Ga0209068_104387092 | 3300027894 | Watersheds | MDAKYNWMIDNATFRVTLNTVAFALWIATAVALLEVAAKL |
| Ga0209048_100419123 | 3300027902 | Freshwater Lake Sediment | MDAKYNWLIDNPTVRVTLNTAALALWIALAIGLLELATKA |
| Ga0209048_104478881 | 3300027902 | Freshwater Lake Sediment | MDAKYNWMIDNVTVRVTLNTVAFALWIATAVGLLEIASKL |
| Ga0209062_10452212 | 3300027965 | Surface Soil | MDAKYNWMIDNGAIRVTLNTVAFALWLAMAVGLLELAAKL |
| Ga0302162_100557361 | 3300028649 | Fen | MDAKYNWLIDNVSVRVTLNTVAFALWMATAVALLEFATKF |
| Ga0302171_101161841 | 3300028651 | Fen | KTMDAKYNWLIDNVSVRVTLNTVAFALWMATAVALLEFATKF |
| Ga0265338_101655182 | 3300028800 | Rhizosphere | MDAKFNWLIDNAAVRVTLNTVALALWIAMAVGLLELAARA |
| Ga0308309_111094441 | 3300028906 | Soil | MDAKYNWLIDNAAIRVTLNTVALALWIGLAVGLLELASKV |
| Ga0308309_117802802 | 3300028906 | Soil | MNANYNWLMDNVAIRVTLNTVAFALWMAASIGLLAAAVKM |
| Ga0311347_101833511 | 3300029923 | Fen | MDAKYNWLIDSPSFRVTLNTVAFALWMATAVALLEVATRF |
| Ga0311334_106287201 | 3300029987 | Fen | MDAKYNWLIDNVSVRVTLNTVAFALWMATAVALLE |
| Ga0311339_110259461 | 3300029999 | Palsa | MDAKYDWLIDSVAIRLTLNTLALAIWIAMSVGLLELAVKV |
| Ga0302272_10365683 | 3300030001 | Bog | MDAKYNWLIDNVSIRVTLNTVAFALWMATAVALLEFATKF |
| Ga0302286_100744833 | 3300030047 | Fen | MDAKYNWLIDNVSIRVTLNTVAFALWIATAVGLLEVASKL |
| Ga0311360_101953573 | 3300030339 | Bog | MDAKYNWMIDSPSFRVTLNTVAFALWMATAVALLEVATRF |
| Ga0311356_118734121 | 3300030617 | Palsa | QVSRPKENIMDAKYNWLIDNGAVRLALNTVALALWLAMSVGLLELAARV |
| Ga0265760_101647422 | 3300031090 | Soil | MDAKYNWLIDSGAVRVTLNTVAFALWMVMALGLLELAAKV |
| Ga0170824_1224421841 | 3300031231 | Forest Soil | MDAKYNWMIDSPAIRVTLNTAAFALWIAMAFGILQLADKL |
| Ga0265327_101363401 | 3300031251 | Rhizosphere | MDAKYNWLIDNGVIRVTLNVVAFALWIAMAVGLLELASR |
| Ga0265316_100631873 | 3300031344 | Rhizosphere | MNANYNWLMDNVAIRVTLNTVAFALWMAASVGLLVAAVKL |
| Ga0170818_1074434352 | 3300031474 | Forest Soil | MDAKYNWLIDNVSVRVTLNTVAFALWMATAVALLELATKF |
| Ga0302326_127951592 | 3300031525 | Palsa | TAMDAKYNALIDSATVRLTLNTVALALWFAMCVGLLDLAVKV |
| Ga0318541_106901342 | 3300031545 | Soil | MDAKYNWLIDSVPIRVTLNTVAFAIWIATAVALLELAAKL |
| Ga0318538_103005272 | 3300031546 | Soil | MDAKYNWLIDSASVRVTLNTVAFALWIGTAVALLELATRL |
| Ga0318538_105967592 | 3300031546 | Soil | MDAKYNWLIDNVAVRVTLNTVAFALWIATTVALLEVAAKL |
| Ga0310915_105775882 | 3300031573 | Soil | MDAKYNWLMDNVAVRVTLNTVAFALWMAATVGLLVAATKL |
| Ga0307375_1000031633 | 3300031669 | Soil | MDSKYNWLIDNLPFRVAVNTLVFGLWLAMAVGLLALANV |
| Ga0307375_1000041533 | 3300031669 | Soil | MDSKYNWLIDNLSFRVAVNTLVFGLWLATAVGLLALANV |
| Ga0318561_107312461 | 3300031679 | Soil | METRFHKEITMDAKYNWLIDNGAVRLTLNTVAFALWIAMAVGLMELATKI |
| Ga0318572_107388151 | 3300031681 | Soil | MDAKYNWLIDSGSIRVALNTVAFALWMASAVALLEVATKF |
| Ga0318560_107211632 | 3300031682 | Soil | MDAKFNWLIDNVVVRVSLNTLALGAWIATAVALLALAARS |
| Ga0318560_107667472 | 3300031682 | Soil | RTPLKKENPMDAKYNWLIDSASVRVTLNTVAFALWIATAVALLELATKL |
| Ga0310686_1004920572 | 3300031708 | Soil | MDAKYNWMIDNPAIRVTLNTAAFALWIAMAIGIMELAARV |
| Ga0310686_1016707061 | 3300031708 | Soil | MDAKFNWLIDNAAIRVTLNTVALALWIAMAVGLLELAAKV |
| Ga0310686_1144337401 | 3300031708 | Soil | MDAKYNGLIDNIAMRLALNTVAFALWLAMAVALLELAVKV |
| Ga0310686_1151679912 | 3300031708 | Soil | MDAKYNWLIDNGAIRVTLNTVAFALWIAIAVGLLELAAKV |
| Ga0310686_1180337112 | 3300031708 | Soil | MDAKYNWLIDSATIRLTLNTVALAIWIALSVGLLELAVRV |
| Ga0318501_108265891 | 3300031736 | Soil | MDAKYNWLIDSASIRVTLNTVAFALWIATAVALLELATKL |
| Ga0306918_103654952 | 3300031744 | Soil | MDAKYNWLIDNGAIRVALNTTIFALWVATAIALLEVAVRQ |
| Ga0318521_107433992 | 3300031770 | Soil | RRNVMDAKYNWLMDNVAVRVTLNTVAFALWMAATVGLLVAATKL |
| Ga0307473_109543172 | 3300031820 | Hardwood Forest Soil | MDAKYNWLIDNVSIRVTLNTVAFALWIASAVALLEAAAKL |
| Ga0306925_122713442 | 3300031890 | Soil | MDAKYNWLIDSASIRVTLNTVAFAVWIATAVALLELAAKL |
| Ga0318551_102781482 | 3300031896 | Soil | KYNWLIDSTSVRVALNTMAFALWMATAVALLEVASKF |
| Ga0306923_108749072 | 3300031910 | Soil | MDAKYNWLIDSVSIRVTLNTVAFALWIGTAVALLELATRL |
| Ga0306923_116702022 | 3300031910 | Soil | MDAKYNWLIDNGAVRLTLNTVAFALWIAMAVGLMELATKI |
| Ga0306921_104859561 | 3300031912 | Soil | MDAKYNWLIDNGAVRVTLNTVAFALWIALAMGLLELAAKSS |
| Ga0306921_107205392 | 3300031912 | Soil | MSMDAKYNWLIDSGSIRVALNTVAFALWMATAVVLLEVATKF |
| Ga0308174_106853581 | 3300031939 | Soil | MNANYNWLMDNVAIRVTLNTVAFALWMAASVGLLAAATVKL |
| Ga0310912_100152991 | 3300031941 | Soil | MDAKYNWLIDNVAVRVTLNTVAFALWIATTVALLE |
| Ga0310916_100843912 | 3300031942 | Soil | MDAKYNWLIDNGSIRVALNTVAFALWMASAVALLEVATKF |
| Ga0310913_107521452 | 3300031945 | Soil | LMDAKYNWLIDNVAVRVTLNTVAFALWIATTVALLEVAAKL |
| Ga0310913_112195142 | 3300031945 | Soil | NWLIDSGSIRVALNTVAFALWMASAVALLEVATKF |
| Ga0306926_108562702 | 3300031954 | Soil | MDAKYNWLIDSVSIRVTLNTVAFALWIGSAVALLELAAKL |
| Ga0306922_112636072 | 3300032001 | Soil | MDAKYNWLIDSVSIRVTLNTVAFALWIGTAIALLELATRL |
| Ga0318575_105800502 | 3300032055 | Soil | MDAKYNWLIDSASIRVTLNTVAFALWITTAVALLELATKL |
| Ga0318533_103337772 | 3300032059 | Soil | MDAKFNWLIDSATVRVGLNTLALAAWIAAAVALLELGSRS |
| Ga0311301_1000577524 | 3300032160 | Peatlands Soil | MDAKYNWLIDNGAIRVTLNTVAFALWMVMGLGLLELATKV |
| Ga0311301_122662391 | 3300032160 | Peatlands Soil | MDARYNWLIDSAAVRLTLNTLALVVWIAVSVGLLELAAKA |
| Ga0311301_123093881 | 3300032160 | Peatlands Soil | MDAKYNWLIDNGAVRFTLNTVALALWLAMAMGLLELASKV |
| Ga0306920_1014531071 | 3300032261 | Soil | MDAKYNWLIDNVAVRVTLNTVAFALWMATAVALLEVASKL |
| Ga0306920_1037596531 | 3300032261 | Soil | MDAKYNWLIDSASIRVTLNTVAFAVWIATAVALLE |
| Ga0335085_10000174101 | 3300032770 | Soil | MDAKYNWLIDNGAVRLTLNTVALALWAAMAIGLLEMAARF |
| Ga0335085_100131439 | 3300032770 | Soil | MDAKYNWLIDNVSIRVTLNTVAFALWIATAVAFLEVAAKL |
| Ga0335085_100143258 | 3300032770 | Soil | MDAKYNWLIDNGAIRVTLNTVALALFIATAVGILELATKIS |
| Ga0335085_101117634 | 3300032770 | Soil | MNANYNWLMDNFAVRVTLNTVAFALWAAATVGLLEAAVKL |
| Ga0335085_101267171 | 3300032770 | Soil | MDAKYNWLIDNGTIRVALNTVALALWIALAVGLLELATKA |
| Ga0335085_101420052 | 3300032770 | Soil | MDAKYNWLIDNGAVRLTLNTLALVLWIGMAVGLLELAAKV |
| Ga0335085_101749992 | 3300032770 | Soil | MNANYNWLMDNFAVRVTLNTVAFAVWMAASFGLLEAAVRL |
| Ga0335085_106307072 | 3300032770 | Soil | MDAKYNWLIDNAAIRVTLNTVALALWIAMAVGLLELASRA |
| Ga0335085_110699332 | 3300032770 | Soil | MNANYNWLMDNFAVRVTLNTVAFALWMAAAVGLLEAAVKL |
| Ga0335085_120829951 | 3300032770 | Soil | MDAKYNWLIDNVPVRVTLNTVAFALWMATAVALLEVAARL |
| Ga0335082_100430918 | 3300032782 | Soil | MDAKYNWLIDNGAIRVTLNVVALALFIATAFGILELAAKAS |
| Ga0335082_101733061 | 3300032782 | Soil | EVTMDSKYNWLIDNGAIRLTLNTVAFALWVALAVGVMELAVKI |
| Ga0335082_114863002 | 3300032782 | Soil | MDAKFNWLIDNAAIRVTLNTVALVLWIAMAVGLLELAAKV |
| Ga0335079_102435532 | 3300032783 | Soil | MDAKFNWLIDNAAVRVTLNTVALALWIAMAVGLLELAAKV |
| Ga0335079_103523052 | 3300032783 | Soil | MDAKYNWLIDNGAIRVTLNTVAFALWIATAVGLLELAARI |
| Ga0335079_104252253 | 3300032783 | Soil | MDSKYNWLIDNGAIRLTLNTVAFALWVALAVGVMELAVKI |
| Ga0335079_106557533 | 3300032783 | Soil | MDAKYNWMIDNGAIRLTLNTLALALWLAAAVGLLEIAARV |
| Ga0335079_108189811 | 3300032783 | Soil | MDAKYNWLIDNGAVRVTLNVVALALFIATAFGILELATRAS |
| Ga0335079_113868162 | 3300032783 | Soil | MDAKYNWMIDNGAVRVTLNVVALALFIATAFGILELAAKAS |
| Ga0335078_103869693 | 3300032805 | Soil | MDAKFNWLIDNAAIRVTLNTVALALWIAMAVGLLEL |
| Ga0335078_104079611 | 3300032805 | Soil | MDAKFNWLIDNAAIRVTLNTVALALWIAMAVGLLELAAKA |
| Ga0335078_104467143 | 3300032805 | Soil | MDAKYNWLIDNAAIRVTLNTVALALWIGLAVGLLQLASKV |
| Ga0335078_104549911 | 3300032805 | Soil | MDAKYNWLIDSVSIRVTLNTVAFALWIGTAIALLELAAKL |
| Ga0335078_111210852 | 3300032805 | Soil | MDAKYNWLIDNGAIRVTLNTVALALWIATAVGLLELAAKI |
| Ga0335070_100380175 | 3300032829 | Soil | MDAKYNWLIDNVAVRVTLNTVAFALWMATAIVLLEAASRL |
| Ga0335070_100428734 | 3300032829 | Soil | MNANYNWLMDNVAIRVTLNTVAFALWMAATVGLLEAAAKL |
| Ga0335070_103183412 | 3300032829 | Soil | MDAKYNWMIDNGAVRLTLNTLALAVWIAMAVGLLELAAKI |
| Ga0335070_105343781 | 3300032829 | Soil | MDAKYNWLIDNGAVRVALNTVAFALWMATALALLELATKL |
| Ga0335081_100111274 | 3300032892 | Soil | MDAKYNWLIDNPAIRVALNTVALALWIGMAVGLLELASKV |
| Ga0335081_104540432 | 3300032892 | Soil | MDAKYNWLIDNAAVRVTLNTLALAVWMAVAVGLLELASRV |
| Ga0335081_105837932 | 3300032892 | Soil | MDAKYNWLIDNGAVRLTLNTVALAIWAATAVGLLELAARL |
| Ga0335081_106773032 | 3300032892 | Soil | MDAKYNWLIDNGAIRVTLNTMALALWMAMAVGLLELASRL |
| Ga0335081_112632092 | 3300032892 | Soil | MDAKYNWLIDNPAVRVTLNTVALALWIAMAFGILELASKI |
| Ga0335069_101219625 | 3300032893 | Soil | MDAKYNWLMDNAAIRLALNTVAFALWLAASVALLEVAAKL |
| Ga0335069_102161271 | 3300032893 | Soil | MDAKYNWLIDNVAIRVTLNTVAFALWMATTIALLAIAAKM |
| Ga0335069_105262732 | 3300032893 | Soil | MDAKYNWLIDNGVVRFTLNTVAFALWIAMAMGILELAAKSS |
| Ga0335069_115453862 | 3300032893 | Soil | MDAKYNWLIDNVAVRVTLNTVAFALWIATAVAFLEVAAKL |
| Ga0335074_100070105 | 3300032895 | Soil | MDAKFNWLIDNGAIRVTLNTVALALWIAMAVGLLELAAKV |
| Ga0335074_1001501613 | 3300032895 | Soil | MDAKYNWLIDNTAIRITLNTVALALWIATAVGLLELAAKV |
| Ga0335072_117155281 | 3300032898 | Soil | MDAKYNWLIDNAAIRVTLNTLALVLWAALAVGLLDLASKV |
| Ga0335083_115369771 | 3300032954 | Soil | MDAKYNWLIDNPAIRVTLNTAAFALWIAMAVGIMELASRA |
| Ga0335076_107572053 | 3300032955 | Soil | MDAKYNWLIDNAAIRVTLNTVAFALWAALAVGLMELASRV |
| Ga0335076_107917211 | 3300032955 | Soil | MNANYNWLMDNVAIRLTLNTVAFALWVAASIGLLAAAVKL |
| Ga0335076_110476082 | 3300032955 | Soil | MDAKYNWLIDNTALRITINTVAFALWIATAVGLLELASKI |
| Ga0335076_113866952 | 3300032955 | Soil | YNWLMDNVAIRVTLNTVAFALWMAATVGLLEAAVRL |
| Ga0335084_103838172 | 3300033004 | Soil | MDAKYNWLIDNGAVRVALNVVGLALFIATAFGIMELAAKAS |
| Ga0335084_114186451 | 3300033004 | Soil | MNANYNWLMDNFAVRVTLNTVAFAVWMAASFGLLEAA |
| Ga0335084_123425541 | 3300033004 | Soil | GRNQQRRNAMNANYNWLMDNFAVRVTLNTVAFAVWMAASFGLLEAAVRL |
| Ga0335073_100831833 | 3300033134 | Soil | MDAKYNWIIDNSAVRIALNTMALALWVATAVGLLALAAKV |
| Ga0335077_100115014 | 3300033158 | Soil | MNANYNWMMDNVAIRVTLNTVAFALWMAATVGLLEAAVRL |
| Ga0335077_102589691 | 3300033158 | Soil | MNANYNWLMDNVAVRVTLNTVAFALWMAAAVGLLEAAVKF |
| Ga0310914_102292563 | 3300033289 | Soil | KYNWLIDNVAVRVTLNTVAFALWMATAVALLEVASKL |
| Ga0310914_102326072 | 3300033289 | Soil | MDAKYNWLIDSASVRVTLNTVAFALWITTAVALLELATKL |
| Ga0310914_102871243 | 3300033289 | Soil | KETLMDAKYNWLIDNVAVRVTLNTVAFALWIATTVALLEVAAKL |
| Ga0318519_101962332 | 3300033290 | Soil | MDAKYNWLIDSASIRVTLNTVAFALWIATTVALLEVAAKL |
| Ga0334790_000106_24768_24890 | 3300033887 | Soil | MDAKYNWLIDNGAIRLTLNTVAFALWIAMAVGLMELAVRI |
| ⦗Top⦘ |