| Basic Information | |
|---|---|
| Family ID | F007386 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 352 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MDELLEKLLLEPAERLRGEKELRRKIQNVEALRDLFLSNREKP |
| Number of Associated Samples | 269 |
| Number of Associated Scaffolds | 352 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.99 % |
| % of genes near scaffold ends (potentially truncated) | 96.31 % |
| % of genes from short scaffolds (< 2000 bps) | 90.34 % |
| Associated GOLD sequencing projects | 241 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (80.682 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (21.875 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.852 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.557 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.70% β-sheet: 0.00% Coil/Unstructured: 49.30% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 352 Family Scaffolds |
|---|---|---|
| PF01379 | Porphobil_deam | 58.52 |
| PF03900 | Porphobil_deamC | 26.99 |
| PF02602 | HEM4 | 6.82 |
| PF00490 | ALAD | 3.12 |
| PF00202 | Aminotran_3 | 0.57 |
| PF05201 | GlutR_N | 0.57 |
| PF04239 | DUF421 | 0.28 |
| PF13188 | PAS_8 | 0.28 |
| PF13426 | PAS_9 | 0.28 |
| PF07366 | SnoaL | 0.28 |
| PF01425 | Amidase | 0.28 |
| PF01761 | DHQ_synthase | 0.28 |
| PF01849 | NAC | 0.28 |
| COG ID | Name | Functional Category | % Frequency in 352 Family Scaffolds |
|---|---|---|---|
| COG0181 | Porphobilinogen deaminase | Coenzyme transport and metabolism [H] | 85.51 |
| COG1587 | Uroporphyrinogen-III synthase | Coenzyme transport and metabolism [H] | 6.82 |
| COG0113 | Delta-aminolevulinic acid dehydratase, porphobilinogen synthase | Coenzyme transport and metabolism [H] | 3.12 |
| COG0373 | Glutamyl-tRNA reductase | Coenzyme transport and metabolism [H] | 0.57 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.28 |
| COG1308 | Transcription factor homologous to NACalpha-BTF3 | Transcription [K] | 0.28 |
| COG2323 | Uncharacterized membrane protein YcaP, DUF421 family | Function unknown [S] | 0.28 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 80.68 % |
| Unclassified | root | N/A | 19.32 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000559|F14TC_106907813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 525 | Open in IMG/M |
| 3300000955|JGI1027J12803_104344083 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1097 | Open in IMG/M |
| 3300000956|JGI10216J12902_112673312 | Not Available | 705 | Open in IMG/M |
| 3300001593|JGI12635J15846_10037772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 3792 | Open in IMG/M |
| 3300001664|P5cmW16_1054693 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300001867|JGI12627J18819_10003209 | All Organisms → cellular organisms → Bacteria | 6052 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101048491 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300003350|JGI26347J50199_1025591 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300003368|JGI26340J50214_10191469 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300004080|Ga0062385_10949747 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300004080|Ga0062385_11216108 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300004091|Ga0062387_100054357 | All Organisms → cellular organisms → Bacteria | 1938 | Open in IMG/M |
| 3300004633|Ga0066395_10208275 | Not Available | 1027 | Open in IMG/M |
| 3300004633|Ga0066395_10400568 | Not Available | 773 | Open in IMG/M |
| 3300004635|Ga0062388_100500786 | Not Available | 1087 | Open in IMG/M |
| 3300004635|Ga0062388_100882169 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 857 | Open in IMG/M |
| 3300005093|Ga0062594_103106350 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300005166|Ga0066674_10058054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae | 1757 | Open in IMG/M |
| 3300005177|Ga0066690_10008498 | All Organisms → cellular organisms → Bacteria | 5093 | Open in IMG/M |
| 3300005332|Ga0066388_102937968 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300005356|Ga0070674_100143266 | All Organisms → cellular organisms → Bacteria | 1796 | Open in IMG/M |
| 3300005466|Ga0070685_10062772 | All Organisms → cellular organisms → Bacteria | 2179 | Open in IMG/M |
| 3300005533|Ga0070734_10447148 | Not Available | 737 | Open in IMG/M |
| 3300005536|Ga0070697_100425852 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
| 3300005537|Ga0070730_10137362 | All Organisms → cellular organisms → Bacteria | 1667 | Open in IMG/M |
| 3300005541|Ga0070733_10492973 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 819 | Open in IMG/M |
| 3300005541|Ga0070733_10564267 | Not Available | 763 | Open in IMG/M |
| 3300005552|Ga0066701_10799634 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300005553|Ga0066695_10204967 | All Organisms → cellular organisms → Bacteria | 1238 | Open in IMG/M |
| 3300005554|Ga0066661_10893854 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300005560|Ga0066670_10756682 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300005569|Ga0066705_10474468 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300005574|Ga0066694_10090245 | All Organisms → cellular organisms → Bacteria | 1427 | Open in IMG/M |
| 3300005576|Ga0066708_10068758 | All Organisms → cellular organisms → Bacteria | 2032 | Open in IMG/M |
| 3300005576|Ga0066708_10728912 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300005591|Ga0070761_10188732 | All Organisms → cellular organisms → Bacteria | 1218 | Open in IMG/M |
| 3300005602|Ga0070762_10108074 | All Organisms → cellular organisms → Bacteria | 1619 | Open in IMG/M |
| 3300005602|Ga0070762_10150508 | All Organisms → cellular organisms → Bacteria | 1392 | Open in IMG/M |
| 3300005602|Ga0070762_11159993 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300005764|Ga0066903_102357646 | Not Available | 1029 | Open in IMG/M |
| 3300005764|Ga0066903_106370341 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300005843|Ga0068860_101628031 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300005921|Ga0070766_10040630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2578 | Open in IMG/M |
| 3300005950|Ga0066787_10028864 | Not Available | 991 | Open in IMG/M |
| 3300005994|Ga0066789_10005244 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5711 | Open in IMG/M |
| 3300005995|Ga0066790_10306529 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300006028|Ga0070717_10140984 | All Organisms → cellular organisms → Bacteria | 2079 | Open in IMG/M |
| 3300006032|Ga0066696_10571876 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300006047|Ga0075024_100305964 | Not Available | 781 | Open in IMG/M |
| 3300006057|Ga0075026_100496638 | Not Available | 702 | Open in IMG/M |
| 3300006162|Ga0075030_100901893 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300006172|Ga0075018_10312853 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300006174|Ga0075014_100166492 | All Organisms → cellular organisms → Bacteria | 1089 | Open in IMG/M |
| 3300006176|Ga0070765_100030436 | All Organisms → cellular organisms → Bacteria | 4193 | Open in IMG/M |
| 3300006354|Ga0075021_10522694 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 753 | Open in IMG/M |
| 3300006755|Ga0079222_10684148 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300006755|Ga0079222_12088948 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300006791|Ga0066653_10763415 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300006797|Ga0066659_10636509 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300006800|Ga0066660_10661904 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300006804|Ga0079221_10693007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 708 | Open in IMG/M |
| 3300006893|Ga0073928_11106811 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300006914|Ga0075436_100967938 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300006954|Ga0079219_11771565 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300007076|Ga0075435_100134394 | All Organisms → cellular organisms → Bacteria | 2071 | Open in IMG/M |
| 3300007076|Ga0075435_100797873 | Not Available | 822 | Open in IMG/M |
| 3300007255|Ga0099791_10396547 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300007258|Ga0099793_10167777 | Not Available | 1045 | Open in IMG/M |
| 3300007265|Ga0099794_10150717 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
| 3300007265|Ga0099794_10414687 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300009088|Ga0099830_11338299 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300009089|Ga0099828_10088560 | All Organisms → cellular organisms → Bacteria | 2657 | Open in IMG/M |
| 3300009089|Ga0099828_10090276 | All Organisms → cellular organisms → Bacteria | 2633 | Open in IMG/M |
| 3300009089|Ga0099828_10257158 | All Organisms → cellular organisms → Bacteria | 1567 | Open in IMG/M |
| 3300009089|Ga0099828_11093186 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
| 3300009098|Ga0105245_13003991 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300009137|Ga0066709_100085115 | All Organisms → cellular organisms → Bacteria | 3795 | Open in IMG/M |
| 3300009176|Ga0105242_10162771 | All Organisms → cellular organisms → Bacteria | 1954 | Open in IMG/M |
| 3300009792|Ga0126374_10117505 | All Organisms → cellular organisms → Bacteria | 1547 | Open in IMG/M |
| 3300009792|Ga0126374_11065836 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300010043|Ga0126380_11459719 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300010046|Ga0126384_10957566 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300010046|Ga0126384_11477705 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 636 | Open in IMG/M |
| 3300010047|Ga0126382_11256991 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300010048|Ga0126373_12468275 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300010048|Ga0126373_12726665 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300010159|Ga0099796_10046939 | Not Available | 1485 | Open in IMG/M |
| 3300010304|Ga0134088_10489129 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300010320|Ga0134109_10151443 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300010329|Ga0134111_10172914 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300010358|Ga0126370_11026170 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300010359|Ga0126376_10886609 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300010359|Ga0126376_11749740 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300010360|Ga0126372_11122343 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300010360|Ga0126372_11221870 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 777 | Open in IMG/M |
| 3300010360|Ga0126372_12122377 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300010360|Ga0126372_12389406 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300010362|Ga0126377_12288856 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300010362|Ga0126377_13103973 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300010366|Ga0126379_10463766 | All Organisms → cellular organisms → Bacteria | 1331 | Open in IMG/M |
| 3300010376|Ga0126381_100832663 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1326 | Open in IMG/M |
| 3300011269|Ga0137392_10375593 | All Organisms → cellular organisms → Bacteria | 1179 | Open in IMG/M |
| 3300011270|Ga0137391_10078241 | All Organisms → cellular organisms → Bacteria | 2849 | Open in IMG/M |
| 3300011270|Ga0137391_10204256 | All Organisms → cellular organisms → Bacteria | 1718 | Open in IMG/M |
| 3300011270|Ga0137391_10409630 | Not Available | 1157 | Open in IMG/M |
| 3300011271|Ga0137393_10379378 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
| 3300011271|Ga0137393_10853168 | Not Available | 778 | Open in IMG/M |
| 3300011271|Ga0137393_11133854 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300011271|Ga0137393_11731991 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300012096|Ga0137389_10037148 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3589 | Open in IMG/M |
| 3300012096|Ga0137389_10393492 | All Organisms → cellular organisms → Bacteria | 1183 | Open in IMG/M |
| 3300012096|Ga0137389_10668898 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300012200|Ga0137382_10514256 | Not Available | 851 | Open in IMG/M |
| 3300012202|Ga0137363_11228867 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300012202|Ga0137363_11253370 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300012203|Ga0137399_10150054 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1861 | Open in IMG/M |
| 3300012205|Ga0137362_10577778 | Not Available | 970 | Open in IMG/M |
| 3300012205|Ga0137362_11208060 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300012206|Ga0137380_11595498 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300012207|Ga0137381_11454289 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300012208|Ga0137376_10161404 | All Organisms → cellular organisms → Bacteria | 1931 | Open in IMG/M |
| 3300012209|Ga0137379_10152665 | All Organisms → cellular organisms → Bacteria | 2219 | Open in IMG/M |
| 3300012209|Ga0137379_10183055 | All Organisms → cellular organisms → Bacteria | 2007 | Open in IMG/M |
| 3300012350|Ga0137372_10014841 | All Organisms → cellular organisms → Bacteria | 7404 | Open in IMG/M |
| 3300012351|Ga0137386_10243101 | All Organisms → cellular organisms → Bacteria | 1294 | Open in IMG/M |
| 3300012356|Ga0137371_10161885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1755 | Open in IMG/M |
| 3300012361|Ga0137360_11714281 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300012362|Ga0137361_10716561 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300012363|Ga0137390_10818986 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300012363|Ga0137390_11931036 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300012582|Ga0137358_10200871 | All Organisms → cellular organisms → Bacteria | 1361 | Open in IMG/M |
| 3300012582|Ga0137358_10266183 | Not Available | 1165 | Open in IMG/M |
| 3300012582|Ga0137358_10553080 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 774 | Open in IMG/M |
| 3300012582|Ga0137358_10688721 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300012683|Ga0137398_11050650 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300012922|Ga0137394_10455613 | Not Available | 1088 | Open in IMG/M |
| 3300012922|Ga0137394_10973718 | Not Available | 706 | Open in IMG/M |
| 3300012923|Ga0137359_10194116 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1814 | Open in IMG/M |
| 3300012923|Ga0137359_11021534 | Not Available | 709 | Open in IMG/M |
| 3300012923|Ga0137359_11586320 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300012924|Ga0137413_10129513 | All Organisms → cellular organisms → Bacteria | 1619 | Open in IMG/M |
| 3300012925|Ga0137419_10359401 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
| 3300012925|Ga0137419_10923362 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300012925|Ga0137419_11875884 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300012927|Ga0137416_10054511 | All Organisms → cellular organisms → Bacteria | 2822 | Open in IMG/M |
| 3300012929|Ga0137404_11106524 | Not Available | 727 | Open in IMG/M |
| 3300012929|Ga0137404_11191663 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300012929|Ga0137404_11226014 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300012930|Ga0137407_12399611 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300012948|Ga0126375_11197903 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300012955|Ga0164298_10516539 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10 | 802 | Open in IMG/M |
| 3300012960|Ga0164301_10415217 | Not Available | 946 | Open in IMG/M |
| 3300012971|Ga0126369_10596424 | Not Available | 1174 | Open in IMG/M |
| 3300012972|Ga0134077_10439776 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300014150|Ga0134081_10260915 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300014157|Ga0134078_10004438 | All Organisms → cellular organisms → Bacteria | 3813 | Open in IMG/M |
| 3300014164|Ga0181532_10538783 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300015051|Ga0137414_1016860 | All Organisms → cellular organisms → Bacteria | 1676 | Open in IMG/M |
| 3300015053|Ga0137405_1394175 | All Organisms → cellular organisms → Bacteria | 1824 | Open in IMG/M |
| 3300015082|Ga0167662_1011179 | Not Available | 1111 | Open in IMG/M |
| 3300015241|Ga0137418_10538772 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 927 | Open in IMG/M |
| 3300015242|Ga0137412_10735747 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300015264|Ga0137403_10078940 | All Organisms → cellular organisms → Bacteria | 3327 | Open in IMG/M |
| 3300016270|Ga0182036_11498921 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300016341|Ga0182035_10004866 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7429 | Open in IMG/M |
| 3300016387|Ga0182040_10468841 | Not Available | 1001 | Open in IMG/M |
| 3300016387|Ga0182040_10935740 | Not Available | 720 | Open in IMG/M |
| 3300016404|Ga0182037_11126598 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300016445|Ga0182038_10248204 | All Organisms → cellular organisms → Bacteria | 1429 | Open in IMG/M |
| 3300016750|Ga0181505_11184204 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 795 | Open in IMG/M |
| 3300017823|Ga0187818_10355933 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300017927|Ga0187824_10365372 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300017930|Ga0187825_10011662 | All Organisms → cellular organisms → Bacteria | 2941 | Open in IMG/M |
| 3300017933|Ga0187801_10040343 | All Organisms → cellular organisms → Bacteria | 1672 | Open in IMG/M |
| 3300017933|Ga0187801_10494128 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300017934|Ga0187803_10232954 | Not Available | 728 | Open in IMG/M |
| 3300017934|Ga0187803_10283607 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300017934|Ga0187803_10309561 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300017936|Ga0187821_10373531 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300017939|Ga0187775_10319974 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300017959|Ga0187779_11078564 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300017966|Ga0187776_10175302 | All Organisms → cellular organisms → Bacteria | 1334 | Open in IMG/M |
| 3300017972|Ga0187781_10385744 | Not Available | 999 | Open in IMG/M |
| 3300018018|Ga0187886_1200735 | Not Available | 769 | Open in IMG/M |
| 3300018019|Ga0187874_10141376 | Not Available | 1023 | Open in IMG/M |
| 3300018030|Ga0187869_10182650 | Not Available | 1031 | Open in IMG/M |
| 3300018057|Ga0187858_10665287 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300018058|Ga0187766_10242507 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
| 3300018058|Ga0187766_11298444 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300018064|Ga0187773_10198341 | Not Available | 1067 | Open in IMG/M |
| 3300019275|Ga0187798_1148374 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300019789|Ga0137408_1225324 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300019789|Ga0137408_1260930 | All Organisms → cellular organisms → Bacteria | 1542 | Open in IMG/M |
| 3300019886|Ga0193727_1078392 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1006 | Open in IMG/M |
| 3300020170|Ga0179594_10021952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1950 | Open in IMG/M |
| 3300020170|Ga0179594_10074442 | All Organisms → cellular organisms → Bacteria | 1188 | Open in IMG/M |
| 3300020199|Ga0179592_10231507 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 833 | Open in IMG/M |
| 3300020579|Ga0210407_10002607 | All Organisms → cellular organisms → Bacteria | 15361 | Open in IMG/M |
| 3300020579|Ga0210407_10401212 | Not Available | 1073 | Open in IMG/M |
| 3300020579|Ga0210407_10973942 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300020579|Ga0210407_11172328 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300020579|Ga0210407_11348370 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300020579|Ga0210407_11392356 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300020581|Ga0210399_10006899 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8887 | Open in IMG/M |
| 3300020581|Ga0210399_10055925 | All Organisms → cellular organisms → Bacteria | 3177 | Open in IMG/M |
| 3300020581|Ga0210399_10548300 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300021046|Ga0215015_10312037 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300021088|Ga0210404_10616143 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300021168|Ga0210406_10524075 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 934 | Open in IMG/M |
| 3300021168|Ga0210406_11229851 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300021170|Ga0210400_10974819 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 690 | Open in IMG/M |
| 3300021170|Ga0210400_11466773 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300021170|Ga0210400_11664002 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300021171|Ga0210405_10163047 | All Organisms → cellular organisms → Bacteria | 1765 | Open in IMG/M |
| 3300021171|Ga0210405_10284371 | All Organisms → cellular organisms → Bacteria | 1308 | Open in IMG/M |
| 3300021180|Ga0210396_11368611 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300021181|Ga0210388_10749173 | Not Available | 849 | Open in IMG/M |
| 3300021181|Ga0210388_11008973 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300021403|Ga0210397_10185737 | All Organisms → cellular organisms → Bacteria | 1477 | Open in IMG/M |
| 3300021403|Ga0210397_11054501 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300021403|Ga0210397_11121023 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300021404|Ga0210389_10940485 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300021405|Ga0210387_11600461 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300021406|Ga0210386_10621766 | Not Available | 932 | Open in IMG/M |
| 3300021406|Ga0210386_11617971 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300021406|Ga0210386_11727127 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300021407|Ga0210383_10771413 | Not Available | 824 | Open in IMG/M |
| 3300021433|Ga0210391_10962816 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300021433|Ga0210391_11352431 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300021475|Ga0210392_11366035 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300021476|Ga0187846_10260456 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300021559|Ga0210409_11006014 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 708 | Open in IMG/M |
| 3300021559|Ga0210409_11171076 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300021560|Ga0126371_11163567 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300022532|Ga0242655_10285262 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300023056|Ga0233357_1019323 | Not Available | 802 | Open in IMG/M |
| 3300024186|Ga0247688_1071700 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300024219|Ga0247665_1035868 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300024330|Ga0137417_1371473 | Not Available | 3718 | Open in IMG/M |
| 3300024330|Ga0137417_1452848 | All Organisms → cellular organisms → Bacteria | 4372 | Open in IMG/M |
| 3300024331|Ga0247668_1034636 | Not Available | 1034 | Open in IMG/M |
| 3300025448|Ga0208037_1029619 | Not Available | 1184 | Open in IMG/M |
| 3300025929|Ga0207664_11236480 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300025934|Ga0207686_11833688 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300025937|Ga0207669_11162711 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300025939|Ga0207665_10378623 | Not Available | 1074 | Open in IMG/M |
| 3300025986|Ga0207658_11463898 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300026088|Ga0207641_12542795 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300026214|Ga0209838_1015515 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1054 | Open in IMG/M |
| 3300026291|Ga0209890_10020354 | All Organisms → cellular organisms → Bacteria | 2594 | Open in IMG/M |
| 3300026294|Ga0209839_10137962 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 812 | Open in IMG/M |
| 3300026316|Ga0209155_1264843 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300026325|Ga0209152_10066649 | All Organisms → cellular organisms → Bacteria | 1295 | Open in IMG/M |
| 3300026330|Ga0209473_1322056 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300026332|Ga0209803_1209232 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300026334|Ga0209377_1210401 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300026356|Ga0257150_1028594 | Not Available | 797 | Open in IMG/M |
| 3300026475|Ga0257147_1015099 | Not Available | 1051 | Open in IMG/M |
| 3300026524|Ga0209690_1263426 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300026547|Ga0209156_10426214 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300026550|Ga0209474_10069066 | All Organisms → cellular organisms → Bacteria | 2461 | Open in IMG/M |
| 3300026551|Ga0209648_10419586 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300026890|Ga0207781_1014283 | Not Available | 824 | Open in IMG/M |
| 3300026928|Ga0207779_1033534 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300026932|Ga0207836_1032507 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300027011|Ga0207740_1025143 | Not Available | 757 | Open in IMG/M |
| 3300027045|Ga0207726_1044000 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300027070|Ga0208365_1014358 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300027371|Ga0209418_1040283 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 823 | Open in IMG/M |
| 3300027512|Ga0209179_1161494 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300027521|Ga0209524_1116901 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300027535|Ga0209734_1115871 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300027583|Ga0209527_1146664 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300027587|Ga0209220_1037249 | All Organisms → cellular organisms → Bacteria | 1303 | Open in IMG/M |
| 3300027660|Ga0209736_1019773 | All Organisms → cellular organisms → Bacteria | 2070 | Open in IMG/M |
| 3300027660|Ga0209736_1066177 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
| 3300027669|Ga0208981_1058840 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300027671|Ga0209588_1085421 | Not Available | 1018 | Open in IMG/M |
| 3300027671|Ga0209588_1169473 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300027692|Ga0209530_1045388 | All Organisms → cellular organisms → Bacteria | 1293 | Open in IMG/M |
| 3300027812|Ga0209656_10189226 | Not Available | 1005 | Open in IMG/M |
| 3300027825|Ga0209039_10150771 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
| 3300027846|Ga0209180_10525113 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300027875|Ga0209283_10487742 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300027882|Ga0209590_10933668 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300027884|Ga0209275_10086815 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1578 | Open in IMG/M |
| 3300027889|Ga0209380_10498526 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 710 | Open in IMG/M |
| 3300027898|Ga0209067_10249219 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
| 3300027903|Ga0209488_10590420 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 807 | Open in IMG/M |
| 3300027908|Ga0209006_10247739 | All Organisms → cellular organisms → Bacteria | 1533 | Open in IMG/M |
| 3300027915|Ga0209069_10372743 | Not Available | 776 | Open in IMG/M |
| 3300028759|Ga0302224_10123927 | Not Available | 1003 | Open in IMG/M |
| 3300028863|Ga0302218_10050696 | All Organisms → cellular organisms → Bacteria | 1304 | Open in IMG/M |
| 3300028906|Ga0308309_10810783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 813 | Open in IMG/M |
| 3300029943|Ga0311340_10310138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1498 | Open in IMG/M |
| 3300030520|Ga0311372_12092793 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300030940|Ga0265740_1005887 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1004 | Open in IMG/M |
| 3300031057|Ga0170834_106613834 | Not Available | 738 | Open in IMG/M |
| 3300031057|Ga0170834_108771236 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300031128|Ga0170823_11304639 | Not Available | 955 | Open in IMG/M |
| 3300031231|Ga0170824_119074273 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300031240|Ga0265320_10277686 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300031446|Ga0170820_12911350 | Not Available | 700 | Open in IMG/M |
| 3300031545|Ga0318541_10100664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1551 | Open in IMG/M |
| 3300031546|Ga0318538_10191836 | Not Available | 1089 | Open in IMG/M |
| 3300031640|Ga0318555_10281037 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300031680|Ga0318574_10481729 | Not Available | 727 | Open in IMG/M |
| 3300031708|Ga0310686_101424277 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 768 | Open in IMG/M |
| 3300031715|Ga0307476_10221097 | All Organisms → cellular organisms → Bacteria | 1378 | Open in IMG/M |
| 3300031715|Ga0307476_11363027 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300031715|Ga0307476_11433718 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300031719|Ga0306917_10629349 | Not Available | 844 | Open in IMG/M |
| 3300031720|Ga0307469_11013467 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300031753|Ga0307477_10717275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 668 | Open in IMG/M |
| 3300031753|Ga0307477_10997649 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300031754|Ga0307475_10795810 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300031770|Ga0318521_10282113 | Not Available | 975 | Open in IMG/M |
| 3300031823|Ga0307478_11484866 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300031833|Ga0310917_10231907 | Not Available | 1240 | Open in IMG/M |
| 3300031859|Ga0318527_10123303 | Not Available | 1076 | Open in IMG/M |
| 3300031890|Ga0306925_10146975 | All Organisms → cellular organisms → Bacteria | 2535 | Open in IMG/M |
| 3300031897|Ga0318520_10684263 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300031910|Ga0306923_11812484 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300031912|Ga0306921_12592488 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300031941|Ga0310912_11070898 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300031942|Ga0310916_10975646 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300031942|Ga0310916_11105506 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300031954|Ga0306926_10058559 | All Organisms → cellular organisms → Bacteria | 4628 | Open in IMG/M |
| 3300031962|Ga0307479_10897818 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300031962|Ga0307479_11257585 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300031962|Ga0307479_11292646 | Not Available | 691 | Open in IMG/M |
| 3300031981|Ga0318531_10115287 | Not Available | 1190 | Open in IMG/M |
| 3300032001|Ga0306922_11532736 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300032063|Ga0318504_10176958 | Not Available | 990 | Open in IMG/M |
| 3300032067|Ga0318524_10356145 | Not Available | 760 | Open in IMG/M |
| 3300032076|Ga0306924_11299385 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 781 | Open in IMG/M |
| 3300032076|Ga0306924_11849146 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300032089|Ga0318525_10533455 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300032090|Ga0318518_10317549 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300032094|Ga0318540_10433986 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300032160|Ga0311301_11772644 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300032180|Ga0307471_100722469 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
| 3300032205|Ga0307472_100354467 | Not Available | 1206 | Open in IMG/M |
| 3300032205|Ga0307472_101178984 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 730 | Open in IMG/M |
| 3300032261|Ga0306920_100983115 | All Organisms → cellular organisms → Bacteria | 1230 | Open in IMG/M |
| 3300032783|Ga0335079_10754111 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
| 3300032805|Ga0335078_11084297 | Not Available | 938 | Open in IMG/M |
| 3300032892|Ga0335081_11486515 | Not Available | 751 | Open in IMG/M |
| 3300032892|Ga0335081_11693416 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300032892|Ga0335081_12119078 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300032898|Ga0335072_10765216 | Not Available | 931 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 21.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.48% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.26% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.98% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.98% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.84% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.56% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.56% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.56% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.27% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.70% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.70% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.70% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.70% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.42% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.42% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.14% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.14% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.14% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.85% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.57% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.57% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.57% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.57% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.28% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.28% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.28% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.28% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.28% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.28% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.28% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.28% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.28% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.28% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.28% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.28% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.28% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001664 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - 5cm_reassembled | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003350 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 | Environmental | Open in IMG/M |
| 3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005950 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015082 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11c, vegetated hydrological feature) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300019275 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023056 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS2 | Environmental | Open in IMG/M |
| 3300024186 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK29 | Environmental | Open in IMG/M |
| 3300024219 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK06 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
| 3300025448 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026214 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 (SPAdes) | Environmental | Open in IMG/M |
| 3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026356 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-A | Environmental | Open in IMG/M |
| 3300026475 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-A | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026890 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 51 (SPAdes) | Environmental | Open in IMG/M |
| 3300026928 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 44 (SPAdes) | Environmental | Open in IMG/M |
| 3300026932 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 18 (SPAdes) | Environmental | Open in IMG/M |
| 3300027011 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 29 (SPAdes) | Environmental | Open in IMG/M |
| 3300027045 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027070 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes) | Environmental | Open in IMG/M |
| 3300027371 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027535 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027669 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027692 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300028863 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030940 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Host-Associated | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F14TC_1069078132 | 3300000559 | Soil | QRVPNLSPEQRAQMESLIDELLEKLLLDPARRLQGEKDLRRKIQKVEAIRDLFLPGREHT |
| JGI1027J12803_1043440831 | 3300000955 | Soil | RLRMESLMDELLEKLLLEPAQKLRGEKELRRKIQNVEALRDLFLSKREKP* |
| JGI10216J12902_1126733121 | 3300000956 | Soil | VLLDPARRLQGEKDLRRKIQQVEAIRDLFLPDRER* |
| JGI12635J15846_100377725 | 3300001593 | Forest Soil | QQMELLMGELLEKLLLEPAERLRGEKELRRKIQNVEALRDLFLSNRDKQ* |
| P5cmW16_10546931 | 3300001664 | Permafrost | KLLLEPAERLRGEKELRRKIQNVEALRDLFLSNREKP* |
| JGI12627J18819_100032098 | 3300001867 | Forest Soil | REHIGGLMDELIERLLLRPAERLRAEREHRKKIQSVEAIRDLFLSDREKP* |
| JGIcombinedJ26739_1010484912 | 3300002245 | Forest Soil | LEALVDELLESLVIGPAERMRSEKELRRKIRNAEALRDLFLPDREKP* |
| JGI26347J50199_10255912 | 3300003350 | Bog Forest Soil | LEKLLLAPAERLRGEKELRRKIQNVEALRDLFLSNREKP* |
| JGI26340J50214_101914692 | 3300003368 | Bog Forest Soil | LIEKLLIAPAERLRSEKELRKKILSVEAIRELYLSDREKP* |
| Ga0062385_109497471 | 3300004080 | Bog Forest Soil | SMVGDLLEKLLIEPAQQLRGERELRRKIQNVEALRDLFLSKDDKP* |
| Ga0062385_112161081 | 3300004080 | Bog Forest Soil | SMVGDLLEKLLIEPAQQLRGERELRRKIQNVEALRDLFLPKDDKP* |
| Ga0062387_1000543573 | 3300004091 | Bog Forest Soil | LLDKLLLEPAQRMRGEKELRRKIRNVEALRDLFLNNREKP* |
| Ga0066395_102082752 | 3300004633 | Tropical Forest Soil | EHMMDDLLEHLLIEPTQRLRGEKELRRKIQNLEAIRDLFLDRGEKP* |
| Ga0066395_104005681 | 3300004633 | Tropical Forest Soil | MMDELIDRLLIAPAERLRSEKELRKKIQSVEAIRALYLSEREKP* |
| Ga0062388_1005007861 | 3300004635 | Bog Forest Soil | DDHEKIASMMDELIERIMIEPAERMRSEKQLRRKIQNLEALRDLYLSDREKS* |
| Ga0062388_1008821691 | 3300004635 | Bog Forest Soil | DREHLIGLMDELIEQLLIAPAERLRSEKEFRKKIQNVEAIRDLFLSDREKP* |
| Ga0062594_1031063501 | 3300005093 | Soil | QMETLMDELLEKLLLDPARRLQGEKDLRRKIQNVEAIRDLFLPGRERP* |
| Ga0066674_100580542 | 3300005166 | Soil | LTEADRTLVEKLMDEILESLLLGPAQRLRGEKDLRRKVQSVEALRDLFLLNREKS* |
| Ga0066690_100084981 | 3300005177 | Soil | VEKLMDEMLEKLLLEPAERLRGEKELRRKIQNVEALRDLFLSNREKP* |
| Ga0066388_1029379682 | 3300005332 | Tropical Forest Soil | FVERLMDEMLEGLVLEPAQRLRGEKDLRRKIHNVEALRDLFLSNREKH* |
| Ga0070674_1001432661 | 3300005356 | Miscanthus Rhizosphere | LMDELLEKLLLDPARRLQGEKDLRRKIQNVEAIRDIFLPGRERP* |
| Ga0070685_100627724 | 3300005466 | Switchgrass Rhizosphere | METLMDELLEKCLLDPARRLQGEKDLRRKIQNVEAIRDLFLPGRERP* |
| Ga0070734_104471482 | 3300005533 | Surface Soil | DRAHVEALMDQLLERLLLEPAQRLRAEKQLRRKIQNVEVLRDIFLADREKP* |
| Ga0070697_1004258522 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | DEDRQKVAQLTEDLLERILLEPAERLRSERGLRRRLRGLEALRDLFGLDREKP* |
| Ga0070730_101373621 | 3300005537 | Surface Soil | IDELLEKMLLDPARRLQGEKDLRRKIQQVEAIRELFLPDRERP* |
| Ga0070733_104929732 | 3300005541 | Surface Soil | RERLELLMDELLEKLLVEPAERLRGEKELRRKIQNVEALRDLFLTRREKA* |
| Ga0070733_105642671 | 3300005541 | Surface Soil | MLEKFLVQPAERLRDERELRRKIQNVEALRDLFLSDREKR* |
| Ga0066701_107996341 | 3300005552 | Soil | LEPAERLRGEKELRRKIQNVEALRDLFLSEREKP* |
| Ga0066695_102049673 | 3300005553 | Soil | QVEKLMDEMLEKLLLEPAERLRGEKELRRKIQNVEALRDLFLSNREKP* |
| Ga0066661_108938542 | 3300005554 | Soil | LTETDRAHVERLMDEMLEKLLLEPAERLRGERELRRKIQNVEALRDVFLSNREKP* |
| Ga0066670_107566822 | 3300005560 | Soil | LDPARRLQGEKDLRRKIQQVEAIRELFLQDRDRS* |
| Ga0066705_104744682 | 3300005569 | Soil | LLLGPAQRLRGEKDLRRKVQSVEALRDLFLLNREKS* |
| Ga0066694_100902451 | 3300005574 | Soil | QVEKLMDEMLEKLLVGPAERLRGEKELRRKIQNVEALRDLFLSNREKP* |
| Ga0066708_100687581 | 3300005576 | Soil | DEMLEKLLLEPAERLRGEKELRRKIQNVEALRDLFLSYREKP* |
| Ga0066708_107289122 | 3300005576 | Soil | VSELTEEQRKQVEALIDDLLEKTLLDPARRLQGEKDLRRKIQQVEAIRELFLQDRDRS* |
| Ga0070761_101887323 | 3300005591 | Soil | LEKLLVQPAERLRGEKELRRKIQNVEALRDLFLSNREKP* |
| Ga0070762_101080743 | 3300005602 | Soil | LVQPAERLRDERELRRKIANVEALRDLFLSDREKR* |
| Ga0070762_101505081 | 3300005602 | Soil | ELLEKLLLEPAERLRGEKELRRKIQNVEALRDLFLSNREKT* |
| Ga0070762_111599931 | 3300005602 | Soil | LEKFLVQPAERLRDERELRRKIQNVEALRDLFLSDREKR* |
| Ga0066903_1023576461 | 3300005764 | Tropical Forest Soil | LEPARRLQAEKDLRRKIQSAEAIRDLFLPARERP* |
| Ga0066903_1063703411 | 3300005764 | Tropical Forest Soil | ILKILLLEPAERLRGEKDLRRKVQNVEALRDLFLAKRERS* |
| Ga0068860_1016280312 | 3300005843 | Switchgrass Rhizosphere | PEQRTQMETLMDELLEKLLLDPARRLQGEKDLRRKIQNVEAIRDLFLPGRERP* |
| Ga0070766_100406301 | 3300005921 | Soil | AERERMESMMDELLERLLLAPAERLRGEKELRRKIQNVEALRDLFLSNREKP* |
| Ga0066787_100288641 | 3300005950 | Soil | RERMEALMAELLEKLLLEPAERLRGEKELRRKIQNVEALRDLFLSNREKP* |
| Ga0066789_100052441 | 3300005994 | Soil | KDREHMEVLMDELLEKLLIEPAERLRGERELRRKIQNVEALRDLFLSDRDKR* |
| Ga0066790_103065292 | 3300005995 | Soil | ESIVSDLLEKLLIEPARQLRGERELRRKIQNVEALRDLFLSGKDKV* |
| Ga0070717_101409844 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | TLIDELLEKFLVQPAERLRDERELRRKIQNVEALRDLFLSDRNKR* |
| Ga0066696_105718762 | 3300006032 | Soil | DEMLEKLLLEPAERLRGERELRRKIQNVEALRDLFLSNREKP* |
| Ga0075024_1003059641 | 3300006047 | Watersheds | ADIRRIESLMDDLLEKLLLEPAERLRGERELRRKIQSVEALRDLFLRDKEKS* |
| Ga0075026_1004966381 | 3300006057 | Watersheds | EKIMIEPAERMRSEKQLRRKIQNLEALRDLYLSDKEKP* |
| Ga0075030_1009018932 | 3300006162 | Watersheds | EMLEKLILEPAQRLRGEKELRRKIQNVEAMRDLFLPKQEKH* |
| Ga0075018_103128532 | 3300006172 | Watersheds | LEPAQRLRGERELRRKIQNVEALRDLFLSNREKP* |
| Ga0075014_1001664922 | 3300006174 | Watersheds | MLEKVLLEPAQRLRGERELRRKIQNVEALRDLFLSNREKP* |
| Ga0070765_1000304365 | 3300006176 | Soil | ASMMDELIERIMIEPAERMRSEKQLRRKIQNLEALRDLYLTDREKP* |
| Ga0075021_105226942 | 3300006354 | Watersheds | LEKLLIAPTEKLRGEKELRRKIQNVEAVRDLFLDRREKP* |
| Ga0079222_106841482 | 3300006755 | Agricultural Soil | LEGLVLEPAQRLRGEKDLRRKIHNVEALRDLFLSNREKP* |
| Ga0079222_120889481 | 3300006755 | Agricultural Soil | ERLEGLMDELLEKLVVEPAERLRGEKELRRKIQNVEALRDLFLSRREKP* |
| Ga0066653_107634152 | 3300006791 | Soil | DRAHVERLMDEMLEKLLLEPAERLRGERELRRKIQNVEALRDVFLSNREKP* |
| Ga0066659_106365091 | 3300006797 | Soil | EMLEKLLLEPAERLRGEKELRRKIQNVEALRDLFLSNREKP* |
| Ga0066660_106619042 | 3300006800 | Soil | EKLLLEPAERLRGERELRRKIQNVEALRDLFLSNREKP* |
| Ga0079221_106930072 | 3300006804 | Agricultural Soil | LDGVNHLSPADRERLEGLMDELLEKLVVEPAERLRGEKEFRRKIQNVEALRDLFLSRREKP* |
| Ga0073928_111068112 | 3300006893 | Iron-Sulfur Acid Spring | VEPAERLRGERELRRKIQNVEALRDLFLSDRDKR* |
| Ga0075436_1009679381 | 3300006914 | Populus Rhizosphere | KLLLDPARRLQGEKDLRRKIQNVEAIRDLFLPGRERP* |
| Ga0079219_117715651 | 3300006954 | Agricultural Soil | ELLERLLLDPARRLQGEKDLRRKIQKVEAIRDLFLPDRERS* |
| Ga0075435_1001343941 | 3300007076 | Populus Rhizosphere | KMMDELLQGLLLEPAERLRGEKDLRRKIHNVEALRDLFLSNREKP* |
| Ga0075435_1007978731 | 3300007076 | Populus Rhizosphere | RQMEALMDELLERLLLDPARRLQGEKDLRRKIQKVEAIRDLFLPDRERS* |
| Ga0099791_103965471 | 3300007255 | Vadose Zone Soil | KLLVEPAQRLRGEKELRRKIQNVEALLDLFLPKKDKP* |
| Ga0099793_101677772 | 3300007258 | Vadose Zone Soil | VQPAERLRGEKELRRKIQNVEALRDLFLSKKDKP* |
| Ga0099794_101507173 | 3300007265 | Vadose Zone Soil | VEKLMDEMLEKLLLEPAERLRGEKQLRRKIQNVEALRDLFLSNREKP* |
| Ga0099794_104146872 | 3300007265 | Vadose Zone Soil | LSEPDRLRMEGLMDELLEKLLLEPAQKLRGEKELRRKIQNVEALRDLFLSKRDKP* |
| Ga0099830_113382991 | 3300009088 | Vadose Zone Soil | MDEMLEKLLLEPAQRLRGEKELRRKIQNVEALRDLFLSNREKP* |
| Ga0099828_100885601 | 3300009089 | Vadose Zone Soil | RHIETLMDDLLEKLLLEPAERLRGERELRRKIQSVEALRDLFLRDREKP* |
| Ga0099828_100902764 | 3300009089 | Vadose Zone Soil | LLLGPAERLRGEKELRRKIQNVEALRDLFLSNRAKP* |
| Ga0099828_102571581 | 3300009089 | Vadose Zone Soil | KLMDEMLEKLLLEPAERLRGEKELRRKIQNVEALRDLFLSNREKP* |
| Ga0099828_110931861 | 3300009089 | Vadose Zone Soil | RERMETLMDELLEKLLVQPAVRLRGEKELRRKIQNVEALRDLFLSKKDKP* |
| Ga0105245_130039911 | 3300009098 | Miscanthus Rhizosphere | DQDRVEILMDELLDKLLVEPAERLRGERELRRKIQNVEALRDLFLSGREKS* |
| Ga0066709_1000851155 | 3300009137 | Grasslands Soil | EVLMEELLEKLLLEPAEHLRGERHLRRKIQNVEALRDLFLPRREKP* |
| Ga0105242_101627713 | 3300009176 | Miscanthus Rhizosphere | GQRAQMETLMDELLEKLLLDPARRLQGEKDLRRKIQNVEAIRDIFLPGRERP* |
| Ga0126374_101175053 | 3300009792 | Tropical Forest Soil | IEQLVLHPAESLRTEKELRRKIQNVEAIRDLYLSHREKS* |
| Ga0126374_110658362 | 3300009792 | Tropical Forest Soil | LLIEPTQRLRGEKELRRKIQNLEAIRDLFLDRGEKP* |
| Ga0126380_114597191 | 3300010043 | Tropical Forest Soil | EQRERMESLMDELLERLLLDPARRLQGEKDLRRKIQNVEAIRELFLSGRERA* |
| Ga0126384_109575661 | 3300010046 | Tropical Forest Soil | ELLLLEPAQRLRGERDLRRKIQSVEALRDLFLSNREKS* |
| Ga0126384_114777052 | 3300010046 | Tropical Forest Soil | ELLDKLLVEPAERLRGERELRRKLQNVEALRDLFLSNREKS* |
| Ga0126382_112569912 | 3300010047 | Tropical Forest Soil | LEKLLLEPARRLQGEKDLRRKIQNVEAIRDLFLPGRERR* |
| Ga0126373_124682751 | 3300010048 | Tropical Forest Soil | RAHVERLMDEMLESLVLEPAQRLRGERDLRRKIQNVEALRDLFLSNREKS* |
| Ga0126373_127266652 | 3300010048 | Tropical Forest Soil | LLDPARRLQGEKDLRRKIQQVEAIRELFLPDRER* |
| Ga0099796_100469391 | 3300010159 | Vadose Zone Soil | MDELLEKLLVEPAERLRGEKELRRKIQNVEALRDLFLSKKDKS* |
| Ga0134088_104891291 | 3300010304 | Grasslands Soil | ESLLLGPAQRLRGEKDLRRKVQSVEALRDLFLLNREKS* |
| Ga0134109_101514432 | 3300010320 | Grasslands Soil | LTSADRAHVEKLMDEMLESLLLEPAQRLRGEKDLRRKIHNVEALRDLFLSNREKP* |
| Ga0134111_101729142 | 3300010329 | Grasslands Soil | DELLESLLLEPAQRLRGEKDLRRKIHNVEALRDLFLSNREKP* |
| Ga0126370_110261701 | 3300010358 | Tropical Forest Soil | VEKLMDELLEGLLLEPAQRLRGEKDLRRKVQNVEALRDLFLSNREKP* |
| Ga0126376_108866091 | 3300010359 | Tropical Forest Soil | EADRTLVETLMDEILESLLLEPARRLRGEKDLRRKVQNVEALRDLFLSNRKKP* |
| Ga0126376_117497401 | 3300010359 | Tropical Forest Soil | LMDELLEKLLVEPAERLRGERELRRKLQNVEALRDLFLSDREKS* |
| Ga0126372_111223431 | 3300010360 | Tropical Forest Soil | ILESLLLEPARRLRGEKDLRRKVQNVEALRDLFLSNREKP* |
| Ga0126372_112218702 | 3300010360 | Tropical Forest Soil | MDELIEHLLLYSAERLRTEKELRRKIQNVEAIRDLYLSNREKP* |
| Ga0126372_121223772 | 3300010360 | Tropical Forest Soil | ERLLLDPARRLQGEKDLRRKIQNVEAIRELFLSGRERA* |
| Ga0126372_123894061 | 3300010360 | Tropical Forest Soil | ASVEKLMDELLEGLLLEPAQRLRGEKDLRRKIHNVEALRDLFLSNRGKP* |
| Ga0126377_122888561 | 3300010362 | Tropical Forest Soil | QRSQMETLIDELLEKMLLDPAKRLQGEKDLRRKIQQVEAIRELFLPDRERP* |
| Ga0126377_131039731 | 3300010362 | Tropical Forest Soil | RAQMETLMDELLEKCLLDPARRLQGEKNLRRKIQNVEAIRDLFLPGRERP* |
| Ga0126379_104637661 | 3300010366 | Tropical Forest Soil | EQLLLHPAERLRTEKELRRKIQNVEAIRDLYLSHREKP* |
| Ga0126381_1008326631 | 3300010376 | Tropical Forest Soil | KLMDELLEGLLLEPAQRLRGEKDLRRKVQNVEALRDLFLSNREKP* |
| Ga0126381_1018133282 | 3300010376 | Tropical Forest Soil | KYSAEDREHLGELMDELIEQVLIAPAERLRAEKEFRKKIQSVEAIRELYLSDKENL* |
| Ga0137392_103755931 | 3300011269 | Vadose Zone Soil | LHPAERLRTEKELRRKIQNVEAIRDLYLSDREKP* |
| Ga0137391_100782414 | 3300011270 | Vadose Zone Soil | MDDLLKKLLLEPAERLRGERELRRKIQNVEALRDLFLRDGEKL* |
| Ga0137391_102042563 | 3300011270 | Vadose Zone Soil | LLGPAERLRGEKELRRKIQNVEALRDLFLSNREKP* |
| Ga0137391_104096301 | 3300011270 | Vadose Zone Soil | LLEKLLVQPAERLRGEKELRRKIQNVEALRDLFLSKKDKP* |
| Ga0137393_103793783 | 3300011271 | Vadose Zone Soil | LIDDLLEKMLLDPTRRLQGEKDLRRKIQQVEAIRELFLRDRKR* |
| Ga0137393_108531681 | 3300011271 | Vadose Zone Soil | LLEKLLVQPAERLRGEKELRRKIQNLEALRDLFLSKKDKP* |
| Ga0137393_111338542 | 3300011271 | Vadose Zone Soil | EKLLVQPAERLRGEKELRRKIQNVEALRDLFLSKEDKP* |
| Ga0137393_117319912 | 3300011271 | Vadose Zone Soil | ERIGLLMDELIDHLLLHPAERLRTEKELRRKIQNVEAIRDLYLSDREKS* |
| Ga0137389_100371485 | 3300012096 | Vadose Zone Soil | EKLMDEMLEKLLLEPAERLRGEKELRRKIQNVEALRDLFLLNREKP* |
| Ga0137389_103934923 | 3300012096 | Vadose Zone Soil | LLLEPAQRLRGEKDLRRKIQNVEALRDLFLSNREKP* |
| Ga0137389_106688981 | 3300012096 | Vadose Zone Soil | DRLRMENLVDELLEKLLLEPAQKLRGEKELRRKIQNVEALRDLFLSKRDKP* |
| Ga0137382_105142562 | 3300012200 | Vadose Zone Soil | VETIIDQLLEKMLLDPARRLQGEKDLRRKIQQVEAIRALFLPDRERP* |
| Ga0137363_112288672 | 3300012202 | Vadose Zone Soil | LMDELLEKLLVEPAERLRGEKELRRKIQNVEALRDLFLSKKDKS* |
| Ga0137363_112533702 | 3300012202 | Vadose Zone Soil | DELLEKLLLAPEQKLRGEKELRRQRQNVEALRDLFLSRREKP* |
| Ga0137399_101500543 | 3300012203 | Vadose Zone Soil | LEKLLLEPAQRLRGEKELRRKIQNVEALRDLFLSNREKP* |
| Ga0137362_105777781 | 3300012205 | Vadose Zone Soil | LMDELLEKLLVEPAERLRGEKELRRKIQNVEALRDLFLSKKDKP* |
| Ga0137362_112080601 | 3300012205 | Vadose Zone Soil | LLEKLLLEPAERLRREKELRRKIQNVEALRDLFLSEREKP* |
| Ga0137380_115954981 | 3300012206 | Vadose Zone Soil | SLLLGPAQRLRGEKDLRRKVQNVEALRDLFLSNREKS* |
| Ga0137381_114542891 | 3300012207 | Vadose Zone Soil | AHVEKMMDEMLEKLLLEPAQRLRGEKELRRKIQNVEALRDLFLSNREKR* |
| Ga0137376_101614041 | 3300012208 | Vadose Zone Soil | QHLTSADRAHVEKLMDEMLESLLLEPAQRLRGEKDLRRKIHNVEALRDLFLSNREKP* |
| Ga0137379_101526651 | 3300012209 | Vadose Zone Soil | LLLEPAERLRSEKQLRRKIQNVEALRDLFLSNREKP* |
| Ga0137379_101830551 | 3300012209 | Vadose Zone Soil | GLVLEPAQRLRGENDLRRKIHNVEALRDLFLRNREKP* |
| Ga0137372_100148419 | 3300012350 | Vadose Zone Soil | MEKLTDDLLEKLLLEPAERLRGEKELRRKIQNVEALRDLFLSEREKP* |
| Ga0137386_102431011 | 3300012351 | Vadose Zone Soil | HVEKLMDEMLEKLLLEPAERLRGEKELRRKIQNVEALRDLFLSNREKR* |
| Ga0137371_101618853 | 3300012356 | Vadose Zone Soil | LEKLLLEPAERLRGEKELRRKIQNVEALRDLFLSEREKP* |
| Ga0137360_117142812 | 3300012361 | Vadose Zone Soil | VETLMDELLEKLLVEPAVRLRGEKELRRKIQNVEALRDLFLPGKDKL* |
| Ga0137361_107165612 | 3300012362 | Vadose Zone Soil | LRMEGLMDELLEKLLLEPAQKLRGEKELRRKIQNVEALRDLFLSKREKP* |
| Ga0137390_108189862 | 3300012363 | Vadose Zone Soil | EADRAYVEQLMDEMLESLLLEPAQRLRGEKDLRRKIQNVEALRDLFLSNREKP* |
| Ga0137390_119310362 | 3300012363 | Vadose Zone Soil | EKLLVEPAERLRGEKELRRKIQNVEALRDLFLSKRDKP* |
| Ga0137358_102008711 | 3300012582 | Vadose Zone Soil | LLLEPAQKLRGEKELRRKIQNVEALRDLFLSRREKP* |
| Ga0137358_102661831 | 3300012582 | Vadose Zone Soil | VEPAERLRGEKELRRKIQNVEALRDLFLSKKDKS* |
| Ga0137358_105530801 | 3300012582 | Vadose Zone Soil | LLEKLLVEPAERLRGEKELRRKIQNVEALRDLFLSKKGKS* |
| Ga0137358_106887211 | 3300012582 | Vadose Zone Soil | RMESLMDELLEKLLLEPAQKLRGEKELRRKIQNVEALRDLFLPRREKP* |
| Ga0137398_110506501 | 3300012683 | Vadose Zone Soil | MEALMDELLEKLLVEPAERLRGEKELRRKIQNVEALRDLFLSKKDKP* |
| Ga0137394_104556131 | 3300012922 | Vadose Zone Soil | VEAIIDQLLEKMLLDPARRLQGEKDLRRKIQQVEAIRELFLPDRERP* |
| Ga0137394_109737182 | 3300012922 | Vadose Zone Soil | LLLHPAERLRTEKELRRKIQNVEAIRDLYLSDREKP* |
| Ga0137359_101941163 | 3300012923 | Vadose Zone Soil | RMESLMDELLEKLLLEPAQKLRGEKELRRKIQNVEALRDLFLSKRDKP* |
| Ga0137359_110215341 | 3300012923 | Vadose Zone Soil | ELIEKTLLEPARRLQGEKDVRRKIQQVEAIRELFLPDRDRS* |
| Ga0137359_115863201 | 3300012923 | Vadose Zone Soil | EKLLLEPAQRLRGEKELRRKIQNVEALRDLFLSSREKP* |
| Ga0137413_101295131 | 3300012924 | Vadose Zone Soil | LMDELIEQLLLHPAERLRTEKELRRKIQNVEAIRDLYLSDREKP* |
| Ga0137419_103594011 | 3300012925 | Vadose Zone Soil | HVEKLMDEMLEKLLLEPAERLRGEKELRRKIQNVEALRDLFLSNREKP* |
| Ga0137419_109233622 | 3300012925 | Vadose Zone Soil | EKLLLEPAQKLRGEKELRRKIQNVEALRDLFLSKREKP* |
| Ga0137419_118758842 | 3300012925 | Vadose Zone Soil | TPQQREQVESLIDDLLEKMLLDPTRRLQGEKDLRHKIQQVEAIRGLFLSDRKR* |
| Ga0137416_100545111 | 3300012927 | Vadose Zone Soil | MLEKLLLEPAERLRGEKELRRKIQNVEALRDLFLSNREKP* |
| Ga0137404_111065241 | 3300012929 | Vadose Zone Soil | SEQREQVETIIDQLLEKMLLDPARRLQGEKDLRRKIQQVEAIRELFLPDRERP* |
| Ga0137404_111916631 | 3300012929 | Vadose Zone Soil | KLMDEMLEKLLLEPAQRLRGERELRRKIQNVEALRDLFLSNREKP* |
| Ga0137404_112260142 | 3300012929 | Vadose Zone Soil | DELLEKLLLEPAQKLRGEKELRRKIQNVEALRDLFLSRREKP* |
| Ga0137407_123996112 | 3300012930 | Vadose Zone Soil | MDELLEKLLLEPAQKLCGEKELRRKVQNVEALRDLFLSKREKP* |
| Ga0126375_111979032 | 3300012948 | Tropical Forest Soil | EQRAQMETLMDELLEKLLLDPARRLQGEKDLRRKIQNVEAIRDLFLPGRERP* |
| Ga0164298_105165392 | 3300012955 | Soil | LLDPARRLQGEKDLRRKIQQVEAIRELFLPDRERP* |
| Ga0164301_104152171 | 3300012960 | Soil | MLLDPARRLQGEKDLRRKIQQVEAIRDLFLPDRER* |
| Ga0126369_105964242 | 3300012971 | Tropical Forest Soil | IDELLEQLLVQPAERLRGERELRRKIQNVEALRDLFLSPREKS* |
| Ga0134077_104397762 | 3300012972 | Grasslands Soil | MLLDPARRLQGEKDLRRKIQQVEAIRELFLPNRERP* |
| Ga0134081_102609151 | 3300014150 | Grasslands Soil | EKMLLEPAERLRGEKELRRKIQNVEALRDLFLSNREKP* |
| Ga0134078_100044381 | 3300014157 | Grasslands Soil | EKLLLEPAERLRGEKELRRKIQNVEALRDLFLSYREKP* |
| Ga0181532_105387831 | 3300014164 | Bog | QIGNMMDELIEQLLIVPAERLRSEKEHRRKIQNIEALRDLYLSDREKP* |
| Ga0137414_10168603 | 3300015051 | Vadose Zone Soil | KMELLMDELLEKLLMRPAEKLRGEKSLRKKIQNVDALRDLFLKDREKP* |
| Ga0137405_13941755 | 3300015053 | Vadose Zone Soil | TETDRLRMESLMDELLEKLLLEPAQKLRGEKELRRKIQNVEVLRDLFLSRREKS* |
| Ga0167662_10111792 | 3300015082 | Glacier Forefield Soil | MKHLSADDRARMESLMGELLEKLLLEPAERLRGEKELRRKIQNVEALRDLFLSNREKS* |
| Ga0137418_105387722 | 3300015241 | Vadose Zone Soil | MDELLEKLLVEPAERLRGERELRRKIQNVEALRDLFLSKKDKP* |
| Ga0137412_107357471 | 3300015242 | Vadose Zone Soil | VETLMDELLEKLLVEPAERLRGEKELRRKIQNVEALRDLFLRHREKP* |
| Ga0137403_100789401 | 3300015264 | Vadose Zone Soil | DLLEKMLLDPARRLQGEKDLRRKIQQVEAIRELFLPDREHQR* |
| Ga0182036_114989211 | 3300016270 | Soil | LIDELLERLMLQPACRLQSEKDLRRKIQSVEAIRDLFLPGRERL |
| Ga0182035_100048668 | 3300016341 | Soil | QVESLMDELLEKLLLDPARRLQGEKDLRRKIQNVEAIRDLFLPGKERRQ |
| Ga0182040_104688412 | 3300016387 | Soil | ESLMDELLEKLLLDPARRLQGEKDLRRKIQNVEAIRDLFLPGKERRQ |
| Ga0182040_109357401 | 3300016387 | Soil | LLIEPAERLRSEKEFRKKIQSVDALRDLYLSDEDKS |
| Ga0182037_111265981 | 3300016404 | Soil | REHIAALMDELIEKLLIVPAERLRADKELRRKIQSVEAIRALYLSDREKP |
| Ga0182038_102482043 | 3300016445 | Soil | GALMDELIERLLIAPAEHLRSEKELRKKIQNVEAIRDLYLNNREKH |
| Ga0181505_111842041 | 3300016750 | Peatland | ERLLIAPAERLRAEKEFRKKIQSVEAIRDLYLSDREKP |
| Ga0187818_103559331 | 3300017823 | Freshwater Sediment | HLGKLMDELIEQVLIAPAERLRAEKEFRKKIQSVEAIRELYLSDKEKL |
| Ga0187824_103653722 | 3300017927 | Freshwater Sediment | MDELVEKLLIAPAERLRAQKEFRKKIQSVEAIRDLYLSDREKP |
| Ga0187825_100116621 | 3300017930 | Freshwater Sediment | LLLEPARRLQSEKDLRRKIQNVEAVRDLFLPDRERP |
| Ga0187801_100403433 | 3300017933 | Freshwater Sediment | LMDEMLEKLLLEPAQRLRSEKELRRKIHNVEALRDMFLRHEEKP |
| Ga0187801_104941281 | 3300017933 | Freshwater Sediment | ELIEHLVIAPAERLRAEKELRKKIQSVEAIRALYLSDREKP |
| Ga0187803_102329541 | 3300017934 | Freshwater Sediment | LIAPAERLRAEKELRKKIQNVEAIRELYLSDREKP |
| Ga0187803_102836071 | 3300017934 | Freshwater Sediment | KLLISPAERLRSEKALRKKIQNVEAIRSLYLSDREKP |
| Ga0187803_103095612 | 3300017934 | Freshwater Sediment | MDELIERLLIAPAERLRMEKELRKKIQSLEAIRDLYLSDREKP |
| Ga0187821_103735311 | 3300017936 | Freshwater Sediment | LLVGPAERLRGEKELRRKIQNVEALRDLFLSHGGKP |
| Ga0187775_103199742 | 3300017939 | Tropical Peatland | EIGKLMDELIEKLVIAPAERLRMEKELRKKIQSVEAIRDLYLSDREIP |
| Ga0187779_110785641 | 3300017959 | Tropical Peatland | ELIEKLLIAPAERLRMEKELRKKIQSVEAIRALYLSDREKP |
| Ga0187776_101753021 | 3300017966 | Tropical Peatland | RAQVEKLMDDMLERLVLEPAQRLRGEKDLRRKVQNVEALRDLFLPNREKP |
| Ga0187781_103857441 | 3300017972 | Tropical Peatland | SALMDELVEKLLIAPAERLRAEKELRKKIQNVEAIRELYLSDREKP |
| Ga0187886_12007352 | 3300018018 | Peatland | ALMDELVEKLLIAPAERLRAEKELRKKIQNVEAIRELYLSDREKP |
| Ga0187874_101413762 | 3300018019 | Peatland | LVLGRAERVRNERELRRKIQNLEALRDIFGLPREKP |
| Ga0187869_101826502 | 3300018030 | Peatland | DREHIGVLMDELIEKLLIAPAERLRAEKELRKKIQNVEAIRELYLSDREKP |
| Ga0187858_106652871 | 3300018057 | Peatland | VLMDELLGKLLVEPAERLRGERELRRKIQNVEALRDLFLSDRDKR |
| Ga0187766_102425071 | 3300018058 | Tropical Peatland | DRVQVEKLMDDMLESLVLEPAQRLRGEKDLRRKVQNVEALRDLFLPNREKS |
| Ga0187766_112984442 | 3300018058 | Tropical Peatland | YSAEDREHLGKLMDELIEQLLIAPAERLRAEKEFRKKIQSVEAIRELYLSDKEKL |
| Ga0187773_101983412 | 3300018064 | Tropical Peatland | ADARARFENMMDDLLERLLIEPAQRLRGEKELRRKIQNLEAIRDLFLDRGEKP |
| Ga0187798_11483741 | 3300019275 | Peatland | REHIGALMDELVEKLLIAPAERLRAEKELRKKIQNVEAIRDLYLPDREKP |
| Ga0137408_12253241 | 3300019789 | Vadose Zone Soil | RMESLMDELLEKLLLEPAQKLRGEKELRRKIQNVEALRDLFLSKRDKP |
| Ga0137408_12609301 | 3300019789 | Vadose Zone Soil | LEKVLLEPPAQRLRGEKELRRKIQNVEALRDLFLLNREKP |
| Ga0193727_10783922 | 3300019886 | Soil | VESLIDDLLEKMLLDPARRLQGEKDLRRKIQQVEAIRGLFLPDRKR |
| Ga0179594_100219524 | 3300020170 | Vadose Zone Soil | LVEPAERLRGERELRRKIQNVEALRDLFLSDRDKR |
| Ga0179594_100744423 | 3300020170 | Vadose Zone Soil | MDELLEKLLLEPARKLRGEKELRRKIQNVEALRDLFLSKRDKP |
| Ga0179592_102315071 | 3300020199 | Vadose Zone Soil | AELWMDELLEKLLIAPAERLRGEKELRRKIQNAEAIRDLFLDRREKS |
| Ga0210407_1000260716 | 3300020579 | Soil | ELLEKLLLEPAQRLRGEKELRRKIQNVEALRALFLANREKP |
| Ga0210407_104012122 | 3300020579 | Soil | LMDELLEKLLVEPAQRLRGERELRRKIQNVEALRDLFLSNREKP |
| Ga0210407_109739422 | 3300020579 | Soil | LIDELLEKLLIEPAERLRGEKELRRKIQNVEALRDLFLDGRGKP |
| Ga0210407_111723281 | 3300020579 | Soil | IGKLMDELIEHLLLHPAERLRTERELRRKIQNVEAIRDLYLSDREKP |
| Ga0210407_113483702 | 3300020579 | Soil | DELLEKLLVEPAERLRGEKELRRKIQNVEALRDLFLSKKDKR |
| Ga0210407_113923561 | 3300020579 | Soil | EDRDKVEGIVSDLLEKLLIEPAQQLRGERELRRKIQNVESLRDLFLHGKDQR |
| Ga0210399_100068991 | 3300020581 | Soil | ISTMMDELIERIMIEPAERMRSEKQLRRKIQNLEALRDLYLSDREKP |
| Ga0210399_100559251 | 3300020581 | Soil | EADQARMEVLMDELLEKLLLEPAQRLRGEKELRRKIQNVEALRDLFLSNREKP |
| Ga0210399_105483002 | 3300020581 | Soil | LEKLLLEPAQRLRGEKELRRKIQNVEALRDLFLSNREKP |
| Ga0215015_103120372 | 3300021046 | Soil | RQRQMCIRDSLAAADIRRIESLMDDLLEKLLLEPAERLRGERELRRKIQSVEALRDLFLRDKEKP |
| Ga0210404_106161432 | 3300021088 | Soil | HVENLMDELLEKLLVEPATRLRGEKELRRKIQNVEALRDLFLSNKDKP |
| Ga0210406_105240752 | 3300021168 | Soil | MVEELVENLLMSPAERLRGEKEHRRKIQNIEALRDLFLSDREKP |
| Ga0210406_112298511 | 3300021168 | Soil | SMMDELLEKLLLEPAERLRGEKELRRKIQNVEALRDLFLSNREKP |
| Ga0210400_109748192 | 3300021170 | Soil | ERVETLMDELLEKLLVAPAERLRGEKELRRKIQNVEALRDLFLSKKDKP |
| Ga0210400_114667732 | 3300021170 | Soil | MGELLEKLLLEPAERLRGEKELRRKIQNVEALRDLFLSNREKQ |
| Ga0210400_116640022 | 3300021170 | Soil | NEADQARMEVLMDELLEKLLLEPAQRLRGEKELRRKIQNVEALRDLFLSNREKP |
| Ga0210405_101630473 | 3300021171 | Soil | RAQVEKLMDEMLEKLLLEPAQRLRGEKELRRKIQNVEALRDLFLSNREKP |
| Ga0210405_102843713 | 3300021171 | Soil | MDDLLEKLLLQPAERLRGERELRRKIQSVEALRDLFLHDKEKP |
| Ga0210396_113686111 | 3300021180 | Soil | EHLLLHPAERLRTEKELRRKIQNVEAIRDLYLSDREKP |
| Ga0210388_107491731 | 3300021181 | Soil | EQIGNMMDELIEQLLILPAERLRAEKEHRRKIQNVEALRDLYLDREKL |
| Ga0210388_110089731 | 3300021181 | Soil | EHLGLLMDELIEKLLIAPAERLRAEKEFRKKIQSLEAIRELYLSDKERM |
| Ga0210397_101857371 | 3300021403 | Soil | LEKLLVEPAERLRGERELRRKIQNVEALRDLFLSDRDKR |
| Ga0210397_110545011 | 3300021403 | Soil | EGLMDEMLEKLLLKPAEQLRGEKELRRKIQNVEALRDLFLSNREKP |
| Ga0210397_111210231 | 3300021403 | Soil | GLMDELLEKLLLEPAQRLRGEKELRRKIQNVEALRALFLANREKP |
| Ga0210389_109404851 | 3300021404 | Soil | EKFLVQPAERLRDERELRRKIQNVEALRDLFLSDRDKR |
| Ga0210387_116004612 | 3300021405 | Soil | EFMMDDLLEKLLLEPAQRLRGEKELRRKIQNVEALRDLFLSNREKP |
| Ga0210386_106217662 | 3300021406 | Soil | LMDELLEKLLVEPAERLRGERELRRKIQNVEALRDLFLSDRDKR |
| Ga0210386_116179711 | 3300021406 | Soil | MDELIERLLISPAERLRAEKEFRKKIQSVEAIRELYLSDKEKP |
| Ga0210386_117271271 | 3300021406 | Soil | ADDRQQMETLMGELLEKLLLEPAERLRGEKELRRKIQNVEALRDLFLSNREKQ |
| Ga0210383_107714132 | 3300021407 | Soil | LLEKLLLEPAERLRGEKELRRKIQNVEALRDLFLSNREKP |
| Ga0210391_109628161 | 3300021433 | Soil | WERMESMMDELLEKLLLEPAERLRGEKELRRKIQNVEALRDLFLSNREKP |
| Ga0210391_113524312 | 3300021433 | Soil | YHEKIATMMDELIERIMIEPAERMRSEKQLRRKIQNLEALRDLYLSDREKP |
| Ga0210392_113660351 | 3300021475 | Soil | KLLVEPAQRLRGERELRRKIQNVEALRDLFLSNREKP |
| Ga0187846_102604561 | 3300021476 | Biofilm | EKLLLEPAQRLRGEKELRRKIQNVEALRDLFLSNRERP |
| Ga0210409_110060142 | 3300021559 | Soil | ELLEKLLVEPAVRLRGEKELRRKIQNVEALRDLFLPGKDKP |
| Ga0210409_111710762 | 3300021559 | Soil | LLHPAERLRTEKELRRKIQNVEAIRDLYLSNREKP |
| Ga0126371_111635671 | 3300021560 | Tropical Forest Soil | LLLEPARRLRGEKDLRRKVQNVEALRDLFLSNREKP |
| Ga0242655_102852622 | 3300022532 | Soil | FLQPAERLRGEKELRRKIQNVEALRDLFLPNREKP |
| Ga0233357_10193232 | 3300023056 | Soil | LMGELLEKLLLEPAERLRGEKELRRKIQNVEALRDLFLSNREKQ |
| Ga0247688_10717002 | 3300024186 | Soil | LMDELIEQLLLHPAERLRTEKELRRKIQNVEAIRDLYLSNREKP |
| Ga0247665_10358682 | 3300024219 | Soil | LLLDPARRLQGEKDLRRKIQNVEAIRDLFLPGRERS |
| Ga0137417_13714735 | 3300024330 | Vadose Zone Soil | MDELLEKLLVEPATRLRGEKELRRKIQNVEALRDLFLSKKDKA |
| Ga0137417_14528486 | 3300024330 | Vadose Zone Soil | MLEKLLLGPAERLRGEKELRRKIQNVEALRDLFLSNGEKP |
| Ga0247668_10346362 | 3300024331 | Soil | LLEKVLLDPARRLQGERDLRRKIQQVEAIRDLFLPDRERR |
| Ga0208037_10296193 | 3300025448 | Peatland | KLLIAPAERLRAEKELRKKIQNVEAIRELYLSDREKP |
| Ga0207664_112364802 | 3300025929 | Agricultural Soil | LMDELLEKLLVEPATRLRGEKELRRKIQNVEALRDLFLSKKDKP |
| Ga0207686_118336881 | 3300025934 | Miscanthus Rhizosphere | RVEILMDELLDKLLVEPAERLRGERELRRKIQNVEALRDLFLSGREKS |
| Ga0207669_111627111 | 3300025937 | Miscanthus Rhizosphere | TLMDELLEKLLLDPARRLQGEKDLRRKIQNVEAIRDIFLPGRERP |
| Ga0207665_103786233 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MLDPARRLQGEKDLRRKIQQVEAIRELFLPDRERP |
| Ga0207658_114638982 | 3300025986 | Switchgrass Rhizosphere | METLMDELLEKLLLDRARRLQGEKDLRRKIQNVEAIRDIFLPGRERP |
| Ga0207641_125427951 | 3300026088 | Switchgrass Rhizosphere | ELLEKCLLDPARRLQGEKDLRRKIQNVEAIRDLFLPGRERP |
| Ga0209838_10155151 | 3300026214 | Soil | RERMEALMAELLEKLLLEPAERLRGEKELRRKIQNVEALRDLFLSNREKP |
| Ga0209890_100203544 | 3300026291 | Soil | KDREHMEVLMDELLEKLLIEPAERLRGERELRRKIQNVEALRDLFLSDRDKR |
| Ga0209839_101379622 | 3300026294 | Soil | KVESIVSDLLEKLLIEPARQLRGERELRRKIQNVEALRDLFLSGKDKV |
| Ga0209155_12648431 | 3300026316 | Soil | QVEQLMDEMLEKLLLEPAERLRGEKELRRKIQNVEALRDLFLSNREKP |
| Ga0209152_100666493 | 3300026325 | Soil | VERLMDEMLEKLLLEPAERLRGERELRRKIQNVEALRDVFLSNREKP |
| Ga0209473_13220561 | 3300026330 | Soil | ILESLLLGPAQRLRGEKDLRRKVQSVEALRDLFLLNREKS |
| Ga0209803_12092322 | 3300026332 | Soil | SAEDRQRIEVLMEELLEKLLLEPAEHLRGERHLRRKIQNVEALRDLFLPQREKP |
| Ga0209377_12104011 | 3300026334 | Soil | ETDRAHVEKLMDEMLEKLLLEPAERLRGERELRRKIQNVEALRDLFLSNREKP |
| Ga0257150_10285941 | 3300026356 | Soil | QVESLIDDLLEKMLLDPTRRLQGEKDLRRKIQQVEAISELFLRERKR |
| Ga0257147_10150992 | 3300026475 | Soil | TPEQREQIESLIDDLLEKILLDPARRLQGEKDLRRKIQQVEAIRQLFLPDRGH |
| Ga0209690_12634261 | 3300026524 | Soil | LLEPAERLRGEKELRRKIQNVEALRDLFLSNREKP |
| Ga0209156_104262141 | 3300026547 | Soil | EKLMDEMLEKLLLEPAERLRGERELRRKIQNVEALRDLFLSNREKP |
| Ga0209474_100690664 | 3300026550 | Soil | DEMLEKLLLEPAERLRGERELRRKIQNVEALRDVFLSNREKP |
| Ga0209648_104195862 | 3300026551 | Grasslands Soil | EKLMDEMLEKLLLEPAQRLRGEKELRRKIQNVEALRDLFLSNREKP |
| Ga0207781_10142831 | 3300026890 | Tropical Forest Soil | MDELIEKLLIVPAERLRAEKELRRKIQSVEAIRALYLSDREKP |
| Ga0207779_10335341 | 3300026928 | Tropical Forest Soil | REQIGGLMDELMDRLLVRPAERLRAEKEHRKKIQSVEAIRDLFLSDREKP |
| Ga0207836_10325072 | 3300026932 | Tropical Forest Soil | MDRLLVRPAERLRAEKEHRKKIQSVEAIRDLFLSDREKP |
| Ga0207740_10251432 | 3300027011 | Tropical Forest Soil | DELMDRLLVRPAERLRAEKEHRKKIQSVEAIRDLFLSDREKP |
| Ga0207726_10440002 | 3300027045 | Tropical Forest Soil | IEKLLILPAERLRTEKELRKKIQSVEAIRELYLSDREKP |
| Ga0208365_10143581 | 3300027070 | Forest Soil | KLMDEMLEKLLLEPAQRLRGEKELRRKIQNVEALRDLFLSNREKP |
| Ga0209418_10402832 | 3300027371 | Forest Soil | GGLMDELIERLLLRPAERLRAEREHRKKIQSVEAIRDLFLSDREKP |
| Ga0209179_11614942 | 3300027512 | Vadose Zone Soil | KLLVEPAERLRGERELRRKIQNVEALRDLFLSKKDKP |
| Ga0209524_11169012 | 3300027521 | Forest Soil | LAEMGHLSATDRQRVEGLMDELLEKLLLQPAERLRGERVLRRKIQNVEALRDLFLSNREK |
| Ga0209734_11158712 | 3300027535 | Forest Soil | VTDRERVEGLMDDLLEKLLLQPAERLRGERELRRKIQNVEALRHLFLSNREKP |
| Ga0209527_11466642 | 3300027583 | Forest Soil | METLMDELLEKLLVEPAERLRGEKELRRKIQNVEALRDLFLSKKDKP |
| Ga0209220_10372493 | 3300027587 | Forest Soil | EKLLLGPAERLRGEKELRRKIQNVEALRDLFLSNREKP |
| Ga0209736_10197734 | 3300027660 | Forest Soil | LTEADRAHVEKLMDEMLEKLLLEPAERLRGEKELRRKIQNVEAIRDLYLSGREKP |
| Ga0209736_10661771 | 3300027660 | Forest Soil | LMAPAERLRSEKEHRRKIHNIEALRDLFLSDREKP |
| Ga0208981_10588402 | 3300027669 | Forest Soil | AQVEKLMDEMLEKVLLEPAQRLRGERELRRKIQNVEALRDLFLSNREKP |
| Ga0209588_10854211 | 3300027671 | Vadose Zone Soil | MEALMDELLEKLLVEPAERLRGERELRRKIQNVEALRDLFLSKKDKS |
| Ga0209588_11694731 | 3300027671 | Vadose Zone Soil | HLSEPDRLRMEGLMDELLEKLLLEPAQKLRGEKELRRKIQNVEALRDLFLSKRDKP |
| Ga0209530_10453883 | 3300027692 | Forest Soil | EMLEKFLVQPAERLRDERELRRKIQNVEALRDLFLSDRDKR |
| Ga0209656_101892262 | 3300027812 | Bog Forest Soil | EDREHIGDLMDELIEKLLIAPAERLRMEKEHRKKIQNVEAIRDVYLSEREKP |
| Ga0209039_101507711 | 3300027825 | Bog Forest Soil | ERERMESMMDELLEKLLLQPAQRLHGEKELRRKIQNVEALRDLFLSDREKP |
| Ga0209180_105251131 | 3300027846 | Vadose Zone Soil | MEKLMDDLLEKLLLEPAERLRREKELRRKIQNVEALRDLFLSEREKP |
| Ga0209283_104877421 | 3300027875 | Vadose Zone Soil | KLMDEMLEKLLLEPAERLRGEKELRRKIQNVEALRDLFLSNREKP |
| Ga0209590_109336681 | 3300027882 | Vadose Zone Soil | LLEPAERLRGEKELRRKIQNVEALRDLFLSEREKP |
| Ga0209275_100868153 | 3300027884 | Soil | ELLEKLLLEPAERLRGEKELRRKIQNVEALRDLFLSNREKT |
| Ga0209380_104985262 | 3300027889 | Soil | MEEVLEKFLVQPAERLRDERELRRKIQNVEALRDLFLSDREKR |
| Ga0209067_102492191 | 3300027898 | Watersheds | ADKLNVEKLMDEMLEKLILEPTQRLRGEKELRRKIQNVEALRDLFLSKGEKR |
| Ga0209488_105904202 | 3300027903 | Vadose Zone Soil | KLLVEPAERLRGEKELRRKIQNVEALRDLFLSKKDKS |
| Ga0209006_102477391 | 3300027908 | Forest Soil | SAHDRQQMETLMGELLEKLLLEPAERLRGEKELRRKIQNVEALRDLFLSNREKQ |
| Ga0209069_103727431 | 3300027915 | Watersheds | IRCIESLMDDLLEKLLLEPAERLRGERELRRKIQSVEALRDLFLRDKEKS |
| Ga0302224_101239271 | 3300028759 | Palsa | LIGPAERLRGERELRRKIQNVEALRDLFLSGREKP |
| Ga0302218_100506961 | 3300028863 | Palsa | GELLERILIEPARQLRGERELRRKIQNVEALRDVFLNGKDKP |
| Ga0308309_108107832 | 3300028906 | Soil | ELLEKLLLQPAERLRGEKELRRKIQNVEALRDLFLSNREKP |
| Ga0311340_103101381 | 3300029943 | Palsa | LEKLLIDPAQQLRGERELRRKIQNVEALRDLFLREGDKS |
| Ga0311372_120927932 | 3300030520 | Palsa | LLEKLLIDPAQQLRGERELRRKIQNVEALRDLFLRDGDKS |
| Ga0265740_10058872 | 3300030940 | Soil | MDELLEKLLLEPAERLRGEKELRRKIQNVEALRDLFLSNREKP |
| Ga0170834_1066138341 | 3300031057 | Forest Soil | LEKMLLDPTRRLQGEKDLRRKIQQVEAIRGLFLPDRER |
| Ga0170834_1087712361 | 3300031057 | Forest Soil | LLEKMLLDPARRLQGEKDLRRKIQQVEAIRELFLPDREH |
| Ga0170823_113046391 | 3300031128 | Forest Soil | FSGEDREKIGVLMDELIEQLLLHPAERLRTEKELRRKIQNVEAIRDLYLSNREKP |
| Ga0170824_1190742731 | 3300031231 | Forest Soil | KLLLEPAERLRGEKELRRKIQNVEAPRDLFLSNREKS |
| Ga0265320_102776862 | 3300031240 | Rhizosphere | RMESMMDELLEKLLLEPAQRLRGEKELRRKIQNVEALRDLFLSNREKP |
| Ga0170820_129113501 | 3300031446 | Forest Soil | IEQLLLQPAERLRTEKELRRKIQNVEAIRDLYLSNREKP |
| Ga0318541_101006642 | 3300031545 | Soil | MDELIERLLIAPAEHLRSEKELRKKIQNVEAIRDLYLNNREKH |
| Ga0318538_101918362 | 3300031546 | Soil | LIAPAERLRTEKELRKKIQSVEAIRALYLSEREKP |
| Ga0318555_102810371 | 3300031640 | Soil | QHLTEADRALVETLMDEILESVLLEPARRLRGEKDLRRKVQNVEALRDLFLSNREKP |
| Ga0318574_104817291 | 3300031680 | Soil | QSDELMAELIERLLVRPAERLRAEREHRKKIQSVEAIRDLFLSDREKP |
| Ga0310686_1014242772 | 3300031708 | Soil | ESMMDELLEKLLLEPAERLRGEKELRRKIQNVEALRDLFLSNREKP |
| Ga0307476_102210971 | 3300031715 | Hardwood Forest Soil | ELLEKLLLEPAERLRGEKELRRKIQNVEALRDLFLSNREKP |
| Ga0307476_113630272 | 3300031715 | Hardwood Forest Soil | DKVERIVSDLLEKLLIEPAQQLRGERELRRKIQNVESLRDLFLRGKGQA |
| Ga0307476_114337181 | 3300031715 | Hardwood Forest Soil | NHMSEADRARVEGLMDEMLEKLLLKPAEQLRGEKELRRKIQNVEALRDLFLSNREKP |
| Ga0306917_106293492 | 3300031719 | Soil | LMDELIEKLLIEPAERLRSEKEFRKKIQSVDALRDLYLSDEDKS |
| Ga0307469_110134671 | 3300031720 | Hardwood Forest Soil | MAHLSEPDRLGMEGLMDELLEKLLLEPAQKLRGEKELRRKIQNVEALRDLFLSRREKP |
| Ga0307477_107172752 | 3300031753 | Hardwood Forest Soil | ELLEKLLVEPAVRLRGEKELRRKIQNVEALRDLFLPGRDKP |
| Ga0307477_109976492 | 3300031753 | Hardwood Forest Soil | EADRARMETLMDELLEKLVVEPAERLRGERQLRRKIQNVEALRDLFLPGRKKP |
| Ga0307475_107958102 | 3300031754 | Hardwood Forest Soil | KLLLQPAERLRGEKELRRKIQNVEALRDLFLSKKDKP |
| Ga0318521_102821131 | 3300031770 | Soil | LMDRLLVRPAERLRAEKEHRKKIQNVEAIRDLFLSDREKP |
| Ga0307478_114848661 | 3300031823 | Hardwood Forest Soil | LEKLLLEPAERLRGEKELRRKIQNVEALRDLFLSNREKP |
| Ga0310917_102319073 | 3300031833 | Soil | IGQMMDELIDRLLIAPAERLRTEKELRKKIQSVEAIRALYLSEREKP |
| Ga0318527_101233032 | 3300031859 | Soil | LVRPAERLRAEREHRKKIQSVEAIRDLFLSDREKP |
| Ga0306925_101469751 | 3300031890 | Soil | MDELIDRLLIAPAERLRTEKELRKKIQSVEAIRALYLSEREKP |
| Ga0318520_106842632 | 3300031897 | Soil | RLLIAPAERLRTEKELRKKIQSVEAIRALYLSEREKP |
| Ga0306923_118124842 | 3300031910 | Soil | DREQIGNMMDELIEQLLILPAERLRAEKEHRRKIQNVEALRDLYLSDREKP |
| Ga0306921_125924882 | 3300031912 | Soil | LLERLMLQPACRLQSEKDLRRKIQSVEAIRDLFLPGRERL |
| Ga0310912_110708982 | 3300031941 | Soil | TVEQREQVESLIDELLEKMLLDPARRLQGEKDLRRKIQQVEAIRELFLPDRER |
| Ga0310916_109756462 | 3300031942 | Soil | LGVLMDELIEKLLIEPAERLRSEKEFRKKIQSVDALRDLYLSDEDKS |
| Ga0310916_111055062 | 3300031942 | Soil | LLLEPARRLQSERDLRRKIQNVEALRELFLSDRGRR |
| Ga0306926_100585596 | 3300031954 | Soil | GVLMDELIEKLLIEPAERLRSEKEFRKKIQSVDALRDLYLSDEDKS |
| Ga0307479_108978182 | 3300031962 | Hardwood Forest Soil | HVEKLMDEMLEKLLLEPAGRLRGEKELRRKIQNVEALRDLFLSNREKP |
| Ga0307479_112575852 | 3300031962 | Hardwood Forest Soil | MDDLLEKLLLEPAERLRGERELRRKIQNVEALRDLFLRDREKP |
| Ga0307479_112926462 | 3300031962 | Hardwood Forest Soil | EKMLLDPARRLQGEKDLRRKIQQVEAIRELFLPDRER |
| Ga0318531_101152873 | 3300031981 | Soil | MDELLEKLLLDPARRLQGEKDLRRKIQNVEAIRDLFLPGKERRQ |
| Ga0306922_115327361 | 3300032001 | Soil | EKLMDELLEGMVLEPALRLRGEKDLRRKIHNVEALRDLFLSNRGKP |
| Ga0318504_101769582 | 3300032063 | Soil | AELIERLLVRPAERLRAEREHRKKIQSVEAIRDLFLSDREKP |
| Ga0318524_103561452 | 3300032067 | Soil | QLECVMDEWLGRLLLEPARRLQNEKDLRRKIQSIEALRDLFLPGRERL |
| Ga0306924_112993852 | 3300032076 | Soil | QVESLMDELLERLLLEPARRLQSERDLRRKIQNVEALRELFLSDRGRR |
| Ga0306924_118491462 | 3300032076 | Soil | MVLEPALRLRGEKDLRRKIHNVEALRDLFLSNRGKP |
| Ga0318525_105334551 | 3300032089 | Soil | LMLQPACRLQSEKDLRRKIQSVEAIRDLFLPGRERL |
| Ga0318518_103175492 | 3300032090 | Soil | IQHLTEADRALVETLMDEILESVLLEPARRLRGEKDLRRKVQNVEALRDLFLSNREKP |
| Ga0318540_104339861 | 3300032094 | Soil | EQRVQVESLMDELLEKLLLDPARRLQGEKDLRRKIQNVEAIRDLFLPGKERRQ |
| Ga0311301_117726441 | 3300032160 | Peatlands Soil | DRARVEGLMDEMLEKLLLKPAEQLRGEKELRRKIQNVEALRDLFLSNREKP |
| Ga0307471_1007224692 | 3300032180 | Hardwood Forest Soil | KLLLEPAERLRGEKELRRKIQNVEALRDLFLSNREKP |
| Ga0307472_1003544673 | 3300032205 | Hardwood Forest Soil | DELIEHLLLHPAERLRTEKELRRKIQNVEAIRDLYLSDREKP |
| Ga0307472_1011789842 | 3300032205 | Hardwood Forest Soil | ERMETLMDELLEKLLVHPAERLRGEKELRRKIQNVEALRDLFLSRKDKP |
| Ga0306920_1009831153 | 3300032261 | Soil | RHLTERDRAEVEKLMDELLEGMVLEPALRLRGEKDLRRKIHNVEALRDLFLSNRGKP |
| Ga0335079_107541112 | 3300032783 | Soil | SIMDELLEKLLVEPAERLRGEKELRRKIQNVEALRDLFLSHREKP |
| Ga0335078_110842971 | 3300032805 | Soil | LLHPAERLRAEKELRRKIQNVEAIRDLYLSDREKS |
| Ga0335081_114865151 | 3300032892 | Soil | KLMDELIEKLLIAPAERLRMEKELRKKIQSVEAIRDLYLTDREKP |
| Ga0335081_116934162 | 3300032892 | Soil | LVIAPAERLRMERELRKKIQSVETIRDLYLSDREKP |
| Ga0335081_121190782 | 3300032892 | Soil | IGRLMDELVETLLIAPAERLRAQKEIRKKIQSVEAIRDLYLSDREKP |
| Ga0335072_107652162 | 3300032898 | Soil | KFLIQPAERLRDERELRRKIQNVEALRDLFLSDREKR |
| ⦗Top⦘ |