NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F007198

Metagenome / Metatranscriptome Family F007198

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F007198
Family Type Metagenome / Metatranscriptome
Number of Sequences 356
Average Sequence Length 48 residues
Representative Sequence MSVVTETTARSEEKFRVTRSRRNVAWTGAGALIVVVVLALFPY
Number of Associated Samples 261
Number of Associated Scaffolds 356

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 99.16 %
% of genes near scaffold ends (potentially truncated) 98.88 %
% of genes from short scaffolds (< 2000 bps) 93.26 %
Associated GOLD sequencing projects 253
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (87.921 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(41.854 % of family members)
Environment Ontology (ENVO) Unclassified
(37.640 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(44.382 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 38.03%    β-sheet: 0.00%    Coil/Unstructured: 61.97%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 356 Family Scaffolds
PF02653BPD_transp_2 87.08
PF00005ABC_tran 7.87
PF12399BCA_ABC_TP_C 0.84
PF13458Peripla_BP_6 0.56
PF00270DEAD 0.28
PF00886Ribosomal_S16 0.28
PF13193AMP-binding_C 0.28
PF00732GMC_oxred_N 0.28
PF13083KH_4 0.28

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 356 Family Scaffolds
COG0228Ribosomal protein S16Translation, ribosomal structure and biogenesis [J] 0.28
COG2303Choline dehydrogenase or related flavoproteinLipid transport and metabolism [I] 0.28


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms87.92 %
UnclassifiedrootN/A12.08 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2166559005|cont_contig32800All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae1030Open in IMG/M
2170459013|GO6OHWN01DL66EAll Organisms → cellular organisms → Bacteria → Terrabacteria group505Open in IMG/M
2189573004|GZGWRS401BTW8RAll Organisms → cellular organisms → Bacteria → Terrabacteria group512Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_100760433All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae598Open in IMG/M
3300001978|JGI24747J21853_1033366All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae594Open in IMG/M
3300004091|Ga0062387_101571572All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae530Open in IMG/M
3300004633|Ga0066395_10103435All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea coxensis1377Open in IMG/M
3300005168|Ga0066809_10117176All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae666Open in IMG/M
3300005180|Ga0066685_10898417All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae592Open in IMG/M
3300005328|Ga0070676_10097361All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea coxensis1812Open in IMG/M
3300005468|Ga0070707_102249010All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae513Open in IMG/M
3300005533|Ga0070734_10438271All Organisms → cellular organisms → Bacteria → Terrabacteria group745Open in IMG/M
3300005535|Ga0070684_100445099All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea coxensis1197Open in IMG/M
3300005561|Ga0066699_10600284All Organisms → cellular organisms → Bacteria → Terrabacteria group791Open in IMG/M
3300005563|Ga0068855_100608387Not Available1178Open in IMG/M
3300005576|Ga0066708_10366115All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae926Open in IMG/M
3300005577|Ga0068857_101460539All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae666Open in IMG/M
3300005578|Ga0068854_101762942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae567Open in IMG/M
3300005586|Ga0066691_10583653All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae665Open in IMG/M
3300005591|Ga0070761_10319845All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae936Open in IMG/M
3300005598|Ga0066706_11017325All Organisms → cellular organisms → Bacteria → Terrabacteria group638Open in IMG/M
3300005610|Ga0070763_10009223All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea coxensis4001Open in IMG/M
3300005610|Ga0070763_10149178All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea coxensis1219Open in IMG/M
3300005618|Ga0068864_101369760All Organisms → cellular organisms → Bacteria → Terrabacteria group709Open in IMG/M
3300005764|Ga0066903_109147556All Organisms → cellular organisms → Bacteria → Terrabacteria group500Open in IMG/M
3300006028|Ga0070717_10639440All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae966Open in IMG/M
3300006052|Ga0075029_101024459All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae571Open in IMG/M
3300006086|Ga0075019_10101853All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1652Open in IMG/M
3300006086|Ga0075019_10310020Not Available952Open in IMG/M
3300006163|Ga0070715_10650235All Organisms → cellular organisms → Bacteria → Terrabacteria group624Open in IMG/M
3300006172|Ga0075018_10794121All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae519Open in IMG/M
3300006173|Ga0070716_100678812All Organisms → cellular organisms → Bacteria → Terrabacteria group784Open in IMG/M
3300006174|Ga0075014_100507765All Organisms → cellular organisms → Bacteria → Terrabacteria group676Open in IMG/M
3300006176|Ga0070765_100476219All Organisms → cellular organisms → Bacteria1171Open in IMG/M
3300006578|Ga0074059_12126125All Organisms → cellular organisms → Bacteria → Terrabacteria group739Open in IMG/M
3300006603|Ga0074064_11812657All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae892Open in IMG/M
3300006755|Ga0079222_11081470All Organisms → cellular organisms → Bacteria → Terrabacteria group701Open in IMG/M
3300006800|Ga0066660_10681512All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae848Open in IMG/M
3300006804|Ga0079221_10297344All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae945Open in IMG/M
3300006806|Ga0079220_11048421All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae653Open in IMG/M
3300006903|Ga0075426_11167722All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae583Open in IMG/M
3300009525|Ga0116220_10306703All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae699Open in IMG/M
3300009545|Ga0105237_10691004Not Available1027Open in IMG/M
3300009628|Ga0116125_1147131All Organisms → cellular organisms → Bacteria → Terrabacteria group651Open in IMG/M
3300009683|Ga0116224_10374988All Organisms → cellular organisms → Bacteria → Terrabacteria group677Open in IMG/M
3300010043|Ga0126380_12129510All Organisms → cellular organisms → Bacteria → Terrabacteria group517Open in IMG/M
3300010048|Ga0126373_11486949All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae743Open in IMG/M
3300010159|Ga0099796_10111854Not Available1040Open in IMG/M
3300010322|Ga0134084_10414201All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae529Open in IMG/M
3300010326|Ga0134065_10248430All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae663Open in IMG/M
3300010358|Ga0126370_10463865Not Available1060Open in IMG/M
3300010358|Ga0126370_12393864All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae524Open in IMG/M
3300010360|Ga0126372_10394489All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae1260Open in IMG/M
3300010360|Ga0126372_12175714All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae603Open in IMG/M
3300010361|Ga0126378_10673463Not Available1147Open in IMG/M
3300010361|Ga0126378_12079331All Organisms → cellular organisms → Bacteria → Terrabacteria group647Open in IMG/M
3300010361|Ga0126378_13063595All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae532Open in IMG/M
3300010366|Ga0126379_10106000All Organisms → cellular organisms → Bacteria2514Open in IMG/M
3300010373|Ga0134128_13065026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae514Open in IMG/M
3300010376|Ga0126381_101510014All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae971Open in IMG/M
3300010379|Ga0136449_102968375All Organisms → cellular organisms → Bacteria → Terrabacteria group663Open in IMG/M
3300010379|Ga0136449_103110732All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae644Open in IMG/M
3300010379|Ga0136449_104053269All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae546Open in IMG/M
3300010866|Ga0126344_1318325All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae586Open in IMG/M
3300010876|Ga0126361_10354636All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae502Open in IMG/M
3300011404|Ga0153951_1006180All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2234Open in IMG/M
3300012004|Ga0120134_1112851All Organisms → cellular organisms → Bacteria → Terrabacteria group513Open in IMG/M
3300012207|Ga0137381_10109818All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae2346Open in IMG/M
3300012285|Ga0137370_10137634All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae1404Open in IMG/M
3300012356|Ga0137371_10296214All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp.1260Open in IMG/M
3300012362|Ga0137361_10586310Not Available1022Open in IMG/M
3300012363|Ga0137390_11546224All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae603Open in IMG/M
3300012478|Ga0157328_1023670All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae537Open in IMG/M
3300012923|Ga0137359_10561959Not Available1003Open in IMG/M
3300012929|Ga0137404_11051895All Organisms → cellular organisms → Bacteria → Terrabacteria group746Open in IMG/M
3300012971|Ga0126369_12162461All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae644Open in IMG/M
3300012976|Ga0134076_10542726All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae536Open in IMG/M
3300012977|Ga0134087_10303634All Organisms → cellular organisms → Bacteria → Terrabacteria group749Open in IMG/M
3300012984|Ga0164309_11304831All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia614Open in IMG/M
3300012985|Ga0164308_12015103All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae538Open in IMG/M
3300013105|Ga0157369_10817213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae957Open in IMG/M
3300013105|Ga0157369_11889158All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae606Open in IMG/M
3300013306|Ga0163162_11138026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae885Open in IMG/M
3300013307|Ga0157372_10824477Not Available1077Open in IMG/M
3300014157|Ga0134078_10408794All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae611Open in IMG/M
3300014200|Ga0181526_10784378All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae600Open in IMG/M
3300015359|Ga0134085_10466920All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae574Open in IMG/M
3300016341|Ga0182035_11965763All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300016387|Ga0182040_10912812All Organisms → cellular organisms → Bacteria → Terrabacteria group729Open in IMG/M
3300016404|Ga0182037_10712406All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae860Open in IMG/M
3300016404|Ga0182037_11825809All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae543Open in IMG/M
3300016404|Ga0182037_12048101All Organisms → cellular organisms → Bacteria → Terrabacteria group514Open in IMG/M
3300017932|Ga0187814_10008589All Organisms → cellular organisms → Bacteria4030Open in IMG/M
3300017932|Ga0187814_10194954All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae761Open in IMG/M
3300017937|Ga0187809_10280425All Organisms → cellular organisms → Bacteria → Terrabacteria group610Open in IMG/M
3300017937|Ga0187809_10432759All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae506Open in IMG/M
3300017939|Ga0187775_10035415All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae1457Open in IMG/M
3300017942|Ga0187808_10598548All Organisms → cellular organisms → Bacteria → Terrabacteria group512Open in IMG/M
3300017955|Ga0187817_10162769All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1419Open in IMG/M
3300017970|Ga0187783_10404508Not Available992Open in IMG/M
3300017970|Ga0187783_11366717All Organisms → cellular organisms → Bacteria → Terrabacteria group510Open in IMG/M
3300017972|Ga0187781_10127120All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1780Open in IMG/M
3300017973|Ga0187780_10600068All Organisms → cellular organisms → Bacteria → Terrabacteria group791Open in IMG/M
3300017975|Ga0187782_10109284All Organisms → cellular organisms → Bacteria2038Open in IMG/M
3300017999|Ga0187767_10379476All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae505Open in IMG/M
3300018001|Ga0187815_10514175All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae513Open in IMG/M
3300018007|Ga0187805_10384371All Organisms → cellular organisms → Bacteria → Terrabacteria group651Open in IMG/M
3300018007|Ga0187805_10529803All Organisms → cellular organisms → Bacteria → Terrabacteria group553Open in IMG/M
3300018042|Ga0187871_10190091Not Available1150Open in IMG/M
3300018046|Ga0187851_10814533All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae525Open in IMG/M
3300018089|Ga0187774_10509237All Organisms → cellular organisms → Bacteria → Terrabacteria group760Open in IMG/M
3300020062|Ga0193724_1057577All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae818Open in IMG/M
3300020581|Ga0210399_10182647All Organisms → cellular organisms → Bacteria1741Open in IMG/M
3300020582|Ga0210395_10017030All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae5343Open in IMG/M
3300020582|Ga0210395_10321584Not Available1163Open in IMG/M
3300020583|Ga0210401_11357237All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae568Open in IMG/M
3300021088|Ga0210404_10461908All Organisms → cellular organisms → Bacteria → Terrabacteria group715Open in IMG/M
3300021170|Ga0210400_10176417All Organisms → cellular organisms → Bacteria1731Open in IMG/M
3300021170|Ga0210400_11495598All Organisms → cellular organisms → Bacteria → Terrabacteria group536Open in IMG/M
3300021180|Ga0210396_10022898All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae5782Open in IMG/M
3300021180|Ga0210396_10150070All Organisms → cellular organisms → Bacteria2093Open in IMG/M
3300021180|Ga0210396_10754876All Organisms → cellular organisms → Bacteria → Terrabacteria group837Open in IMG/M
3300021181|Ga0210388_10027273All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae4669Open in IMG/M
3300021181|Ga0210388_11233211All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae633Open in IMG/M
3300021374|Ga0213881_10057263All Organisms → cellular organisms → Bacteria1655Open in IMG/M
3300021388|Ga0213875_10246739All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae842Open in IMG/M
3300021401|Ga0210393_10316606All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1268Open in IMG/M
3300021401|Ga0210393_11664996All Organisms → cellular organisms → Bacteria → Terrabacteria group505Open in IMG/M
3300021404|Ga0210389_10744169All Organisms → cellular organisms → Bacteria → Terrabacteria group767Open in IMG/M
3300021405|Ga0210387_11478283All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae582Open in IMG/M
3300021407|Ga0210383_10596157All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae952Open in IMG/M
3300021407|Ga0210383_11133626All Organisms → cellular organisms → Bacteria → Terrabacteria group659Open in IMG/M
3300021433|Ga0210391_10748566All Organisms → cellular organisms → Bacteria → Terrabacteria group765Open in IMG/M
3300021433|Ga0210391_10793245All Organisms → cellular organisms → Bacteria → Terrabacteria group740Open in IMG/M
3300021433|Ga0210391_11141426All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae604Open in IMG/M
3300021474|Ga0210390_10078389All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales2736Open in IMG/M
3300021474|Ga0210390_10767073All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae800Open in IMG/M
3300021474|Ga0210390_11219549All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae606Open in IMG/M
3300021477|Ga0210398_10191719All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1665Open in IMG/M
3300021477|Ga0210398_11555549All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae513Open in IMG/M
3300021479|Ga0210410_10760692All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae852Open in IMG/M
3300021560|Ga0126371_11655893All Organisms → cellular organisms → Bacteria → Terrabacteria group765Open in IMG/M
3300021560|Ga0126371_12669309All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae605Open in IMG/M
3300021860|Ga0213851_1482110All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae561Open in IMG/M
3300021861|Ga0213853_10714782All Organisms → cellular organisms → Bacteria → Terrabacteria group629Open in IMG/M
3300022467|Ga0224712_10266613All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae794Open in IMG/M
3300022557|Ga0212123_10665487All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae646Open in IMG/M
3300025412|Ga0208194_1061468All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae576Open in IMG/M
3300025898|Ga0207692_10145496All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae1352Open in IMG/M
3300025900|Ga0207710_10315847All Organisms → cellular organisms → Bacteria → Terrabacteria group791Open in IMG/M
3300025905|Ga0207685_10014794All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales2452Open in IMG/M
3300025911|Ga0207654_10094166All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1833Open in IMG/M
3300025914|Ga0207671_10609367All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae870Open in IMG/M
3300025917|Ga0207660_10532772All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae954Open in IMG/M
3300025929|Ga0207664_10870960All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae809Open in IMG/M
3300025944|Ga0207661_11194257All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae700Open in IMG/M
3300025945|Ga0207679_10332547All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GMKU3631319Open in IMG/M
3300026316|Ga0209155_1209779All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria610Open in IMG/M
3300026489|Ga0257160_1011421All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1285Open in IMG/M
3300026498|Ga0257156_1016037All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae1465Open in IMG/M
3300026498|Ga0257156_1069455All Organisms → cellular organisms → Bacteria → Terrabacteria group729Open in IMG/M
3300026995|Ga0208761_1015178All Organisms → cellular organisms → Bacteria → Terrabacteria group697Open in IMG/M
3300026998|Ga0208369_1001459All Organisms → cellular organisms → Bacteria1782Open in IMG/M
3300027043|Ga0207800_1018780Not Available1118Open in IMG/M
3300027496|Ga0208987_1015017Not Available1301Open in IMG/M
3300027545|Ga0209008_1062866All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae841Open in IMG/M
3300027575|Ga0209525_1026942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1416Open in IMG/M
3300027633|Ga0208988_1069807All Organisms → cellular organisms → Bacteria885Open in IMG/M
3300027648|Ga0209420_1091605All Organisms → cellular organisms → Bacteria → Terrabacteria group870Open in IMG/M
3300027696|Ga0208696_1082390Not Available1084Open in IMG/M
3300027696|Ga0208696_1203059All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae627Open in IMG/M
3300027855|Ga0209693_10204106Not Available973Open in IMG/M
3300027867|Ga0209167_10645557All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae579Open in IMG/M
3300027879|Ga0209169_10391533All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium731Open in IMG/M
3300027884|Ga0209275_10900047All Organisms → cellular organisms → Bacteria → Terrabacteria group510Open in IMG/M
3300027889|Ga0209380_10081296All Organisms → cellular organisms → Bacteria1860Open in IMG/M
3300027915|Ga0209069_10224475Not Available967Open in IMG/M
3300028747|Ga0302219_10216816All Organisms → cellular organisms → Bacteria → Terrabacteria group739Open in IMG/M
3300028778|Ga0307288_10270687All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae670Open in IMG/M
3300028789|Ga0302232_10052988All Organisms → cellular organisms → Bacteria2147Open in IMG/M
3300028801|Ga0302226_10146214Not Available1029Open in IMG/M
3300028906|Ga0308309_10563944All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae987Open in IMG/M
3300028906|Ga0308309_11223746All Organisms → cellular organisms → Bacteria → Terrabacteria group647Open in IMG/M
3300029943|Ga0311340_10816599All Organisms → cellular organisms → Bacteria → Terrabacteria group784Open in IMG/M
3300029951|Ga0311371_11105428All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae928Open in IMG/M
3300030013|Ga0302178_10526468All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae512Open in IMG/M
3300030053|Ga0302177_10067761All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2120Open in IMG/M
3300030056|Ga0302181_10065070All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1877Open in IMG/M
3300030056|Ga0302181_10319617All Organisms → cellular organisms → Bacteria → Terrabacteria group685Open in IMG/M
3300030058|Ga0302179_10146538Not Available1042Open in IMG/M
3300030494|Ga0310037_10485752Not Available502Open in IMG/M
3300030503|Ga0311370_10292066All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales2115Open in IMG/M
3300030617|Ga0311356_10588381Not Available1078Open in IMG/M
3300030617|Ga0311356_11614536All Organisms → cellular organisms → Bacteria → Terrabacteria group583Open in IMG/M
3300030707|Ga0310038_10131838Not Available1265Open in IMG/M
3300030739|Ga0302311_10438364All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae911Open in IMG/M
3300030743|Ga0265461_13846905Not Available511Open in IMG/M
3300031027|Ga0302308_10102682All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1950Open in IMG/M
3300031027|Ga0302308_10108870All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae1879Open in IMG/M
3300031057|Ga0170834_110055946All Organisms → cellular organisms → Bacteria → Terrabacteria group523Open in IMG/M
3300031090|Ga0265760_10168191All Organisms → cellular organisms → Bacteria → Terrabacteria group727Open in IMG/M
3300031231|Ga0170824_119903761All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae525Open in IMG/M
3300031543|Ga0318516_10009560All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae4641Open in IMG/M
3300031544|Ga0318534_10032823All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales2843Open in IMG/M
3300031546|Ga0318538_10097850All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GMKU3631511Open in IMG/M
3300031549|Ga0318571_10088699Not Available993Open in IMG/M
3300031561|Ga0318528_10328971All Organisms → cellular organisms → Bacteria → Terrabacteria group820Open in IMG/M
3300031572|Ga0318515_10098477All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1531Open in IMG/M
3300031572|Ga0318515_10198425Not Available1075Open in IMG/M
3300031572|Ga0318515_10302561All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae857Open in IMG/M
3300031640|Ga0318555_10148972All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1252Open in IMG/M
3300031640|Ga0318555_10304134All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae863Open in IMG/M
3300031640|Ga0318555_10391579All Organisms → cellular organisms → Bacteria → Terrabacteria group753Open in IMG/M
3300031640|Ga0318555_10820223All Organisms → cellular organisms → Bacteria → Terrabacteria group502Open in IMG/M
3300031668|Ga0318542_10091683All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1455Open in IMG/M
3300031668|Ga0318542_10189983Not Available1033Open in IMG/M
3300031668|Ga0318542_10515315All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae622Open in IMG/M
3300031668|Ga0318542_10586992All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae581Open in IMG/M
3300031680|Ga0318574_10128783All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae1425Open in IMG/M
3300031680|Ga0318574_10131802All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microtetraspora → Microtetraspora glauca1409Open in IMG/M
3300031680|Ga0318574_10271449Not Available983Open in IMG/M
3300031681|Ga0318572_10554113All Organisms → cellular organisms → Bacteria → Terrabacteria group685Open in IMG/M
3300031682|Ga0318560_10249316All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae953Open in IMG/M
3300031682|Ga0318560_10555259All Organisms → cellular organisms → Bacteria → Terrabacteria group622Open in IMG/M
3300031708|Ga0310686_106050864All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae514Open in IMG/M
3300031713|Ga0318496_10233311All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae1013Open in IMG/M
3300031713|Ga0318496_10656912All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae579Open in IMG/M
3300031718|Ga0307474_11068600All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae639Open in IMG/M
3300031719|Ga0306917_10794349All Organisms → cellular organisms → Bacteria → Terrabacteria group742Open in IMG/M
3300031724|Ga0318500_10062751All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae1613Open in IMG/M
3300031724|Ga0318500_10230137All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae894Open in IMG/M
3300031724|Ga0318500_10250108All Organisms → cellular organisms → Bacteria → Terrabacteria group859Open in IMG/M
3300031736|Ga0318501_10700901All Organisms → cellular organisms → Bacteria → Terrabacteria group558Open in IMG/M
3300031744|Ga0306918_10102929All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2036Open in IMG/M
3300031744|Ga0306918_10702736All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae791Open in IMG/M
3300031744|Ga0306918_11479224All Organisms → cellular organisms → Bacteria → Terrabacteria group519Open in IMG/M
3300031747|Ga0318502_10300467All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae944Open in IMG/M
3300031747|Ga0318502_10342055All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae884Open in IMG/M
3300031747|Ga0318502_11030063All Organisms → cellular organisms → Bacteria → Terrabacteria group502Open in IMG/M
3300031748|Ga0318492_10249908All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae916Open in IMG/M
3300031751|Ga0318494_10329991All Organisms → cellular organisms → Bacteria → Terrabacteria group881Open in IMG/M
3300031754|Ga0307475_11030019All Organisms → cellular organisms → Bacteria → Terrabacteria group646Open in IMG/M
3300031763|Ga0318537_10158841All Organisms → cellular organisms → Bacteria → Terrabacteria group842Open in IMG/M
3300031764|Ga0318535_10166757All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae983Open in IMG/M
3300031765|Ga0318554_10254951Not Available999Open in IMG/M
3300031765|Ga0318554_10689823All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae573Open in IMG/M
3300031768|Ga0318509_10835405All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae509Open in IMG/M
3300031770|Ga0318521_10048409All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2182Open in IMG/M
3300031770|Ga0318521_10083763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1725Open in IMG/M
3300031771|Ga0318546_10904711All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales621Open in IMG/M
3300031777|Ga0318543_10262898All Organisms → cellular organisms → Bacteria → Terrabacteria group770Open in IMG/M
3300031777|Ga0318543_10371738All Organisms → cellular organisms → Bacteria → Terrabacteria group640Open in IMG/M
3300031778|Ga0318498_10133958Not Available1127Open in IMG/M
3300031778|Ga0318498_10259101All Organisms → cellular organisms → Bacteria → Terrabacteria group783Open in IMG/M
3300031778|Ga0318498_10295204All Organisms → cellular organisms → Bacteria → Terrabacteria group727Open in IMG/M
3300031779|Ga0318566_10005206All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae4946Open in IMG/M
3300031781|Ga0318547_10829424All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae576Open in IMG/M
3300031782|Ga0318552_10216998All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae969Open in IMG/M
3300031793|Ga0318548_10177357Not Available1043Open in IMG/M
3300031793|Ga0318548_10188704All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae1010Open in IMG/M
3300031793|Ga0318548_10609601All Organisms → cellular organisms → Bacteria → Terrabacteria group531Open in IMG/M
3300031795|Ga0318557_10061971All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1598Open in IMG/M
3300031795|Ga0318557_10092493All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microtetraspora → Microtetraspora glauca1330Open in IMG/M
3300031796|Ga0318576_10093840All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae1362Open in IMG/M
3300031796|Ga0318576_10155444Not Available1068Open in IMG/M
3300031796|Ga0318576_10191423All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae961Open in IMG/M
3300031796|Ga0318576_10214534All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae906Open in IMG/M
3300031796|Ga0318576_10252816All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae831Open in IMG/M
3300031797|Ga0318550_10481746All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae599Open in IMG/M
3300031798|Ga0318523_10170336Not Available1085Open in IMG/M
3300031799|Ga0318565_10514831All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae577Open in IMG/M
3300031799|Ga0318565_10607637All Organisms → cellular organisms → Bacteria → Terrabacteria group525Open in IMG/M
3300031805|Ga0318497_10430619All Organisms → cellular organisms → Bacteria → Terrabacteria group738Open in IMG/M
3300031819|Ga0318568_10109746All Organisms → cellular organisms → Bacteria1659Open in IMG/M
3300031821|Ga0318567_10534006All Organisms → cellular organisms → Bacteria → Terrabacteria group666Open in IMG/M
3300031823|Ga0307478_10789009All Organisms → cellular organisms → Bacteria → Terrabacteria group795Open in IMG/M
3300031823|Ga0307478_10958167All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae715Open in IMG/M
3300031831|Ga0318564_10381865All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae617Open in IMG/M
3300031832|Ga0318499_10030533All Organisms → cellular organisms → Bacteria1941Open in IMG/M
3300031832|Ga0318499_10120676Not Available1019Open in IMG/M
3300031845|Ga0318511_10410942All Organisms → cellular organisms → Bacteria → Terrabacteria group621Open in IMG/M
3300031845|Ga0318511_10458911All Organisms → cellular organisms → Bacteria → Terrabacteria group587Open in IMG/M
3300031846|Ga0318512_10626436All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae549Open in IMG/M
3300031860|Ga0318495_10228276All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae836Open in IMG/M
3300031880|Ga0318544_10402749All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae532Open in IMG/M
3300031890|Ga0306925_10333324All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1630Open in IMG/M
3300031890|Ga0306925_10983817All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae861Open in IMG/M
3300031890|Ga0306925_12238375All Organisms → cellular organisms → Bacteria → Terrabacteria group507Open in IMG/M
3300031893|Ga0318536_10268154All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae867Open in IMG/M
3300031893|Ga0318536_10331080All Organisms → cellular organisms → Bacteria → Terrabacteria group771Open in IMG/M
3300031893|Ga0318536_10540916All Organisms → cellular organisms → Bacteria → Terrabacteria group584Open in IMG/M
3300031894|Ga0318522_10054000All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae1424Open in IMG/M
3300031894|Ga0318522_10106443Not Available1041Open in IMG/M
3300031894|Ga0318522_10175752All Organisms → cellular organisms → Bacteria → Terrabacteria group809Open in IMG/M
3300031896|Ga0318551_10235983All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae1019Open in IMG/M
3300031896|Ga0318551_10883354All Organisms → cellular organisms → Bacteria → Terrabacteria group521Open in IMG/M
3300031897|Ga0318520_10178597All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae1244Open in IMG/M
3300031910|Ga0306923_11002642All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae907Open in IMG/M
3300031941|Ga0310912_11255336All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae563Open in IMG/M
3300031942|Ga0310916_10571599All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae961Open in IMG/M
3300031947|Ga0310909_11476912All Organisms → cellular organisms → Bacteria → Terrabacteria group542Open in IMG/M
3300031954|Ga0306926_10142919All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales2961Open in IMG/M
3300031981|Ga0318531_10124993All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microtetraspora → Microtetraspora glauca1143Open in IMG/M
3300031981|Ga0318531_10152398Not Available1036Open in IMG/M
3300032001|Ga0306922_12304970All Organisms → cellular organisms → Bacteria → Terrabacteria group516Open in IMG/M
3300032008|Ga0318562_10152625All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae1329Open in IMG/M
3300032008|Ga0318562_10818905All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae532Open in IMG/M
3300032009|Ga0318563_10206475Not Available1059Open in IMG/M
3300032009|Ga0318563_10231080All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae998Open in IMG/M
3300032025|Ga0318507_10138745All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae1035Open in IMG/M
3300032025|Ga0318507_10159018All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae968Open in IMG/M
3300032035|Ga0310911_10326287All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae885Open in IMG/M
3300032041|Ga0318549_10056167All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1637Open in IMG/M
3300032044|Ga0318558_10082889All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1478Open in IMG/M
3300032052|Ga0318506_10030469All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2060Open in IMG/M
3300032052|Ga0318506_10531686All Organisms → cellular organisms → Bacteria → Terrabacteria group521Open in IMG/M
3300032054|Ga0318570_10545146All Organisms → cellular organisms → Bacteria → Terrabacteria group529Open in IMG/M
3300032060|Ga0318505_10379847All Organisms → cellular organisms → Bacteria → Terrabacteria group668Open in IMG/M
3300032063|Ga0318504_10160079Not Available1040Open in IMG/M
3300032064|Ga0318510_10119501Not Available1019Open in IMG/M
3300032064|Ga0318510_10355329All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae618Open in IMG/M
3300032066|Ga0318514_10038703All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales2266Open in IMG/M
3300032066|Ga0318514_10158959All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae1174Open in IMG/M
3300032066|Ga0318514_10621217All Organisms → cellular organisms → Bacteria → Terrabacteria group575Open in IMG/M
3300032068|Ga0318553_10277848All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae875Open in IMG/M
3300032068|Ga0318553_10399781All Organisms → cellular organisms → Bacteria → Terrabacteria group719Open in IMG/M
3300032068|Ga0318553_10478018All Organisms → cellular organisms → Bacteria → Terrabacteria group653Open in IMG/M
3300032068|Ga0318553_10654252All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae550Open in IMG/M
3300032090|Ga0318518_10095083All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1481Open in IMG/M
3300032090|Ga0318518_10708013All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae512Open in IMG/M
3300032091|Ga0318577_10289744All Organisms → cellular organisms → Bacteria → Terrabacteria group783Open in IMG/M
3300032094|Ga0318540_10197123Not Available970Open in IMG/M
3300032205|Ga0307472_101002662All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae782Open in IMG/M
3300032205|Ga0307472_101687208All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae625Open in IMG/M
3300032261|Ga0306920_100943360All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae1259Open in IMG/M
3300032770|Ga0335085_10390946All Organisms → cellular organisms → Bacteria1617Open in IMG/M
3300032770|Ga0335085_11862453All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae614Open in IMG/M
3300032805|Ga0335078_12018417All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae616Open in IMG/M
3300032829|Ga0335070_10822454All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae863Open in IMG/M
3300032893|Ga0335069_10353495All Organisms → cellular organisms → Bacteria1735Open in IMG/M
3300032895|Ga0335074_10082754All Organisms → cellular organisms → Bacteria4289Open in IMG/M
3300032895|Ga0335074_10728777Not Available946Open in IMG/M
3300032895|Ga0335074_10865702All Organisms → cellular organisms → Bacteria → Terrabacteria group827Open in IMG/M
3300032895|Ga0335074_11071010All Organisms → cellular organisms → Bacteria → Terrabacteria group699Open in IMG/M
3300032898|Ga0335072_10455551Not Available1346Open in IMG/M
3300032898|Ga0335072_11154258All Organisms → cellular organisms → Bacteria → Terrabacteria group693Open in IMG/M
3300032898|Ga0335072_11167229All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae688Open in IMG/M
3300033004|Ga0335084_10622683Not Available1103Open in IMG/M
3300033134|Ga0335073_12097429All Organisms → cellular organisms → Bacteria → Terrabacteria group512Open in IMG/M
3300033158|Ga0335077_11473638All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae653Open in IMG/M
3300033289|Ga0310914_10725481All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae890Open in IMG/M
3300033290|Ga0318519_10155228All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1282Open in IMG/M
3300033290|Ga0318519_10586875All Organisms → cellular organisms → Bacteria → Terrabacteria group676Open in IMG/M
3300033803|Ga0314862_0057246All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae851Open in IMG/M
3300033808|Ga0314867_149428All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae548Open in IMG/M
3300034820|Ga0373959_0028680Not Available1112Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil41.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.49%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa4.49%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.21%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.93%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.53%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.53%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.25%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.25%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.97%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.69%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.69%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.69%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.69%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.12%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.84%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.84%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.84%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.84%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.84%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.84%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.56%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.56%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.56%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.56%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.56%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.56%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.56%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.28%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.28%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.28%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.28%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.28%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.28%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.28%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.28%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.28%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.28%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.28%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.28%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.28%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.28%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.28%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.28%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.28%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.28%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.28%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.28%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.28%
Attine Ant Fungus GardensHost-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens0.28%
SimulatedEngineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated0.28%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2166559005Simulated microbial communities from Lyon, FranceEngineeredOpen in IMG/M
2170459013Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cmEnvironmentalOpen in IMG/M
2189573004Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen)EnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001978Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6Host-AssociatedOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005168Soil and rhizosphere microbial communities from Laval, Canada - mgLPCEnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006578Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006603Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009628Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10EnvironmentalOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010866Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011404Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ035 MetaGHost-AssociatedOpen in IMG/M
3300012004Permafrost microbial communities from Nunavut, Canada - A30_5cm_6MEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012478Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610Host-AssociatedOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017939Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MGEnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017999Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MGEnvironmentalOpen in IMG/M
3300018001Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5EnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300020062Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021374Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08EnvironmentalOpen in IMG/M
3300021388Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8Host-AssociatedOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300021860Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021861Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022467Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300025412Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026316Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes)EnvironmentalOpen in IMG/M
3300026489Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-AEnvironmentalOpen in IMG/M
3300026498Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-AEnvironmentalOpen in IMG/M
3300026995Soil and rhizosphere microbial communities from Laval, Canada - mgLAB (SPAdes)EnvironmentalOpen in IMG/M
3300026998Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF046 (SPAdes)EnvironmentalOpen in IMG/M
3300027043Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 11 (SPAdes)EnvironmentalOpen in IMG/M
3300027496Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027545Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027575Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027633Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027648Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027696Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028747Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2EnvironmentalOpen in IMG/M
3300028778Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142EnvironmentalOpen in IMG/M
3300028789Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3EnvironmentalOpen in IMG/M
3300028801Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030013Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3EnvironmentalOpen in IMG/M
3300030053Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2EnvironmentalOpen in IMG/M
3300030056Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3EnvironmentalOpen in IMG/M
3300030058Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030494Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2)EnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030617II_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030707Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2)EnvironmentalOpen in IMG/M
3300030739Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3EnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300031027Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031090Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300033803Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10EnvironmentalOpen in IMG/M
3300033808Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20EnvironmentalOpen in IMG/M
3300034820Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
cont_0800.000024302166559005SimulatedVSLATETTARSAGNFRVARSRRNVVWTGGVALIVVVVLALFPY
N57_086459402170459013Grass SoilMSLVKETTAAPLTEFRVARSQRNVAWTAGVALIIV
FG2_076556902189573004Grass SoilMSVTTGATVRSEENLKVTRSRRNVTWTGLGALVVVVVLALFPYLVY
INPhiseqgaiiFebDRAFT_10076043323300000364SoilMSVVTDTPARSEENFRVTRSRRNVAWTGAGALIVV
JGI24747J21853_103336613300001978Corn, Switchgrass And Miscanthus RhizosphereMSVVTDTPARSEENFRVTRSRRNVAWTGAGALIVVVVLALFPYIVYSGTTSL
Ga0062387_10157157213300004091Bog Forest SoilVSTVAETQARSAENYRVTRSRRNVAWTGAGALVVVVVLSL
Ga0066395_1010343533300004633Tropical Forest SoilMSTIAQTAAPSAADFRVTRSRRSVVWTGAGALLVVIVLAYFPYIVHSGTTAILVQAFIVL
Ga0066809_1011717623300005168SoilVSLATESTARSARKIRVTRSRRNVAWTGAVALIVVVVLALFPYIVYSGTTAIL
Ga0066685_1089841723300005180SoilMSVVTDTPARSEENFRVTRSRRNVAWTGAGALIVVVVLALFPYIVYSGTTSLMVQGF
Ga0070676_1009736133300005328Miscanthus RhizosphereMSVVTDTPARSEENFRVTRSRRNVAWTGAGALIVVVVLALFP
Ga0070707_10224901023300005468Corn, Switchgrass And Miscanthus RhizosphereMSLAAETTARSAQKFRVTRSRRNVAWTGAGTLIVVVVLALFPY
Ga0070734_1043827113300005533Surface SoilVSQVTEASLQPAPAFRVTRSQRNVAWTGGVALVVVVVLAMFP
Ga0070684_10044509913300005535Corn RhizosphereMSLATDITTTPAAGFRVARSRRNVAWTGAAALIVVVVLAFFPYIVYAG
Ga0066699_1060028413300005561SoilVSLATETTARPAGNFRVTRSQRNVAWTGAGALIVVVVLAMFPYIVYSGTTAILVQAFIVL
Ga0068855_10060838723300005563Corn RhizosphereMSLVTDTSVRSEENFRVTRSRRNVAWTGAGALIVVVVLALFPYIVYSGTTSLMVQ
Ga0066708_1036611523300005576SoilMSVVTDTSARWEENFRVTRSRRNVAWTGAGAMIVV
Ga0068857_10146053913300005577Corn RhizosphereMSVATETTTRSADKIRVTRSRRNMAWTGIGALVVVVVLALFPYIVYSGTTGIMVQ
Ga0068854_10176294223300005578Corn RhizosphereVSLATKTTARPAEGFRVTRGRRNVAWTGLVALIVVVVLALFPYIV
Ga0066691_1058365313300005586SoilVSLVTETTARPAERFRVTRSRRNVVWTGAGAVIVVVVLALFPYIVHSGTTA
Ga0070761_1031984523300005591SoilVTLAAEPTLLGAEDFRVTRSRRNVTWNGIGVLAVVVVLALFPYIVYAGT
Ga0066706_1101732513300005598SoilVSLATETTARPAGNFRVTRSQRNVAWTGAGALIVVVVLAMFPYIVYSGTTAILVQAF
Ga0070763_1000922353300005610SoilVTAVAETTARSAEKYRVTRSRRNVAWTGLGALVVVVVLA
Ga0070763_1014917813300005610SoilMTAVAETTGRSAEKYRVTRSRRNVAWTGLGALVVVV
Ga0068864_10136976023300005618Switchgrass RhizosphereMSVATETTTRSADKIRVTRSRRNMAWTGIGALVVVVVLALFPYIVY
Ga0066903_10914755613300005764Tropical Forest SoilMSVITDATARSGEKFKVTRSRRNVAWTGIGAAVVVVVLGVFPFYVKSGTLA
Ga0070717_1063944023300006028Corn, Switchgrass And Miscanthus RhizosphereVTAVAETTARSAEKYRVTRSRRNVAWTGLGALVVVVVLALFP
Ga0075029_10102445923300006052WatershedsMSLITETTARSAENIRVTRSRRNVAWTGVGALVVVVVLALFPYIV
Ga0075019_1010185313300006086WatershedsVSLATDSTTGAAEAFRVTRSRRNVTWTGLGALIVVVVFWLLPYIVYSGTTAILVQ
Ga0075019_1031002023300006086WatershedsMTVVTETNARSAEKYRITRSRRNVAWTGLGALVVVVVLALFPY
Ga0070715_1065023513300006163Corn, Switchgrass And Miscanthus RhizosphereMSVTTDATVRSEEKVKVTRSRRNVAWTGLGALVVVVVLALFPYIVYSGTTGI
Ga0075018_1079412123300006172WatershedsMSVVADTSVRSEENFRVTRSRRNVAWTGAGALIVVVVLALFPYIVYSGTTSLMVQ
Ga0070716_10067881213300006173Corn, Switchgrass And Miscanthus RhizosphereMSVVTDTPARSEENFRVTRSRRNVAWTGAGALIVVVVLALFPYIV
Ga0075014_10050776513300006174WatershedsVSLATDSTTGAAEAFRVTRSRRNVTWTGLGALIVVVVFWLLPY
Ga0070765_10047621913300006176SoilMSLATETSARRAEPFRVARSRRNVAWTGAGALIVIAVLAMFPYIVY
Ga0074059_1212612513300006578SoilVSLATETTTRPAGRFRVTRGRRNVAWTGLAALIVVV
Ga0074064_1181265723300006603SoilVSLATETTTRPAGRFRVTRGRRNVAWTGLAALIVVVVLA
Ga0079222_1108147023300006755Agricultural SoilMSVVTDTQVRSEEKIRVTRSRRNVAWTGLGALVVIV
Ga0066660_1068151223300006800SoilVSLVTQTSARPAAGFRIARSQRNVAWTGAVALIAVVVLAIF
Ga0079221_1029734413300006804Agricultural SoilVSVATETTAPSAERFRVTRSRRNVAWTGVGTLIVVVVLAFFPYIVYS
Ga0079220_1104842113300006806Agricultural SoilMSVVTDTPARSEENFRVTRSRRNVAWTGAGALIVVVVLALFPYIVYSGTTSLMVQ
Ga0075426_1116772223300006903Populus RhizosphereMSVVTDTPARSEENFRVTRSRRNVAWTGAGALIVVVVLAL
Ga0116220_1030670313300009525Peatlands SoilMTAVAETTARSAEKYRVTRSRRNVAWTGLGALVVVAVLALFPYLVGAGTETILVQAFIILTLA
Ga0105237_1069100423300009545Corn RhizosphereVSLATKTTARPAEGFRVTRGRRNVAWTGLVALIVVVVLALFPYIVYSGTTAILV
Ga0116125_114713123300009628PeatlandMTATTETTARSAEKYRVTRSRRNVAWTGAGALVVVVVLALFPYIVY
Ga0116224_1037498823300009683Peatlands SoilMTAVAETPARSAEKYRVTRSRRNVAWTGLGALVVVVVLALFPYVVGAG
Ga0126380_1212951013300010043Tropical Forest SoilVSLATETTARPAGRFRVTRSRRNVAWTGLAALIVVVVL
Ga0126373_1148694913300010048Tropical Forest SoilMTVATDTTTRSEEKFRVTRSRRNVAWTGAGALAVVVVLALFPYI
Ga0099796_1011185413300010159Vadose Zone SoilMVKEAPGRPAAEFRVTRSRRNVAWTGAGALIVVVVLAYFPYIV
Ga0134084_1041420123300010322Grasslands SoilVSLATETTVRPAENFRVTRSRRNMAWTVAVALIVVVVLAMFPYIV
Ga0134065_1024843013300010326Grasslands SoilMSVVTDTPARSEENFRVTRSRRNVAWTGAGALIVVVVLALFPYIVYSGTTSLMVQA
Ga0126370_1046386513300010358Tropical Forest SoilMSVITDATARSGEKFKVTRSRRNVAWTGIGAAVVV
Ga0126370_1239386413300010358Tropical Forest SoilVSLATETTARSAEKFRVTRSQRNVAWTAAVALIVVVVFAMFPYI
Ga0126372_1039448913300010360Tropical Forest SoilVSLATETTARSAEKFRVTRSQRNVAWTAAVALIVV
Ga0126372_1217571423300010360Tropical Forest SoilVSLVTETAVRPAEGFRVTRSRRNVVWTGAGALIVVV
Ga0126378_1067346313300010361Tropical Forest SoilMTVATDTTTRSEEEFRVTRSRRNVAWTGAGALAVVVVL
Ga0126378_1207933113300010361Tropical Forest SoilMSVVTDATARSGERLKVTRSRRNVAWTGIGAAVVVVVLGVFPFY
Ga0126378_1306359513300010361Tropical Forest SoilVSVVTDAATGSAAGFRVTRSRRNVAWTGIGALVVVVVLAMFPYIVYSGTSAILVQAFIVLTLA
Ga0126379_1010600043300010366Tropical Forest SoilVSLVTETTVRPAEGFRVTRSRRNVVWTGAGALIVVVVL
Ga0134128_1306502613300010373Terrestrial SoilVSLATETTARPVEQFRVSRSRRNVIWTGAGALIVVVVLALF
Ga0126381_10151001413300010376Tropical Forest SoilVSVATEPTAPPAERFRVTRSRRNVAWTGVGALIAVVVLAL
Ga0136449_10296837513300010379Peatlands SoilMSVATETTARSAENIRVTRSRRNVAWTGVGALVVVVVLA
Ga0136449_10311073223300010379Peatlands SoilMSLATETTARSAEKYRVTRSRRNVAWTGLGALAVVVVLALF
Ga0136449_10405326913300010379Peatlands SoilMTVVTETNARSAEKYRVTRSRKNVAWTGLGALVVVVVLALFPYIVYSGTTSIMVQAFIVL
Ga0126344_131832513300010866Boreal Forest SoilMSVVAERPASSAEPDVRVTRSRRNVAWTGVGALVVVV
Ga0126361_1035463613300010876Boreal Forest SoilMSVATDTSVRSEENYRVTRSRRNVAWTGVGALIVVVVLALFPYIVYSGTTSLMVQG
Ga0153951_100618013300011404Attine Ant Fungus GardensVSLVTEPAARQAGSFRVTRSQRNVAWTGAVALIVVVVLAFFPYIVYSGT
Ga0120134_111285113300012004PermafrostMSLVSETTARPAGGFRVARSRRNVAWTGAAALIVVVVLALFPYLV
Ga0137381_1010981813300012207Vadose Zone SoilMSVVTDTPARSEENFRVTRSRRNVAWTGAGALIVVVV
Ga0137370_1013763433300012285Vadose Zone SoilMSVVTDTPARSEENFRVTRSRRNVAWTGAGALIVVVVLALFPYIVY
Ga0137371_1029621413300012356Vadose Zone SoilVSLATETTARPAENFRVARSRRNVVWTGGVALIVVVVLALFPYIVYSGTTAVL
Ga0137361_1058631023300012362Vadose Zone SoilVSLATETTARPAENFRVARSRRNVVWTGGVALIVVVVLALF
Ga0137390_1154622423300012363Vadose Zone SoilMSLVSQTTARPAEGFRVARSRRNVAWTGAAALIVVVVLAMFPYIV
Ga0157328_102367013300012478Arabidopsis RhizosphereMSVVTDTPARSEENFRVTRSRRNVAWTGAGALIVVVVLALFPYI
Ga0137359_1056195913300012923Vadose Zone SoilMSVATDTPARSEENFRVTRSRRNVAWTGAGALIVV
Ga0137404_1105189513300012929Vadose Zone SoilMVTETTARSAEKFRVTRSRRNVAWTAAGALIVIVVLAMLPYIVYS
Ga0126369_1216246123300012971Tropical Forest SoilMSVATETTARSAEKIRVTRSRRNMAWTSIGALVVVVVLALFPY
Ga0134076_1054272613300012976Grasslands SoilMSVVTDTPARSEENFRVTRSRRNVAWTGAGALIVVVVLALFPYIVYSGTTS
Ga0134087_1030363413300012977Grasslands SoilMSLVTETTARPAERFRVTRSRRNVVWTGAAGLIVVVVLAL
Ga0164309_1130483113300012984SoilMSVVTDSQARSEEKIRVTRSRRNVAWTGIGALVVVVVLALFPYIVYSGTTTIMVQAFIV
Ga0164308_1201510323300012985SoilMSLATETTIRPEESFRVTRSRRNMAWTVAVAVIVIVVLAMFPYIVYSGTTAI
Ga0157369_1081721313300013105Corn RhizosphereMSLATDITTTPAAGFRVARSRRNVAWTGAAALIVVVVL
Ga0157369_1188915823300013105Corn RhizosphereVSLATKTTARPAEGFRVTRGRRNVAWTGLVALIVVVVLALFPYIVYSGTTAILVQA
Ga0163162_1113802613300013306Switchgrass RhizosphereVSLATKTTARPAEGFRVTRGRRNVAWTGLVALIVVVVLALFPYIVYSGTSAILVQAF
Ga0157372_1082447713300013307Corn RhizosphereMSVATETTTRSADKIRVTRSRRNMAWTGIGALIVVVVLALFPYI
Ga0134078_1040879413300014157Grasslands SoilVSLATETTARRAEGFRVARSRRNVAWTGLVALIVV
Ga0181526_1078437813300014200BogMSVATETHARSEENYRVTRSRRNVAWTGAGALIVVVVLALFPYI
Ga0134085_1046692013300015359Grasslands SoilVSLATESTARSAQKFRVTRSRRNVAWTGAVALIVVVVLA
Ga0182035_1196576323300016341SoilVSLATETTTRPAGKFRVTRSQRNVAWTGVAALIIVVVFAILPYIVYSSTTSILVQAFIVLTLAT
Ga0182040_1091281213300016387SoilMSVVTETTVRSAEKFRVTRSRRNVAWTGIGALIVVVVLALFPYIVY
Ga0182037_1071240613300016404SoilVSVATEITAPSEERFRVTRSRRNVAWTGVGALIVVVVLALFPYIVYSGTTAILVQ
Ga0182037_1182580923300016404SoilVSLATETTARPAEKFRVTRSRRNVAWTGAVALIVVVVLAMFPYIVYS
Ga0182037_1204810123300016404SoilVSLATETTARSAEKFRVTRSQRNVAWTGAVALIIVVVLAMFPYIVYSGTTAILVQAF
Ga0187814_1000858953300017932Freshwater SedimentVTAVAETTARSAEKYRVTRSRRNVAWTGLGALVVVVVLALFPYVVGAG
Ga0187814_1019495413300017932Freshwater SedimentVSVVTETTARSAERFRVTRSRRNVAWTGIGALIVVVVLA
Ga0187809_1028042513300017937Freshwater SedimentMSVLTDATARSGENLRVTRSRSNVAWTGIGAIIVIVVLAAFPYYIAS
Ga0187809_1043275923300017937Freshwater SedimentMTAVAETPARSAEKYRVTRSRRNVAWTGLGALVVVVVL
Ga0187775_1003541533300017939Tropical PeatlandVSLATESTARSAGKFRVTRSRRNVAWTGAVALIVVVVLALFPYIVYSGTT
Ga0187808_1059854813300017942Freshwater SedimentMSVLTDATARSGENLRVTRSRRNVAWTGIGAIIVIVVLAAFPYYIASGTLG
Ga0187817_1016276913300017955Freshwater SedimentMTAVAETTARSAEKYRVTRSRRNVAWTGLGALVVVVVLALFPYVVGAGTETILVQ
Ga0187783_1040450823300017970Tropical PeatlandMSLATETTARPAEQFRITRSRRNVAWTGAVALIIVVVFAM
Ga0187783_1136671723300017970Tropical PeatlandVSLATETAARPAESFRVTRSQRNVAWTGAVALIVVVVFAFLPYIVYSGTTS
Ga0187781_1012712013300017972Tropical PeatlandVSVATRAETRAAEGFRVTRSQRNVIWTGAAALVVVVVFGLAPFEVHSGTTAILVQGFIVLTLASM
Ga0187780_1060006823300017973Tropical PeatlandMTAIAETTARSAEKYRVTRSRRNVAWTGLGALVVVVVLALFPYAVGAGTETILVQ
Ga0187782_1010928413300017975Tropical PeatlandVSVATRAETRAAEGFRVTRSQRNVIWTGAAALVVVVVFGLAPFEVHSGTTAILVQGFI
Ga0187767_1037947623300017999Tropical PeatlandVSLATESAARSAGKFRVTRSRRNVAWTGAVALIVVVVLALFPYIVYSC
Ga0187815_1051417513300018001Freshwater SedimentMTAVAETTARSAEKYRVTRSRRNVAWTGLGALVVVVVLALFP
Ga0187805_1038437123300018007Freshwater SedimentVSAAASTTTLPAEGFRVTRSRRNIAWTGAGAVIVVVVLA
Ga0187805_1052980313300018007Freshwater SedimentMSVTTDATVRSEDKVKVTRSRRNVAWTGLGALVVV
Ga0187871_1019009113300018042PeatlandMTATTETTARSAEKYRVTRSRRNVAWTGAGALVVVVVLALFPYIVYSSTTSIMVQAFIILTMACMW
Ga0187851_1081453323300018046PeatlandMSVATETTARSAEKIRVTRSRRNMTWTGGGALVVVVVLALFPYIVYSGT
Ga0187774_1050923723300018089Tropical PeatlandVSLATESTARSAGKFRVTRSRRNVAWTGAVALIVVLVLAMFPYLVHSGTTAILVQAFIVLTMA
Ga0193724_105757723300020062SoilMSVVTDTPARSEENFRVTRSRRNVAWTGAGALIVVV
Ga0210399_1018264713300020581SoilMSVVTDSSVRSEENFRVTRSRRNVAWTGAGALIVVVVLALFPYIVYSGTTSLMVQA
Ga0210395_1001703013300020582SoilVTAVAETTARSAEKYRVTRSRRNVAWTGLGALVVVVVLALFPYIVGAG
Ga0210395_1032158413300020582SoilMTAVAETTGRSAEKYRVTRSRRNVAWTGLGALVVVVVLALFPYLVGAGTE
Ga0210401_1135723723300020583SoilVTAVAETTARSAEKYRVTRSRRNVAWTGLGALVVVVVLALFPYIVGAGTETILVQAFII
Ga0210404_1046190823300021088SoilVSLVTEPTARQAESFRVTRSQRNVAWTGAVALIVVVVLAFF
Ga0210400_1017641713300021170SoilVTAVAETTARSAEKYRVTRSRRNVAWTGLGALVVVVVLALFPYIVGAGT
Ga0210400_1149559823300021170SoilVSMVTETTARSAGKFRVTRSRRNVAWTAAGALIVIVVLAM
Ga0210396_1002289813300021180SoilVTAVAETTPRSAEKYRVTRSRRNVAWTGLGALVVVVVLALFPYIVGAGTET
Ga0210396_1015007013300021180SoilVTAVAETTARSAEKYRVTRSRRNVAWTGLGALVVVVVLALFPY
Ga0210396_1075487623300021180SoilMSVMTEATLRSGEKSRVTRSRRNVAWTGIGAVLIVVILAAFPYYVKSGV
Ga0210388_1002727353300021181SoilVTAVAETTARSAEKYRVTRSRRNVAWTGLGALVVVVVLALFPYIVGAGTETILVQAFIIL
Ga0210388_1123321113300021181SoilVTAVAETTARSAEKYRVTRSRRNVAWTGLGALVVVVVLALFPYIVGAGTETILV
Ga0213881_1005726333300021374Exposed RockVSIATETTPVSGERFRVTRSRRNVAWTGGGAVIVVAV
Ga0213875_1024673923300021388Plant RootsMSVATQTTARSEEKFRVTRSRRNVAWTGAGALIVVVVLALFPYVV
Ga0210393_1031660613300021401SoilMTAVAETTGRSAEKYRVTRSRRNVAWTGLGALVVVVVLALFPYLVGAGTETILVQAFIILTLASMW
Ga0210393_1166499613300021401SoilVSMVTETTARSAGKFRVTRSRRNVAWTAAGALIVIVVLAMLPYIVYSGTTA
Ga0210389_1074416923300021404SoilVSLVTEPTARQAGSFRVTRSQRNVAWTGAVALIVVVVLAF
Ga0210387_1147828323300021405SoilVTAVAETTPRSAEKYRVTRSRRNVAWTGLGALVVVVVLALFPYIVGAGTETIL
Ga0210383_1059615713300021407SoilMSVTTGATVRSEENLKVTRSRRNVAWTGLGTLVVVVVLALFPYIVYSGTTAIMVQGLIVL
Ga0210383_1113362623300021407SoilMTLAPETGMIEAPEIRVARSQRNVAWTGVGALAVVAVLAYFPYFVYSG
Ga0210391_1074856623300021433SoilMTATTETTARSAEKFRVTRSRRNVAWTGAGVLIVVV
Ga0210391_1079324513300021433SoilVTAVAETTARSAEKYRVTRSRRNVAWTGLGALVVVVV
Ga0210391_1114142613300021433SoilVSLATETATHSAGKFRVTRSQRNVAWTGVVALIVVVVLAMFPYIVYSSTTAIL
Ga0210390_1007838953300021474SoilVTAVAETTARSAEKYRVTRSRRNVAWTGLGALVVVV
Ga0210390_1076707323300021474SoilVTAVAETTARSAEKYRVTRSRRNVAWTGLGALVVVVVLALF
Ga0210390_1121954923300021474SoilVSLATETATHSAGKFRVTRSQRNVAWTGVVALIVVVVLAMFPYI
Ga0210398_1019171933300021477SoilVTAVAETTARSAEKYRVTRSRRNVAWTGLGALVVVVVLALFPYLVG
Ga0210398_1155554923300021477SoilMTAVAETTGRSAEKYRVTRSRRNVAWTGLGALVVVVV
Ga0210410_1076069223300021479SoilVTAVAETTARSAEKYRVTRSRRNVAWTGLGALVVVVVLALFPYIVG
Ga0126371_1165589323300021560Tropical Forest SoilMSVVTDATARSGEKFKVTRSRRNVAWTGIGAAVVVVVLGVFPFYVKSGTLAI
Ga0126371_1266930913300021560Tropical Forest SoilVSLVTESTAARPAPDFRVARSQRNVVWTGVVALVIVAVLAYFPYIFYAGTTTILVQAFIVLT
Ga0213851_148211013300021860WatershedsVSLATDSTTRAAEAFRVTRSRRNVTWTGLGALIVVVVFW
Ga0213853_1071478223300021861WatershedsVSLATDSTTGAAEAFRVTRSRRNVTWTGLGALIIVVVFWLLPYIV
Ga0224712_1026661313300022467Corn, Switchgrass And Miscanthus RhizosphereMSVATETTTRSADKIRVTRSRRNMAWTGIGALVVVVVLA
Ga0212123_1066548713300022557Iron-Sulfur Acid SpringVTAVAETTARSAEKYRVTRSRRNVAWTGLGALVVVVVLALFPYLVGAGTETILVQAFI
Ga0208194_106146823300025412PeatlandVSLATETTTRPAEGFRVTRSRRNIAWTGTGALIVVAVLAMLPYIVYSGTTAILVQ
Ga0207692_1014549633300025898Corn, Switchgrass And Miscanthus RhizosphereMSLVTDTSVRSEENFRVTRSRRNVAWTGAGALVVVVVLALFPYIVYSGTTSLMVQGFI
Ga0207710_1031584713300025900Switchgrass RhizosphereVSLATKTTARPAEGFRVTRGRRNVAWTGLVALIVVVVLALFPYIVYSGTT
Ga0207685_1001479443300025905Corn, Switchgrass And Miscanthus RhizosphereMSLATDITTTPAAGFRVARSRRNVAWTGAAALIVVVVLAFFPYIVYAGTTTILVQAFIVL
Ga0207654_1009416633300025911Corn RhizosphereMSVVTDTPARSEENFRVTRSRRNVAWTGVGALIVV
Ga0207671_1060936713300025914Corn RhizosphereVSLATKTTARPAEGFRVTRGRRNVAWTGLVALIVVVVLALFP
Ga0207660_1053277213300025917Corn RhizosphereVSLATKTTARPAEGFRVTRGRRNVAWTGLVALIVV
Ga0207664_1087096023300025929Agricultural SoilVSVVTDTPARSEENFRVTRSRRNVAWTGAGALIVVVVLA
Ga0207661_1119425723300025944Corn RhizosphereMSVATETTTRSADKIRVTRSRRNMAWTGAGALVVVVVLALFPYIVY
Ga0207679_1033254713300025945Corn RhizosphereMSVATETTTRSADKIRVTRSRRNMAWTGAGALVVVVVLALFPYIVYSGTT
Ga0209155_120977923300026316SoilMSLVTETAARPAERFRVTRSRRNVVWTGAAGLIVVV
Ga0257160_101142113300026489SoilVSMVTETAARSAEKFRVTRSRRNVAWTAAGALIVIVVLAILPYLVY
Ga0257156_101603713300026498SoilVSLATETTARPAEHFRVARSRRNVVWTGGVALIVVVVLALFPYIVYSGTTA
Ga0257156_106945523300026498SoilVSAVTDAATGSAGGFRVTRSRRNVAWTGLGALIAVAVLAAFP
Ga0208761_101517823300026995SoilVSLATETTVRPAESFRVARSRRNVAWTGAVALIVIVVLAMFPYIVY
Ga0208369_100145933300026998Forest SoilMTAVAETTGRSAEKYRVTRSRRNVAWTGLGALVVVVVLALFPYLVGAGTETILVQAFIIL
Ga0207800_101878013300027043Tropical Forest SoilMSVVTETTARSEEKFRVTRSRRNVAWTGAGALIVVVVLALFPY
Ga0208987_101501713300027496Forest SoilVSMVTETTARPAENFRVTRSRRNVAWTAAGALIVIVVLAIL
Ga0209008_106286623300027545Forest SoilVSETVVAETTARSAEKYRVTRSRRNVAWTGLGALVVVVVLALFPYLVGAG
Ga0209525_102694233300027575Forest SoilVSETVVAETTARSAEKYRVTRSRRNVAWTGLGALVVVVVLALFPYLVGA
Ga0208988_106980723300027633Forest SoilVSMVTETTARSAEKFRVTRSRRNVAWTAAGALIVIVVLAILPYLVYSGTTA
Ga0209420_109160523300027648Forest SoilMTATTETTARSAEKYRVTRSRRNVAWTGAGALIVVVVLALFPYIVYSSTTSIMVQAFII
Ga0208696_108239023300027696Peatlands SoilMTAVAETTARSAEKYRVTRSRRNVAWTGLGALVVVVVLALFPYIV
Ga0208696_120305923300027696Peatlands SoilMTAVAETPARSAEKYRVTRSRRNVAWTGLGALVVVVVLALFPYVVGAGTETILVQGFIIL
Ga0209693_1020410613300027855SoilVTAVAETTARSAEKYRVTRSRRNVAWTGLGALVVVVVLALFPYIVGA
Ga0209167_1064555713300027867Surface SoilMSTVTQTTARSAEKFRVTRSRRNVAWTWAGALVVVVVLWRLPYI
Ga0209169_1039153313300027879SoilMSLATESAAELAGDVRVTRSRRNVAWTGAGALVAVIVLAYLPYI
Ga0209275_1090004713300027884SoilMTATTETTARSAEKYRVTRSRRNVAWTGAGAVIVVVVLALFPYIVYSSTTSIMV
Ga0209380_1008129613300027889SoilVSMVTETTARSAGKFRVTRSRRNVAWTAAGALIVIVVLAMLPYIV
Ga0209069_1022447513300027915WatershedsMSLATETTARSAEKYRVTRSRRNVAWTGLGALAVVVVLALFPYIVY
Ga0302219_1021681613300028747PalsaMTATTETTARSAEKFRVTRSRRNVAWTGAGALIVVVVLALFPYIVYSSTTSIMVQAFIILTMAC
Ga0307288_1027068723300028778SoilMSVVTDTPARSEENFRVTRSRRNVAWTGAGALIVVVVLALFPYIVYSGTTSLM
Ga0302232_1005298833300028789PalsaMSTVAESQARSVEKYRVTRSRRNVAWTGAGALIVVVVLALFPYIVYSSTTSIMVQAFIILTMA
Ga0302226_1014621413300028801PalsaMTATTETTARSAEKYRVTRSRRNVAWTGAGALIVVVVLALFPYIVYSSTTSIMVQAFIIL
Ga0308309_1056394413300028906SoilMSVTTDATVRSEENLKVTRSRRNVAWTGLGALVVVVVLALFPYIVYSGT
Ga0308309_1122374623300028906SoilVSVVTERQAPAAAQFRVTRSQRNVAWTGGVALVVV
Ga0311340_1081659923300029943PalsaMTAMAEGTVRSPGNELRVTRSRRNVAWSGLGALVVVVVLFLFPY
Ga0311371_1110542813300029951PalsaMTIAAETNVRSAENYRVTRSRRNVAWTGLGALVVVVVLALFP
Ga0302178_1052646813300030013PalsaMSTVAESQARSVEKYRVTRSRRNVAWTGAGALIVVVVLALFPYIVYSSTTSIMVQAFIILTMACMW
Ga0302177_1006776113300030053PalsaMTAIAETTARSAEKYRVTRSRRNVAWTGLGALVVVVVLALFPYVVGAGTETVLVQAFIILTLA
Ga0302181_1006507013300030056PalsaMSVVAETTARSEERYRVTRSRRNVAWTGAGALIVVVVLAFFPYIV
Ga0302181_1031961713300030056PalsaMTIAAETNVRSAENYRVTRSRRNVAWTGLGALVVVVVLALFPYIVYA
Ga0302179_1014653813300030058PalsaMTATTETTARSAEKYRVTRSRRNVAWTGAGALIVVVVLALFPYIVYSSTTSIM
Ga0310037_1048575223300030494Peatlands SoilMTAVAETTARSAEKYRVTRSRRNVAWTGLGALVVVVVLALFPYVVGPGTDTIMVQAFIILTLASM
Ga0311370_1029206613300030503PalsaMSTVAESQARSVEKYRVTRSRRNVAWTGAGALIVVVVLALFPYIVYSSTTSIMVQAFIILTMARMWNL
Ga0311356_1058838113300030617PalsaMTAVADTADRPAERYRVTRSRRNVAWTGAGALAVVVVLALFPYIVYAGTTTIMVQ
Ga0311356_1161453613300030617PalsaMTATTETTARSAEKYRVTRSRRNVAWTGAGAVIVVVVLALFPYIVYSSTTSIMVQAFIIL
Ga0310038_1013183813300030707Peatlands SoilMTAVAETTARSAEKYRVTRSRRNVAWTGLGALVVVVVLALFPYVVGPGTDTIMVQAFIILTLAS
Ga0302311_1043836423300030739PalsaMSTVAESQARSVEKYRVTRSRRNVAWTGAGALIVVVVLALFPYIVYSI
Ga0265461_1384690513300030743SoilMSLVTEKATPVAADIRVTRSQRNVAWTGIVALVIVGVLAYFPYIVYAGTTTILVQAFIVW
Ga0302308_1010268213300031027PalsaMSTVAESQARSVEKYRVTRSRRNVAWTGAGALIVVVVLALFPYIVYSSTTSIMVQAFII
Ga0302308_1010887033300031027PalsaVTAVAETTARSAEKYRVTRSRRNVAWTGLGALVVVVVL
Ga0170834_11005594613300031057Forest SoilVSSVSETTVRSEKKDPRVTRSRGNVAWTGVGAVVVVAVFAYFPYIY
Ga0265760_1016819113300031090SoilVSLATETATHSAGKFRVTRSQRNVAWTGVVALIVVVVLAMF
Ga0170824_11990376113300031231Forest SoilVSLAADTNALPADAFRVARSRRNVAWTGVGALVVVVILALFPY
Ga0318516_1000956063300031543SoilVSLATETTARPAEKFRVTRSRRNVAWTGAVALIVVVVLAMFPYIVYSGTTA
Ga0318534_1003282353300031544SoilMSVVTETTARSEEKFRVTRSRRNVAWTGGGALIVVVVLALFPYLVGAGVWTIMVQAFIVLTLASM
Ga0318538_1009785033300031546SoilVSLATETTTLPAERFRVTRSRRNVAWTGVGALIVVVVLAY
Ga0318571_1008869923300031549SoilMSVVTETTARSEEKFRVTRSRRNVAWTGGGALIVVVVLALFPYLVGAGVW
Ga0318528_1032897123300031561SoilVSLATETTARSAEKFRVTRSQRNVAWTGAVALIIVVVLAMFPYIVYSGT
Ga0318515_1009847713300031572SoilMSVITDATARSGEKFKVTRSRRNVAWTGIGAAVVVVVLGVFP
Ga0318515_1019842523300031572SoilMSVVTETTARSEEKFRVTRSRRNVAWTGGGALIVVVVLALFPYLVGA
Ga0318515_1030256113300031572SoilMSVVTDTQVRSEERFRVTRSRRNVAWTGLGALVVVVVLALFPYIVYSGT
Ga0318555_1014897213300031640SoilMSVVTETTARSEEKFRVTRSRRNVAWTGGGALIVVVVL
Ga0318555_1030413413300031640SoilMSLVAEAGTQPVAEFRVTRSRRNVAWTGAGALIVVVVLALVPY
Ga0318555_1039157923300031640SoilVSLVAETAAPATERFRVSRSRRNVAWTGAGALIVVVVLALFPYIVYSGT
Ga0318555_1082022313300031640SoilVTLATETTTRPARKFRITRSQRNVAWTGVAALIIVVVFAMLPYIVYSSTTAILVQAF
Ga0318542_1009168313300031668SoilMSVITDATARSGEKFKVTRSRRNVAWTGIGAAVVVVVLGVFPFYVKSGTLAILVQG
Ga0318542_1018998323300031668SoilMSVVTETTARSEEKFRVTRSRRNVAWTGGGALIVVVVLALFPYLVGAGVWTIMVQA
Ga0318542_1051531513300031668SoilVSLVAETPPRSAERFRVTRSRRNVAWTGAGALIVVVVLALFPYIVYSGTTAI
Ga0318542_1058699213300031668SoilVSLATETTARPAEKFRVSRSQRNVAWTGAVALIIVVVFAMLPYIVYSGTTSVLVQG
Ga0318574_1012878313300031680SoilVSLITETTAPAAERFRVTRSRRNVAWTGVGALIIVVVLA
Ga0318574_1013180233300031680SoilVSLATDTTARQAGTFRVTRSRRNVAWTGAGALIVVVVLALFPYIVYS
Ga0318574_1027144913300031680SoilVSLATETTTRPAGKFRVTRSQRNVAWTGVVALIVVVVFAMLPYV
Ga0318572_1055411313300031681SoilMSVVTETTARSEDNFRVTRSRRNVAWTGGGALIVVVVLA
Ga0318560_1024931623300031682SoilVSLATETTARPAENFRVTRSRRNVAWTGAVALIVVVVLAMLPY
Ga0318560_1055525923300031682SoilMSVIADATARSGEKFKVTRSRRNVAWTGIGAAVVVVVLGVFPFYIK
Ga0310686_10605086413300031708SoilMSTVTGTTARSAEKFRVTRSRRNVAWTGVGAVIAVVVLERLPYFVYSGTTTILVQAFI
Ga0318496_1023331123300031713SoilVSLVTETTARPVEGFRVTRSRRNVVWTGAGALIVVVVLALFPYIVYSGTTAIM
Ga0318496_1065691213300031713SoilVSLVAETAAPATERFRVSRSRRNVAWTGAGALIVVVVLALFPYIVYSGTTAIL
Ga0307474_1106860023300031718Hardwood Forest SoilMSLATETSARPAAGFRVTRSQRNVAWTGAAALVVVVVLAMFPYFVYSGTTSV
Ga0306917_1079434913300031719SoilMSVVTETTVRSAEKFRVTRSRRNVAWTGVGALVVVV
Ga0318500_1006275113300031724SoilVSLATDTTARQAGTFRVTRSRRNVAWTGAGALIVVVVLALFPYIVYSGTTAILVQAF
Ga0318500_1023013723300031724SoilMSVVTDTQARSEEKIRVTRSRRNVAWTGLIALAVVVVLALFPYIVYS
Ga0318500_1025010823300031724SoilMSVITDATARSGEKFKVTRSRRNVAWTGIGAAVVVVVLGVFPF
Ga0318501_1070090113300031736SoilMSVVTDATARSGERLKVTRSRRNVAWTGVGAIVLVAVLGVFPFYVKSGTLAI
Ga0306918_1010292913300031744SoilVSLVTEATARPAENFRVTRSRRNVAWTGAGALVVVVVLAMFPYIVYSGTTAILVQA
Ga0306918_1070273613300031744SoilMSVVTDTQVRSEERFRVTRSRRNVAWTGLGALVVVVVLALFPYI
Ga0306918_1147922423300031744SoilVSLATETTARPAEKFRVSRSQRNVAWTGAVALIIVVVFAMLPYIVYSGTTSVLVQGFIVL
Ga0318502_1030046713300031747SoilVSLATETTARPAENFRVTRSRRNVAWTGAVALIVVVVLAMLPYLVYSGTTAVLV
Ga0318502_1034205513300031747SoilVSLVAETPPRSAERFRVTRSRRNVAWTGAGALIVVVVLALFPYIVYSGTT
Ga0318502_1103006313300031747SoilVSLATEPATRPAGKFRVTRSQRNVAWTGVAALVIVVVFAMLPYIVYSSTTSI
Ga0318492_1024990813300031748SoilMTAVAETTARSAEKYRVTRSRRNMAWTGLGALVIVVVLALFPYLVGAGTETVLVQA
Ga0318494_1032999123300031751SoilMSVITDATARSGEKFKVTRSRRNVAWTGIGAAVVVVVLGVFPFYIKSGTLAIM
Ga0307475_1103001923300031754Hardwood Forest SoilVSLATETTARSAEKFRVTRSQRNVAWTGAVALIVVVVFAMLPYIVYSGTT
Ga0318537_1015884113300031763SoilMSVVTETTARSEEKFRVTRSRRNVAWTGGGALIVVVVLALFPYLVGAGVWTIMVQAFIVLTLAS
Ga0318535_1016675723300031764SoilVSLATDTTARQAGTFRVTRSRRNVAWTGAGALIVVVVLALFPYIVY
Ga0318554_1025495113300031765SoilMSVVTETTVRSEEGFRVTRSRRNVAWTGVGALIVVVVLALFPYFVGA
Ga0318554_1068982313300031765SoilMSVVTDTSVRSAEKIRVTRSRRNVAWTGVGVLAVVVVLALFPYIVYSG
Ga0318509_1083540513300031768SoilMSVATETAARSEENYRVTRSRRNVAWTGVGALAVVVVLALFPYIVYSGTTTIM
Ga0318521_1004840913300031770SoilVSLVAETPPRSAERFRVTRSRRNVAWTGAGALIVVVVLALFPYIVYSGTTAILVQAF
Ga0318521_1008376333300031770SoilMSVVTETTARSEEKFRVTRSRRNVAWTGGGALIVVVVLALFPYLVGAGVWTIMV
Ga0318546_1090471123300031771SoilMSVVTDATARSGEKYKVTRSRRNVAWTSIGAVVVVVVLGVFPFYVKSGTLAILVQGVSRPSSGSARTSC
Ga0318543_1026289813300031777SoilVSLATDTTARQAGTFRVTRSRRNVAWTGAGALIVVVV
Ga0318543_1037173813300031777SoilVSLVAETPPRSAERFRVTRSRRNVAWTGAGALIVVVVLALFPY
Ga0318498_1013395833300031778SoilVSLATETAARPAEGFRVTRSRRNVAWTGAGALIVVVVLALFPY
Ga0318498_1025910113300031778SoilMSVVTETTARSEEKFRVTRSRRNVAWTGGGALIVVVVLALFPYLVGAGVWTI
Ga0318498_1029520413300031778SoilMSVVTDTQVRSEERFRVTRSRRNVAWTGLGALVVVVVLALFPYIVYSGTTTIMVQA
Ga0318566_1000520663300031779SoilVSLVTEATARPAENFRVTRSRRNVAWTGAGALVVVVVLAMFPYIV
Ga0318547_1082942423300031781SoilMSVATETAARSEENYRVTRSRRNVAWTGVGALAVVVVLALFPYIVYSGTTTIMVQGFII
Ga0318552_1021699823300031782SoilMSVVTDTQVRSEERFRVTRSRRNVAWTGLGALVVVVVLALFPYIVYS
Ga0318548_1017735723300031793SoilMSVVTDTQVRSEERFRVTRSRRNVAWTGLGALVVVVVLALFPY
Ga0318548_1018870423300031793SoilVSLVAETAAPATERFRVSRSRRNVAWTGAGALIVVVVLALFPYIVY
Ga0318548_1060960113300031793SoilMSVITDATARSGEKFKVTRSRRNVAWTGIGAAVVVVVL
Ga0318557_1006197113300031795SoilMSVVTDATARSGEKFKVTRSRRNVAWTSIGAAVVVVVLGVFP
Ga0318557_1009249333300031795SoilVSLATEPATRPAGKFRVTRSQRNVAWTGVAALVIVVVFAMLPYIVYSSTTSILV
Ga0318576_1009384033300031796SoilVSLVTEATARPAENFRVTRSRRNVAWTGAGALVVVV
Ga0318576_1015544423300031796SoilMSVVTETTARSEENFRVTRSRRNVAWTGGGALIVVVVLA
Ga0318576_1019142323300031796SoilMSVITDATARSGEKFKVTRSRRNVAWTGIGAAVVVV
Ga0318576_1021453423300031796SoilMSVVTETTVRSAEKFRVTRSRRNVAWTGIGALVVVVVLALFPYLVYSGTTTIMVQAFIL
Ga0318576_1025281623300031796SoilVSVATEITAPSEERFRVTRSRRNVAWTGVGALIVVIVLALFPYIVYSGT
Ga0318550_1048174623300031797SoilVSLVTETTARPVEGFRVTRSRRNVVWTGAGALIVVVVLALFPYIVYSGTTAILVQA
Ga0318523_1017033623300031798SoilMSVVTDTRVRSGEKFRVTRSRRNVVWTGLGALVVVVVLALFPYIVYSGT
Ga0318565_1051483113300031799SoilMSVVTETTARSEEKFRVTRSRRNVAWTGGGALIVV
Ga0318565_1060763713300031799SoilVSLATETTTRPAGKFRVTRSQRNVAWTGVVALIIVVVFAMLPYI
Ga0318497_1043061923300031805SoilMSVVTDATARSGERLKVTRSRRNVAWTGVGAIVLVAVLGVFPFYVKSGTLAILVQGLIILTLASMW
Ga0318568_1010974633300031819SoilVSLVAETPPRSAERFRVTRSRRNVAWTGAGALIVVVVLAL
Ga0318567_1053400613300031821SoilMTAVAETTARSAEKYRVTRSRRNMAWTGLGALVIVVVL
Ga0307478_1078900913300031823Hardwood Forest SoilMTAVAETTARSAEKYRVTRSRRNVAWTGLGALVVVVVLALFPY
Ga0307478_1095816723300031823Hardwood Forest SoilVTAVAETTARSAEKYRVTRSRRNVAWTGLGALVVVVVLALFPYIVGAGTETILVQAF
Ga0318564_1038186523300031831SoilVSLATETTTRPAGKFRVTRSQRNVAWTGVVALIIVVVFAMLPYIVYSGTTSILVQA
Ga0318499_1003053313300031832SoilVSLATETTALAAEQFRVTRSRRNVAWTGVGALIVVVVLAYFPYIVYSGTTAILVQA
Ga0318499_1012067613300031832SoilVSLVAETPPRSAERFRVTRSRRNVAWTGAGALIVVVVLALFPYIVYSGTTAILVQA
Ga0318511_1041094223300031845SoilVSVATEITAPSGERFRVTRSRRNVAWTGVGALIVVVVLALFPYIVYSGTTAILVQAFI
Ga0318511_1045891113300031845SoilVSLVTETTARPVEGFRVTRSRRNVAWTGVGALIVVVVLALFPYIVYSGTTAILVQ
Ga0318512_1062643613300031846SoilVSLVAETPPRSAERFRVTRSRRNVAWTGAGALIVVVVLALF
Ga0318495_1022827623300031860SoilVSLATETTALPAERFRVTRSRRNIAWTGVGALIVVVVLAYFPYIVYSGTTAILV
Ga0318544_1040274923300031880SoilVSLVTETTARPVEGFRVTRSRRNVVWTGAGALIVVVVLALFPYIVYSGT
Ga0306925_1033332433300031890SoilMSVVTETTARSEDNFRVTRSRRNVAWTGGGALIVVVVLALFPY
Ga0306925_1098381713300031890SoilMSVVTDTQVRSEEKIRVTRSRRNVAWTGLVALAVVVVLALFPYIVYSGTTTIMVQA
Ga0306925_1223837523300031890SoilVSVATEITAPPAERFRVTRSRRNVAWTGVGALIVVVVLALFPYIVYSGTTTIL
Ga0318536_1026815413300031893SoilMSVVTETTVRSAEKFRVTRSRRNVAWTGIGALVVVVVLALFPYLVYSGTTTI
Ga0318536_1033108023300031893SoilVSVATETTAPPAERFRVTRSRRNVAWTGVGALIAVVVLALFPYIVYAGT
Ga0318536_1054091623300031893SoilVSLATDTTARQAGTFRVTRSRRNVAWTGAGALIVVVVLA
Ga0318522_1005400033300031894SoilMSVIADATARSGEKFKVTRSRRNVAWTGIGAAVVVVVLGVFP
Ga0318522_1010644313300031894SoilVSLATDTTARQAGTFRVTRSRRNVAWTGAGALIVVVVL
Ga0318522_1017575213300031894SoilVSLVTETTARPVEGFRVTRSRRNVVWTGAGALIVVVVLALFPYIVYSGTTAIMVQAF
Ga0318551_1023598313300031896SoilMSVVTETTARSEEKFRVTRSRRNVAWTGGGALIVVVVLALFPYLVGAGVWTIMVQAFIVLTLASMW
Ga0318551_1088335413300031896SoilVTLATETTTRPARKFRITRSQRNVAWTGVAALIIVVVFAMLPYIVYS
Ga0318520_1017859733300031897SoilVSLATETTARPAEKFRVTRSRRNVAWTGAVALIVVVVLAMFPYIVYSGTTAILVQ
Ga0306923_1100264223300031910SoilVTLATETTTRPARKFRITRSQRNVAWTGVAALIIVVVFAMLPYIVYSSTTAILVQAFIVL
Ga0310912_1125533613300031941SoilMSVITDATARSGEKLKVTRSRRNVAWTGIGAAVVVVVLAFFPYFVYSGTTAIMVQGLIIL
Ga0310916_1057159923300031942SoilMSVVTDATARSGEKYKVTRSRRNVAWTSIGAVVVVVVLGVFPFYVKSGT
Ga0310909_1147691213300031947SoilMSVVTDATARSGEKFKVTRSRRNVAWTSIGAAVVVIVLGVFPFYVKSGTLAILVQGLIIL
Ga0306926_1014291953300031954SoilMSVVTETTARSEEKFRVTRSRRNVAWTGAGALIVVVVLALFP
Ga0318531_1012499313300031981SoilVSLATDTTARQAGTFRVTRSRRNVAWTGAGALIVVVVLALFPYI
Ga0318531_1015239823300031981SoilVSLVTEATARPAENFRVTRSRRNVAWTGAGALVVVVVLAMFPYIVYSGTTAIL
Ga0306922_1230497023300032001SoilVTLATETTTRPARKFRITRSQRNVAWTGVAALIIVVVFAMLPYIVYSST
Ga0318562_1015262513300032008SoilMSVVTDTQARSEEKIRVTRSRRNVAWTGLIALAVVVVLALFPYIVYSS
Ga0318562_1081890523300032008SoilVSLATEPATRPAGKFRVTRSQRNVAWTGVAALVIVVVFAMLPY
Ga0318563_1020647523300032009SoilMSVVTDTQVRSEEKIRVTRSRRNVAWTGLVALAVVVVLALFPYIVY
Ga0318563_1023108013300032009SoilMSVVTDATARSGEKFKVTRSRRNVAWTSIGAAVVVVVLGVFPFYVKSGTLAILVQG
Ga0318507_1013874523300032025SoilVSLVTETTARPVEGFRVTRSRRNVVWTGAGALIVVVVLALFPYIVYSGTTAIMVQA
Ga0318507_1015901823300032025SoilMSVITDATARSGEKFKVTRSRRNVAWTGIGAAVVVVVLGVF
Ga0310911_1032628723300032035SoilMSVVTETTARSEEKFRVTRSRRNVAWTGGGALIVVVVLALFPYLVGAGVWTIMVQAFIVLTL
Ga0318549_1005616733300032041SoilMSVVTETTVRSAEKFRVTRSRRNVAWTGIGALVVVVVLALFPYLVYSGTTTIMVQA
Ga0318558_1008288913300032044SoilVSVATEITAPSGERFRVTRSRRNVAWTGVGALIVVVVLALFPYIV
Ga0318506_1003046943300032052SoilVSLATETTARPAGTFRVTRSRRNVTWTGLGALIVVVVLGLAPYIVYSGTTAILVQAFI
Ga0318506_1053168613300032052SoilMSVVTDTSVRSAEKIRVTRSRRNVAWTGVGVLVVVVVLALFPY
Ga0318570_1054514623300032054SoilMSVITDATARSGEKFKVTRSRRNVAWTGIGAAVVVVVLGVFPFYVKSGTHAI
Ga0318505_1037984723300032060SoilVSVATEITAPSEERFRVTRSRRNVAWTGVGALIVVIVLALFPYIVYSGTTAILVQAF
Ga0318504_1016007913300032063SoilVSLATETTARSAEKFRVTRSQRNVAWTGAVALIIVVVLAMFPY
Ga0318510_1011950123300032064SoilMSVVTETTVRSEENFRVTRSRRNVAWTGIGALIVVVVLALFPYIVYSG
Ga0318510_1035532923300032064SoilVSLATETTARPAEKFRVTRSRRNVAWTGAVALIVVVVLAMFPYIVYSGT
Ga0318514_1003870343300032066SoilVSLVTEATARPAENFRVTRSRRNVAWTGAGALVVVVVLAMFPY
Ga0318514_1015895933300032066SoilVSLATETTARPAEKFRVSRSQRNVAWTGAVALIIVVVFAMLPY
Ga0318514_1062121713300032066SoilMSAATDATLRSGEKIKVTRSRRNVLWSSIGALVVVAVLFVFPFYVASGTLGIMIQALVVL
Ga0318553_1027784813300032068SoilMSVVTDTRVRSGEKFRVTRSRRNVVWTGLGALVVVVVLALFPYIVY
Ga0318553_1039978113300032068SoilMSVATETTARSEEKFRVTRSRRNVAWTGGGALIVVVVLALFPYLVGAGVW
Ga0318553_1047801823300032068SoilMSVATETAARSEENYRVTRSRRNVAWTGVGALAVVVVLALFPYIVYSGTTTIMVQGFI
Ga0318553_1065425213300032068SoilVSVATETTAPPAERFRVTRSRRNVAWTGVGALIAVVVLAL
Ga0318518_1009508333300032090SoilVSLVAETPPRSAERFRVTRSRRNVAWTGAGALIVVVVLALFPYI
Ga0318518_1070801313300032090SoilMSLATETPARSEETIRVTRSRRNVAWTGLGALVVVV
Ga0318577_1028974423300032091SoilMSVIADATARSGEKFKVTRSRRNVAWTGIGAAVVVVVLGVFPFYVK
Ga0318540_1019712313300032094SoilMSVVTETTARSEEKFRVTRSRRNVAWTGGGALIVVVVLALFPY
Ga0307472_10100266213300032205Hardwood Forest SoilMSVVTDTPARSEENFRVTRSRRNVAWTGAGALIVVVVLVLFP
Ga0307472_10168720813300032205Hardwood Forest SoilVSLATKTTARPAEGFRVTRGRRNVAWTGLVALIVVVVLALFPYIVY
Ga0306920_10094336013300032261SoilVSVATETTAPPAERFRVTRSRRNVAWTGVGALIAVVVLALFP
Ga0335085_1039094633300032770SoilMSDTEGAGLSVATVTPPGQSGGFRVARSRRNVAWTGGVALIVVVVLAYFPYIVYSGTTAI
Ga0335085_1186245323300032770SoilVSLATESAARSAGKFRVTRSRRNVAWTGAVALIVVMVLALFPYIVYSGTT
Ga0335078_1201841713300032805SoilVSLATETTARPAEEFRVTRSRRNVAWTGAVALIVIVVFAMLPYIVFSG
Ga0335070_1082245413300032829SoilMSVVTQPSTRPAGGFRVTRSRRNVVWTGAAALIVVVVLALFPYIVYSGTTAI
Ga0335069_1035349513300032893SoilMSTVTETPARPAAGFRVTRSQRNVAWTGIAALIVVVVMAMFPYFVYSGTTSVLVQ
Ga0335074_1008275413300032895SoilVSLVTEASTQPAAAFRVTRSRRNVAWTGIGALVVVAVLALFPYIVYSGTTAIL
Ga0335074_1072877723300032895SoilVSLITETTARPAENFRVTRSQRNVAWTGAVALIIVVV
Ga0335074_1086570223300032895SoilVTALAETTGRSAEKYRVTRSRRNVAWTGIGALVVVVVLALFPYIIGAGTETIMVQGFIILTLA
Ga0335074_1107101013300032895SoilVSVVTKAGPRPAESFLVTRSQRNVVWTGIGALIVV
Ga0335072_1045555113300032898SoilMGTVMSLITETTARPAENFRVTRSQRNVAWTGAVALIIVVVFAMFPYIVYSGTTAILVQA
Ga0335072_1115425823300032898SoilMSLATEPAAGLAGDVRVTRSRRNVAWTGVGALVVVIVLAYFPYIVYAGTTAILVQGF
Ga0335072_1116722923300032898SoilVSLATETTARPAEGFRVTRSQRNVAWTGAVALIVVVVFAFFPYIIYSGTTSILVQAFIVLTL
Ga0335084_1062268313300033004SoilMSVATDTPARSEENFRVTRSRRNVAWTGAGALIVVVVLALFPYIVYSGTT
Ga0335073_1209742913300033134SoilVSMVTKAGPRAAESFRVTRSQRNVVWTGVGAVVVVVVLALFPYLVYSGTTSLMVQGFI
Ga0335077_1147363823300033158SoilMSMVADARTRSAGKIRVTRSRRNVAWTGIGALVAVVVLALFPYIVYSGTTTIMVQA
Ga0310914_1072548123300033289SoilMSVVTDTQARSEEKIRVTRSRRNVAWSGLVALAVVVVL
Ga0318519_1015522833300033290SoilMSVVTETTVRSAEKFRVTRSRRNVAWTGICALVVVVVLALFPYLVYSGTTT
Ga0318519_1058687523300033290SoilMSVATDTQVRSEEKFRVTRSRRNVAWTGLGALVVVVVLALFPY
Ga0314862_0057246_697_8493300033803PeatlandMSLVTDTQARSEEKIRVTRSRRNVAWTGLGALVVVVVLALFPYIVYSGTTT
Ga0314867_149428_415_5463300033808PeatlandMSVVTETTARSEEKFRVTRSRRNVAWTGAGALVVVVVLALFPYL
Ga0373959_0028680_998_11113300034820Rhizosphere SoilMSLATKTTARPAEGFRVTRGRRNVAWTGLVALIVVVVL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.