| Basic Information | |
|---|---|
| Family ID | F007081 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 358 |
| Average Sequence Length | 46 residues |
| Representative Sequence | NFAKSRHLGFIARAAEAAGIQADQWLFTLSDLMVLVTLFPRCTH |
| Number of Associated Samples | 235 |
| Number of Associated Scaffolds | 358 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.96 % |
| % of genes near scaffold ends (potentially truncated) | 97.21 % |
| % of genes from short scaffolds (< 2000 bps) | 86.87 % |
| Associated GOLD sequencing projects | 208 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.31 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.693 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (33.240 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.358 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.810 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.72% β-sheet: 0.00% Coil/Unstructured: 65.28% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 358 Family Scaffolds |
|---|---|---|
| PF03486 | HI0933_like | 5.31 |
| PF13426 | PAS_9 | 2.79 |
| PF07238 | PilZ | 2.23 |
| PF02518 | HATPase_c | 1.96 |
| PF00072 | Response_reg | 1.68 |
| PF00753 | Lactamase_B | 1.40 |
| PF04389 | Peptidase_M28 | 1.12 |
| PF00248 | Aldo_ket_red | 1.12 |
| PF12867 | DinB_2 | 1.12 |
| PF00578 | AhpC-TSA | 0.84 |
| PF02371 | Transposase_20 | 0.56 |
| PF01850 | PIN | 0.56 |
| PF04264 | YceI | 0.56 |
| PF00092 | VWA | 0.56 |
| PF01555 | N6_N4_Mtase | 0.56 |
| PF05163 | DinB | 0.28 |
| PF00589 | Phage_integrase | 0.28 |
| PF14078 | DUF4259 | 0.28 |
| PF13551 | HTH_29 | 0.28 |
| PF12849 | PBP_like_2 | 0.28 |
| PF08534 | Redoxin | 0.28 |
| PF08592 | Anthrone_oxy | 0.28 |
| PF01872 | RibD_C | 0.28 |
| PF02687 | FtsX | 0.28 |
| PF00069 | Pkinase | 0.28 |
| PF07282 | OrfB_Zn_ribbon | 0.28 |
| PF07690 | MFS_1 | 0.28 |
| PF02823 | ATP-synt_DE_N | 0.28 |
| PF08447 | PAS_3 | 0.28 |
| PF13365 | Trypsin_2 | 0.28 |
| PF07732 | Cu-oxidase_3 | 0.28 |
| PF07045 | DUF1330 | 0.28 |
| PF13565 | HTH_32 | 0.28 |
| PF13701 | DDE_Tnp_1_4 | 0.28 |
| PF13620 | CarboxypepD_reg | 0.28 |
| PF13646 | HEAT_2 | 0.28 |
| PF03143 | GTP_EFTU_D3 | 0.28 |
| PF00491 | Arginase | 0.28 |
| PF16326 | ABC_tran_CTD | 0.28 |
| PF05016 | ParE_toxin | 0.28 |
| PF07221 | GlcNAc_2-epim | 0.28 |
| PF01564 | Spermine_synth | 0.28 |
| PF13857 | Ank_5 | 0.28 |
| PF16320 | Ribosomal_L12_N | 0.28 |
| PF07452 | CHRD | 0.28 |
| PF00501 | AMP-binding | 0.28 |
| PF05000 | RNA_pol_Rpb1_4 | 0.28 |
| COG ID | Name | Functional Category | % Frequency in 358 Family Scaffolds |
|---|---|---|---|
| COG0493 | NADPH-dependent glutamate synthase beta chain or related oxidoreductase | Amino acid transport and metabolism [E] | 10.61 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 10.61 |
| COG0029 | Aspartate oxidase | Coenzyme transport and metabolism [H] | 5.31 |
| COG3634 | Alkyl hydroperoxide reductase subunit AhpF | Defense mechanisms [V] | 5.31 |
| COG2509 | FAD-dependent dehydrogenase | General function prediction only [R] | 5.31 |
| COG2081 | Predicted flavoprotein YhiN | General function prediction only [R] | 5.31 |
| COG2072 | Predicted flavoprotein CzcO associated with the cation diffusion facilitator CzcD | Inorganic ion transport and metabolism [P] | 5.31 |
| COG1249 | Dihydrolipoamide dehydrogenase (E3) component of pyruvate/2-oxoglutarate dehydrogenase complex or glutathione oxidoreductase | Energy production and conversion [C] | 5.31 |
| COG1053 | Succinate dehydrogenase/fumarate reductase, flavoprotein subunit | Energy production and conversion [C] | 5.31 |
| COG0492 | Thioredoxin reductase | Posttranslational modification, protein turnover, chaperones [O] | 5.31 |
| COG0446 | NADPH-dependent 2,4-dienoyl-CoA reductase, sulfur reductase, or a related oxidoreductase | Lipid transport and metabolism [I] | 5.31 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 5.31 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 1.12 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.56 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.56 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.56 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.56 |
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 0.56 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.28 |
| COG0010 | Arginase/agmatinase family enzyme | Amino acid transport and metabolism [E] | 0.28 |
| COG2942 | Mannose or cellobiose epimerase, N-acyl-D-glucosamine 2-epimerase family | Carbohydrate transport and metabolism [G] | 0.28 |
| COG0086 | DNA-directed RNA polymerase, beta' subunit/160 kD subunit | Transcription [K] | 0.28 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.28 |
| COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 0.28 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.28 |
| COG0355 | FoF1-type ATP synthase, epsilon subunit | Energy production and conversion [C] | 0.28 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.28 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.69 % |
| Unclassified | root | N/A | 5.31 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2162886012|MBSR1b_contig_5654787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1260 | Open in IMG/M |
| 3300001661|JGI12053J15887_10528710 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
| 3300002907|JGI25613J43889_10001392 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6212 | Open in IMG/M |
| 3300002914|JGI25617J43924_10187824 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 688 | Open in IMG/M |
| 3300002917|JGI25616J43925_10015800 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3341 | Open in IMG/M |
| 3300002917|JGI25616J43925_10066430 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1531 | Open in IMG/M |
| 3300002917|JGI25616J43925_10147638 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300004091|Ga0062387_100157118 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1318 | Open in IMG/M |
| 3300004092|Ga0062389_101222494 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300004104|Ga0058891_1436984 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300004152|Ga0062386_100068466 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2695 | Open in IMG/M |
| 3300004152|Ga0062386_100263943 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1367 | Open in IMG/M |
| 3300004152|Ga0062386_100942318 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300004635|Ga0062388_100379310 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1219 | Open in IMG/M |
| 3300005174|Ga0066680_10146822 | All Organisms → cellular organisms → Bacteria | 1473 | Open in IMG/M |
| 3300005174|Ga0066680_10198814 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1266 | Open in IMG/M |
| 3300005332|Ga0066388_102370307 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 962 | Open in IMG/M |
| 3300005468|Ga0070707_100390451 | All Organisms → cellular organisms → Bacteria | 1352 | Open in IMG/M |
| 3300005531|Ga0070738_10062643 | All Organisms → cellular organisms → Bacteria | 2218 | Open in IMG/M |
| 3300005541|Ga0070733_10761989 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 650 | Open in IMG/M |
| 3300005542|Ga0070732_10996571 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300005552|Ga0066701_10391888 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 859 | Open in IMG/M |
| 3300005552|Ga0066701_10594809 | Not Available | 674 | Open in IMG/M |
| 3300005556|Ga0066707_10078649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_17 | 1984 | Open in IMG/M |
| 3300005556|Ga0066707_10729752 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
| 3300005557|Ga0066704_10136639 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1636 | Open in IMG/M |
| 3300005561|Ga0066699_11202868 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
| 3300005566|Ga0066693_10041249 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1507 | Open in IMG/M |
| 3300005569|Ga0066705_10225699 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1181 | Open in IMG/M |
| 3300005574|Ga0066694_10548499 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300005586|Ga0066691_10095591 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1662 | Open in IMG/M |
| 3300005586|Ga0066691_10432027 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 785 | Open in IMG/M |
| 3300005602|Ga0070762_10558246 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 756 | Open in IMG/M |
| 3300005764|Ga0066903_101158918 | All Organisms → cellular organisms → Bacteria | 1431 | Open in IMG/M |
| 3300006028|Ga0070717_10905591 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300006034|Ga0066656_10197389 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1279 | Open in IMG/M |
| 3300006034|Ga0066656_11025289 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300006050|Ga0075028_100634885 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 637 | Open in IMG/M |
| 3300006057|Ga0075026_100349531 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 819 | Open in IMG/M |
| 3300006173|Ga0070716_100232594 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1245 | Open in IMG/M |
| 3300006175|Ga0070712_100163536 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1721 | Open in IMG/M |
| 3300006176|Ga0070765_100304653 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1473 | Open in IMG/M |
| 3300006176|Ga0070765_100522870 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
| 3300006176|Ga0070765_101165007 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 728 | Open in IMG/M |
| 3300006796|Ga0066665_10721953 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 789 | Open in IMG/M |
| 3300006797|Ga0066659_10223979 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1392 | Open in IMG/M |
| 3300006797|Ga0066659_10300373 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1225 | Open in IMG/M |
| 3300006797|Ga0066659_11696583 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
| 3300006800|Ga0066660_11211613 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300006804|Ga0079221_11124916 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300006852|Ga0075433_11686951 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300006854|Ga0075425_100426915 | Not Available | 1527 | Open in IMG/M |
| 3300006893|Ga0073928_10354493 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1085 | Open in IMG/M |
| 3300007255|Ga0099791_10142122 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1119 | Open in IMG/M |
| 3300007255|Ga0099791_10342005 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 716 | Open in IMG/M |
| 3300007255|Ga0099791_10540186 | Not Available | 567 | Open in IMG/M |
| 3300007255|Ga0099791_10569360 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300007258|Ga0099793_10022598 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2599 | Open in IMG/M |
| 3300007258|Ga0099793_10103572 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1319 | Open in IMG/M |
| 3300007258|Ga0099793_10249534 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 856 | Open in IMG/M |
| 3300007265|Ga0099794_10164898 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1128 | Open in IMG/M |
| 3300009012|Ga0066710_100899447 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1362 | Open in IMG/M |
| 3300009038|Ga0099829_10720457 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 829 | Open in IMG/M |
| 3300009038|Ga0099829_11215377 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300009038|Ga0099829_11282281 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300009038|Ga0099829_11407623 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300009088|Ga0099830_10411417 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1095 | Open in IMG/M |
| 3300009088|Ga0099830_10760954 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 798 | Open in IMG/M |
| 3300009089|Ga0099828_10951288 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300009089|Ga0099828_11534685 | Not Available | 587 | Open in IMG/M |
| 3300009090|Ga0099827_10264695 | All Organisms → cellular organisms → Bacteria | 1448 | Open in IMG/M |
| 3300009090|Ga0099827_10266503 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1443 | Open in IMG/M |
| 3300009090|Ga0099827_11287233 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 636 | Open in IMG/M |
| 3300009137|Ga0066709_100249809 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2374 | Open in IMG/M |
| 3300009137|Ga0066709_100514338 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1689 | Open in IMG/M |
| 3300009137|Ga0066709_104448887 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300009143|Ga0099792_11184179 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300009177|Ga0105248_10782578 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1077 | Open in IMG/M |
| 3300009638|Ga0116113_1155515 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300009650|Ga0105857_1245673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
| 3300009683|Ga0116224_10465262 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 602 | Open in IMG/M |
| 3300009792|Ga0126374_10700138 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300010046|Ga0126384_12264260 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 524 | Open in IMG/M |
| 3300010047|Ga0126382_11878125 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300010048|Ga0126373_10051088 | All Organisms → cellular organisms → Bacteria | 3675 | Open in IMG/M |
| 3300010048|Ga0126373_11780652 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 680 | Open in IMG/M |
| 3300010048|Ga0126373_12656721 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300010048|Ga0126373_13031007 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300010322|Ga0134084_10245198 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 645 | Open in IMG/M |
| 3300010336|Ga0134071_10437928 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 669 | Open in IMG/M |
| 3300010359|Ga0126376_12070780 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
| 3300010360|Ga0126372_10069327 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2499 | Open in IMG/M |
| 3300010360|Ga0126372_10961721 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 862 | Open in IMG/M |
| 3300010361|Ga0126378_10772022 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1071 | Open in IMG/M |
| 3300010361|Ga0126378_11802829 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
| 3300010366|Ga0126379_10078605 | All Organisms → cellular organisms → Bacteria | 2847 | Open in IMG/M |
| 3300010376|Ga0126381_102174433 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 798 | Open in IMG/M |
| 3300010398|Ga0126383_11347725 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 803 | Open in IMG/M |
| 3300011269|Ga0137392_10617994 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 899 | Open in IMG/M |
| 3300011269|Ga0137392_11024086 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 678 | Open in IMG/M |
| 3300011269|Ga0137392_11493015 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300011270|Ga0137391_11391692 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300011271|Ga0137393_10686019 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 877 | Open in IMG/M |
| 3300011271|Ga0137393_10848791 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 780 | Open in IMG/M |
| 3300011271|Ga0137393_11035005 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 699 | Open in IMG/M |
| 3300011271|Ga0137393_11625681 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300012096|Ga0137389_10026999 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_6 | 4117 | Open in IMG/M |
| 3300012096|Ga0137389_10384393 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1197 | Open in IMG/M |
| 3300012096|Ga0137389_10739427 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 845 | Open in IMG/M |
| 3300012096|Ga0137389_10817551 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 800 | Open in IMG/M |
| 3300012189|Ga0137388_10244941 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1629 | Open in IMG/M |
| 3300012189|Ga0137388_10540245 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1083 | Open in IMG/M |
| 3300012189|Ga0137388_10572158 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1050 | Open in IMG/M |
| 3300012189|Ga0137388_11519211 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
| 3300012189|Ga0137388_11616064 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 583 | Open in IMG/M |
| 3300012189|Ga0137388_11864980 | Not Available | 532 | Open in IMG/M |
| 3300012198|Ga0137364_11284381 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300012199|Ga0137383_10853464 | Not Available | 665 | Open in IMG/M |
| 3300012199|Ga0137383_10894264 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
| 3300012200|Ga0137382_10055787 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2483 | Open in IMG/M |
| 3300012200|Ga0137382_10204466 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1357 | Open in IMG/M |
| 3300012200|Ga0137382_11181590 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300012202|Ga0137363_10114736 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2069 | Open in IMG/M |
| 3300012202|Ga0137363_10156517 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1795 | Open in IMG/M |
| 3300012202|Ga0137363_11036593 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300012202|Ga0137363_11353087 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
| 3300012203|Ga0137399_10256803 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1434 | Open in IMG/M |
| 3300012203|Ga0137399_10759622 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 816 | Open in IMG/M |
| 3300012205|Ga0137362_10025787 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4599 | Open in IMG/M |
| 3300012205|Ga0137362_10412582 | All Organisms → cellular organisms → Bacteria | 1170 | Open in IMG/M |
| 3300012205|Ga0137362_11142600 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 661 | Open in IMG/M |
| 3300012209|Ga0137379_10852311 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 816 | Open in IMG/M |
| 3300012209|Ga0137379_11306958 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
| 3300012209|Ga0137379_11576138 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300012210|Ga0137378_11602701 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
| 3300012211|Ga0137377_10096469 | All Organisms → cellular organisms → Bacteria | 2796 | Open in IMG/M |
| 3300012211|Ga0137377_10244715 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1723 | Open in IMG/M |
| 3300012211|Ga0137377_11516059 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
| 3300012285|Ga0137370_10165078 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1286 | Open in IMG/M |
| 3300012349|Ga0137387_10049866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_17 | 2787 | Open in IMG/M |
| 3300012349|Ga0137387_11251226 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300012351|Ga0137386_10521410 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 856 | Open in IMG/M |
| 3300012356|Ga0137371_10150153 | All Organisms → cellular organisms → Bacteria | 1826 | Open in IMG/M |
| 3300012357|Ga0137384_10058362 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3198 | Open in IMG/M |
| 3300012357|Ga0137384_11435939 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300012357|Ga0137384_11475284 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300012359|Ga0137385_10607637 | Not Available | 919 | Open in IMG/M |
| 3300012361|Ga0137360_10008004 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6610 | Open in IMG/M |
| 3300012361|Ga0137360_10028239 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3852 | Open in IMG/M |
| 3300012361|Ga0137360_10616740 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 929 | Open in IMG/M |
| 3300012361|Ga0137360_10864524 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 779 | Open in IMG/M |
| 3300012361|Ga0137360_10998063 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 722 | Open in IMG/M |
| 3300012361|Ga0137360_11839507 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300012362|Ga0137361_10103118 | All Organisms → cellular organisms → Bacteria | 2485 | Open in IMG/M |
| 3300012362|Ga0137361_11123738 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 707 | Open in IMG/M |
| 3300012362|Ga0137361_11789707 | Not Available | 533 | Open in IMG/M |
| 3300012582|Ga0137358_10325102 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1043 | Open in IMG/M |
| 3300012582|Ga0137358_11051186 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300012582|Ga0137358_11081662 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300012683|Ga0137398_10060347 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2280 | Open in IMG/M |
| 3300012683|Ga0137398_10600974 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300012685|Ga0137397_10552409 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 857 | Open in IMG/M |
| 3300012685|Ga0137397_11072588 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300012918|Ga0137396_10490275 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 911 | Open in IMG/M |
| 3300012918|Ga0137396_11266306 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300012922|Ga0137394_11399488 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
| 3300012923|Ga0137359_10612114 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300012924|Ga0137413_10034201 | All Organisms → cellular organisms → Bacteria | 2822 | Open in IMG/M |
| 3300012924|Ga0137413_10357359 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1038 | Open in IMG/M |
| 3300012924|Ga0137413_11558234 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300012925|Ga0137419_10029448 | All Organisms → cellular organisms → Bacteria | 3341 | Open in IMG/M |
| 3300012925|Ga0137419_10869220 | Not Available | 741 | Open in IMG/M |
| 3300012925|Ga0137419_11665699 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300012927|Ga0137416_10321387 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1289 | Open in IMG/M |
| 3300012927|Ga0137416_11456180 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
| 3300012927|Ga0137416_11945512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300012929|Ga0137404_10138823 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2009 | Open in IMG/M |
| 3300012929|Ga0137404_11172228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 706 | Open in IMG/M |
| 3300012929|Ga0137404_11574325 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
| 3300012929|Ga0137404_11650130 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300012930|Ga0137407_11582746 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300012930|Ga0137407_12008676 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
| 3300012931|Ga0153915_10991410 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 978 | Open in IMG/M |
| 3300012971|Ga0126369_11510882 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300012989|Ga0164305_11931557 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 537 | Open in IMG/M |
| 3300014153|Ga0181527_1112494 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1254 | Open in IMG/M |
| 3300014154|Ga0134075_10023543 | All Organisms → cellular organisms → Bacteria | 2467 | Open in IMG/M |
| 3300014164|Ga0181532_10114327 | All Organisms → cellular organisms → Bacteria | 1663 | Open in IMG/M |
| 3300015054|Ga0137420_1020790 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1012 | Open in IMG/M |
| 3300015054|Ga0137420_1099014 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1212 | Open in IMG/M |
| 3300015054|Ga0137420_1190109 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1996 | Open in IMG/M |
| 3300015242|Ga0137412_10071183 | All Organisms → cellular organisms → Bacteria | 2829 | Open in IMG/M |
| 3300016294|Ga0182041_10006024 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6607 | Open in IMG/M |
| 3300016319|Ga0182033_10418783 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1136 | Open in IMG/M |
| 3300016422|Ga0182039_10425550 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1132 | Open in IMG/M |
| 3300016445|Ga0182038_10618642 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 936 | Open in IMG/M |
| 3300017934|Ga0187803_10372530 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 576 | Open in IMG/M |
| 3300017947|Ga0187785_10122684 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1064 | Open in IMG/M |
| 3300017955|Ga0187817_10106891 | All Organisms → cellular organisms → Bacteria | 1764 | Open in IMG/M |
| 3300017961|Ga0187778_10530002 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 784 | Open in IMG/M |
| 3300017973|Ga0187780_10176342 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1487 | Open in IMG/M |
| 3300017975|Ga0187782_11371693 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300017999|Ga0187767_10080335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 871 | Open in IMG/M |
| 3300018085|Ga0187772_11180937 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
| 3300018088|Ga0187771_10097024 | All Organisms → cellular organisms → Bacteria | 2369 | Open in IMG/M |
| 3300018088|Ga0187771_11149862 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 658 | Open in IMG/M |
| 3300018089|Ga0187774_11294453 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300018090|Ga0187770_10679899 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 821 | Open in IMG/M |
| 3300018090|Ga0187770_11096888 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
| 3300018433|Ga0066667_11063310 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 699 | Open in IMG/M |
| 3300020002|Ga0193730_1081410 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 915 | Open in IMG/M |
| 3300020170|Ga0179594_10106842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1010 | Open in IMG/M |
| 3300020199|Ga0179592_10099271 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1337 | Open in IMG/M |
| 3300020579|Ga0210407_10011604 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6558 | Open in IMG/M |
| 3300020579|Ga0210407_10422031 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1044 | Open in IMG/M |
| 3300020579|Ga0210407_10826648 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 713 | Open in IMG/M |
| 3300020580|Ga0210403_10501116 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 986 | Open in IMG/M |
| 3300020581|Ga0210399_10328014 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1278 | Open in IMG/M |
| 3300020581|Ga0210399_11490706 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300020581|Ga0210399_11590895 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300020582|Ga0210395_11445619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae | 501 | Open in IMG/M |
| 3300020583|Ga0210401_10538243 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1030 | Open in IMG/M |
| 3300020583|Ga0210401_11195325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300021046|Ga0215015_10792103 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 752 | Open in IMG/M |
| 3300021088|Ga0210404_10299862 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 884 | Open in IMG/M |
| 3300021088|Ga0210404_10770208 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300021088|Ga0210404_10782604 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300021168|Ga0210406_11195915 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300021170|Ga0210400_11235600 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
| 3300021170|Ga0210400_11672560 | Not Available | 501 | Open in IMG/M |
| 3300021171|Ga0210405_10445956 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1017 | Open in IMG/M |
| 3300021171|Ga0210405_10647703 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 820 | Open in IMG/M |
| 3300021178|Ga0210408_10227453 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1485 | Open in IMG/M |
| 3300021178|Ga0210408_11268956 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
| 3300021401|Ga0210393_11213727 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
| 3300021405|Ga0210387_10409280 | All Organisms → cellular organisms → Bacteria | 1202 | Open in IMG/M |
| 3300021475|Ga0210392_11100034 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
| 3300021478|Ga0210402_11293730 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 656 | Open in IMG/M |
| 3300021478|Ga0210402_11706273 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300021479|Ga0210410_11351940 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
| 3300021559|Ga0210409_11564943 | Not Available | 535 | Open in IMG/M |
| 3300022533|Ga0242662_10073864 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300022557|Ga0212123_10032264 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5331 | Open in IMG/M |
| 3300024251|Ga0247679_1034300 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 854 | Open in IMG/M |
| 3300024330|Ga0137417_1420003 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1915 | Open in IMG/M |
| 3300024330|Ga0137417_1472487 | Not Available | 2325 | Open in IMG/M |
| 3300025454|Ga0208039_1086253 | Not Available | 547 | Open in IMG/M |
| 3300025898|Ga0207692_11010381 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300025905|Ga0207685_10616504 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300025916|Ga0207663_11704708 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300025922|Ga0207646_10197834 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1815 | Open in IMG/M |
| 3300025939|Ga0207665_10278209 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1245 | Open in IMG/M |
| 3300026304|Ga0209240_1082113 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1186 | Open in IMG/M |
| 3300026304|Ga0209240_1169970 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300026307|Ga0209469_1109132 | Not Available | 733 | Open in IMG/M |
| 3300026310|Ga0209239_1001212 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 15245 | Open in IMG/M |
| 3300026328|Ga0209802_1330253 | Not Available | 504 | Open in IMG/M |
| 3300026330|Ga0209473_1057585 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1678 | Open in IMG/M |
| 3300026333|Ga0209158_1370072 | Not Available | 500 | Open in IMG/M |
| 3300026334|Ga0209377_1025852 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2888 | Open in IMG/M |
| 3300026359|Ga0257163_1050809 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
| 3300026467|Ga0257154_1062737 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 583 | Open in IMG/M |
| 3300026490|Ga0257153_1024631 | All Organisms → cellular organisms → Bacteria | 1237 | Open in IMG/M |
| 3300026528|Ga0209378_1222707 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300026537|Ga0209157_1336599 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300026538|Ga0209056_10419029 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 802 | Open in IMG/M |
| 3300026548|Ga0209161_10074535 | All Organisms → cellular organisms → Bacteria | 2119 | Open in IMG/M |
| 3300026551|Ga0209648_10067290 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3023 | Open in IMG/M |
| 3300026552|Ga0209577_10045346 | All Organisms → cellular organisms → Bacteria | 3741 | Open in IMG/M |
| 3300026833|Ga0207728_117139 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
| 3300027537|Ga0209419_1040931 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 890 | Open in IMG/M |
| 3300027562|Ga0209735_1074183 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 736 | Open in IMG/M |
| 3300027603|Ga0209331_1060183 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 953 | Open in IMG/M |
| 3300027610|Ga0209528_1145392 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300027645|Ga0209117_1099582 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 795 | Open in IMG/M |
| 3300027655|Ga0209388_1065427 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1048 | Open in IMG/M |
| 3300027671|Ga0209588_1091158 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 982 | Open in IMG/M |
| 3300027706|Ga0209581_1004527 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 11134 | Open in IMG/M |
| 3300027706|Ga0209581_1013331 | All Organisms → cellular organisms → Bacteria | 4866 | Open in IMG/M |
| 3300027767|Ga0209655_10091211 | Not Available | 1013 | Open in IMG/M |
| 3300027812|Ga0209656_10358140 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300027825|Ga0209039_10179659 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 868 | Open in IMG/M |
| 3300027829|Ga0209773_10432093 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
| 3300027842|Ga0209580_10264225 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300027846|Ga0209180_10651893 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300027862|Ga0209701_10176663 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 1288 | Open in IMG/M |
| 3300027862|Ga0209701_10238615 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1068 | Open in IMG/M |
| 3300027867|Ga0209167_10674525 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300027884|Ga0209275_10011961 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3730 | Open in IMG/M |
| 3300027884|Ga0209275_10235210 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1001 | Open in IMG/M |
| 3300027908|Ga0209006_10042500 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4097 | Open in IMG/M |
| 3300028047|Ga0209526_10142623 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1680 | Open in IMG/M |
| 3300028281|Ga0247689_1061054 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
| 3300028293|Ga0247662_1065189 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
| 3300028536|Ga0137415_11142656 | Not Available | 592 | Open in IMG/M |
| 3300028536|Ga0137415_11322553 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300028759|Ga0302224_10213692 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300028906|Ga0308309_10552103 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 998 | Open in IMG/M |
| 3300028906|Ga0308309_10908327 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 764 | Open in IMG/M |
| 3300029944|Ga0311352_10354966 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1209 | Open in IMG/M |
| 3300030580|Ga0311355_11139133 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 692 | Open in IMG/M |
| 3300030618|Ga0311354_10889400 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 831 | Open in IMG/M |
| 3300031057|Ga0170834_108639551 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
| 3300031247|Ga0265340_10231369 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 826 | Open in IMG/M |
| 3300031474|Ga0170818_101076735 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300031573|Ga0310915_11151112 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300031679|Ga0318561_10033910 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2482 | Open in IMG/M |
| 3300031716|Ga0310813_11257017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 683 | Open in IMG/M |
| 3300031720|Ga0307469_10158429 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1707 | Open in IMG/M |
| 3300031720|Ga0307469_10279686 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1362 | Open in IMG/M |
| 3300031720|Ga0307469_10393604 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1180 | Open in IMG/M |
| 3300031720|Ga0307469_10834034 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 848 | Open in IMG/M |
| 3300031744|Ga0306918_10389795 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1084 | Open in IMG/M |
| 3300031744|Ga0306918_11197812 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
| 3300031753|Ga0307477_10524571 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 803 | Open in IMG/M |
| 3300031753|Ga0307477_10538455 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 791 | Open in IMG/M |
| 3300031754|Ga0307475_10004964 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8280 | Open in IMG/M |
| 3300031754|Ga0307475_10174438 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1714 | Open in IMG/M |
| 3300031754|Ga0307475_11323507 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
| 3300031770|Ga0318521_10252254 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1030 | Open in IMG/M |
| 3300031771|Ga0318546_10168786 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1483 | Open in IMG/M |
| 3300031796|Ga0318576_10423979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
| 3300031820|Ga0307473_10613456 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 753 | Open in IMG/M |
| 3300031823|Ga0307478_11214529 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
| 3300031879|Ga0306919_10206140 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1463 | Open in IMG/M |
| 3300031910|Ga0306923_10016088 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7779 | Open in IMG/M |
| 3300031945|Ga0310913_11089813 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300031946|Ga0310910_10848882 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 718 | Open in IMG/M |
| 3300031954|Ga0306926_10003216 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 16844 | Open in IMG/M |
| 3300031962|Ga0307479_10062563 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3587 | Open in IMG/M |
| 3300031962|Ga0307479_10516774 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1177 | Open in IMG/M |
| 3300031962|Ga0307479_10681490 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1007 | Open in IMG/M |
| 3300031962|Ga0307479_10727913 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 970 | Open in IMG/M |
| 3300031962|Ga0307479_11498934 | Not Available | 631 | Open in IMG/M |
| 3300032010|Ga0318569_10372404 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 666 | Open in IMG/M |
| 3300032035|Ga0310911_10880517 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300032059|Ga0318533_10857484 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
| 3300032094|Ga0318540_10625653 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300032174|Ga0307470_10122463 | All Organisms → cellular organisms → Bacteria | 1538 | Open in IMG/M |
| 3300032174|Ga0307470_11556437 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
| 3300032180|Ga0307471_100691129 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1184 | Open in IMG/M |
| 3300032180|Ga0307471_100995583 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1005 | Open in IMG/M |
| 3300032180|Ga0307471_101369671 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300032180|Ga0307471_102231674 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 690 | Open in IMG/M |
| 3300032205|Ga0307472_100076601 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2206 | Open in IMG/M |
| 3300032205|Ga0307472_101679807 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
| 3300032261|Ga0306920_100191783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3050 | Open in IMG/M |
| 3300032770|Ga0335085_10140813 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3042 | Open in IMG/M |
| 3300032783|Ga0335079_11358193 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 707 | Open in IMG/M |
| 3300032805|Ga0335078_10480074 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1604 | Open in IMG/M |
| 3300032805|Ga0335078_12590141 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
| 3300032828|Ga0335080_10301286 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1740 | Open in IMG/M |
| 3300032892|Ga0335081_10867211 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1069 | Open in IMG/M |
| 3300032895|Ga0335074_11440929 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
| 3300033134|Ga0335073_10492417 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1403 | Open in IMG/M |
| 3300033134|Ga0335073_10927891 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 912 | Open in IMG/M |
| 3300033158|Ga0335077_10911695 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 884 | Open in IMG/M |
| 3300033402|Ga0326728_10530988 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 944 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 33.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.38% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.70% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.47% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.91% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.07% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.79% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.79% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.23% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.51% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.51% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.12% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.12% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.56% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.56% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.56% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.56% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.56% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.56% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.56% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.28% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.28% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.28% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.28% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.28% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.28% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.28% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.28% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.84% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004104 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF218 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005531 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
| 3300009650 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-061 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014153 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300024251 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025454 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026359 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A | Environmental | Open in IMG/M |
| 3300026467 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-A | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026833 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 54 (SPAdes) | Environmental | Open in IMG/M |
| 3300027537 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028281 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK30 | Environmental | Open in IMG/M |
| 3300028293 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK03 | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| MBSR1b_0223.00005340 | 2162886012 | Miscanthus Rhizosphere | KSRHLGFIARAAERAGIQADQWLFTLSDLMVLVTLFPRCTH |
| JGI12053J15887_105287102 | 3300001661 | Forest Soil | LTGICVDHLHNFAKKRHLGFIARAAEAASISADQWLFTLSDLMVLVTLFPKCTH* |
| JGI25613J43889_100013921 | 3300002907 | Grasslands Soil | LHNFAKSRHLGFIARAAEAAGLQADQWLFTLSDLMVLVTLFPRCTH* |
| JGI25617J43924_101878241 | 3300002914 | Grasslands Soil | DSEVANLTGICVEHVHNFAKSRHLGFIARAAEAAGISADQWLFTLSDLMVLVTLFPKCTH |
| JGI25616J43925_100158001 | 3300002917 | Grasslands Soil | VHNFAKSRHLGFIARAAEAAGISADQWLFTLSDLMVLVTLFPKCTH* |
| JGI25616J43925_100664303 | 3300002917 | Grasslands Soil | GICVEHVHNFAKSRHLGMIARAAEAAGAQADQWLFTLSDLMVLVTLFPRCSH* |
| JGI25616J43925_101476381 | 3300002917 | Grasslands Soil | ICVEHIHNFAKSRHLGFIARAAEAAGARADQWLFSLSDLMVIVTLFPKCTH* |
| Ga0062387_1001571181 | 3300004091 | Bog Forest Soil | TGICVDHIRNFAKSRHLGFIARAAEAAGKQADQWLFTLSDLMVLVTLFPRCTH* |
| Ga0062389_1012224941 | 3300004092 | Bog Forest Soil | GICVEHLHNFARRRHLGFLARAAEAAGAKTDQWLFTLSDLMVLVTLFPRCTH* |
| Ga0058891_14369842 | 3300004104 | Forest Soil | FAKSRHLGFIARAAEAAGLSADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0062386_1000684661 | 3300004152 | Bog Forest Soil | EHVHNFARSRHLGMIARAAEAAGAQADQWLFTLSDLMVLVTLFPRCSH* |
| Ga0062386_1002639431 | 3300004152 | Bog Forest Soil | EHLHNFARSRHLGFIARAAEAAGARADQWLFTLSDLMVLVTLFPRCTH* |
| Ga0062386_1009423181 | 3300004152 | Bog Forest Soil | HNFAKSRHLGFIARAAEAAGAQADQWLFSLSDLMVLVTLFPKCTH* |
| Ga0062388_1003793102 | 3300004635 | Bog Forest Soil | HIRNFAKSRHLGFIARAAEAAGKQADQWLFTLSDLMVLVTLFPRCTH* |
| Ga0066680_101468221 | 3300005174 | Soil | VATLTGICVEHLHDLAKARHLGFIARAAEAAGKQADQWLFTLPDLMVLAMLYPGCEH* |
| Ga0066680_101988142 | 3300005174 | Soil | LTGICVEHVHNFAKSRHLGFIARAAEAAGISADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0066388_1023703072 | 3300005332 | Tropical Forest Soil | LTGICVEHVHNFAKSRHLGFIARAAEAAGINADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0070707_1003904512 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VNLTGICVEHLHNFAKRRRLGFIARVAAAAGDQADQWLFTPWDLTVLVTLFPRCTH* |
| Ga0070738_100626431 | 3300005531 | Surface Soil | HLGFIARAAEAAGLQADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0070733_107619891 | 3300005541 | Surface Soil | GFIARAAEAAGKQADQWLFTLSDLMVLVTLFPRCTH* |
| Ga0070732_109965711 | 3300005542 | Surface Soil | HLGFIARAAEAAGLQADQWLFTPSDLMVLVTLFPRCTH* |
| Ga0066701_103918882 | 3300005552 | Soil | HNFAKSRHLGFIARAAEAAGINADQWLFTLSDLMVLVTLFPKCSH* |
| Ga0066701_105948091 | 3300005552 | Soil | LHGLARRTHLGFIARAAKVAGMQPDQWLFTLSDLMVLLMLHPRCKH* |
| Ga0066707_100786494 | 3300005556 | Soil | GFIARAAEAAGLSADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0066707_107297522 | 3300005556 | Soil | CVEHVHNFAKSRHLGFIARAAEAAGINADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0066704_101366391 | 3300005557 | Soil | GLERLRHLARTRHIGFIARAAEVAGKQAEQWLFTPSDLMVLVTLYHRC* |
| Ga0066699_112028682 | 3300005561 | Soil | NFAKSRHLGFIARAAEAAGLSADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0066693_100412492 | 3300005566 | Soil | AKTRHLGFIARAAEAAGINADQWLFTLSDLMVIVTLFPKCTH* |
| Ga0066705_102256992 | 3300005569 | Soil | LGFIARAAEAAGLSADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0066694_105484991 | 3300005574 | Soil | LTGICVEHVHNFAKSRHLGFIARAAEAAGLSADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0066691_100955911 | 3300005586 | Soil | EHLHGLARRRHLGFIARADEAAGKRPDQWLFTLSDLIVLVMLDQRCQH* |
| Ga0066691_104320271 | 3300005586 | Soil | LTGICVEHVHNFAQSRHLGFIARAAEAAGISADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0070762_105582461 | 3300005602 | Soil | GICVDHIRNFAKSRHLGFIARAAEAAGKQADQWLFTLSDLMVLVTLFPRCTH* |
| Ga0066903_1011589181 | 3300005764 | Tropical Forest Soil | CVDHIHNFAKSRHLGFIARAAEAAGAQADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0070717_109055911 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | GICVDHLHNFAKSRHLGFIARAAEAAGIQADQWLFTLSDLMVLVTLFPRCTH* |
| Ga0066656_101973892 | 3300006034 | Soil | ARRRHLGFIARAAEAAGKQADQWLFTLSDLMVLVTLFPKCSH* |
| Ga0066656_110252891 | 3300006034 | Soil | FTDSEVANLTGICVEHVHNFAKSRHLGFIARAAEAAGINADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0075028_1006348851 | 3300006050 | Watersheds | EHVHNFAKSRHLGFIARAAEAAGLSADQWLFTLSDLMVMVTLFPKCTH* |
| Ga0075026_1003495311 | 3300006057 | Watersheds | KSRHLGFIARAAEAAGIQADQWLFTLSDLMVLVTLFPRCTH* |
| Ga0070716_1002325942 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | KSRHLGFIARAAEAASMTADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0070712_1001635363 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | TGICVDHLHNFARSRHLGFIARAAEAAGAQADQWLFTLSDLMVLTTLFPRCTH* |
| Ga0070765_1003046531 | 3300006176 | Soil | FIARAAEAAGKQADQWLFTLSDLMVLVTLFPRCTH* |
| Ga0070765_1005228702 | 3300006176 | Soil | ATLTGICVDHLHNFAKSRHLGFIARAAEAAGKQADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0070765_1011650071 | 3300006176 | Soil | HLGFIARAAEAAGKQADQWLFTLSDLMVLVTLFPRCTH* |
| Ga0066665_107219531 | 3300006796 | Soil | HLGFIARAAEAAGLSADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0066659_102239791 | 3300006797 | Soil | KSRHLGFIARAAEAAGLSADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0066659_103003733 | 3300006797 | Soil | GLARRRHLGFIARADEAAGKRPDQWLFTLSDLIVLVMLDQRCQH* |
| Ga0066659_116965832 | 3300006797 | Soil | ICVEHVHNFAKSRHLGFIARAAEAAGLSADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0066660_112116131 | 3300006800 | Soil | GICVEHVHNFAKSRHLGFIARAAEAAGLSADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0079221_111249161 | 3300006804 | Agricultural Soil | TGICVEHVHNFAKSRHLGFIARAAEAAGLSADQWLFTLSDLMVLVTLFPKCSH* |
| Ga0075433_116869512 | 3300006852 | Populus Rhizosphere | ICVDHIHNFAKSRHLGFIARAAEAAGAQADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0075425_1004269151 | 3300006854 | Populus Rhizosphere | NFAKSRHLGFIARAAEAAGAQADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0073928_103544931 | 3300006893 | Iron-Sulfur Acid Spring | RHLGFIARAAEAASMTADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0099791_101421221 | 3300007255 | Vadose Zone Soil | HLGFIAHADEAAGKQADQWLFTLPDLMVLAMLYPGCEH* |
| Ga0099791_103420052 | 3300007255 | Vadose Zone Soil | GICVEHVHNFAKSRHLGFIARAAEAAGINADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0099791_105401861 | 3300007255 | Vadose Zone Soil | RSRHLGFIAHADEAAGKQANQRLFTLPDLMVLAMLYPCCEH* |
| Ga0099791_105693602 | 3300007255 | Vadose Zone Soil | VHNFAKSRHLGFIARAAEAAGLSADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0099793_100225982 | 3300007258 | Vadose Zone Soil | ARRRHLGFIARADEAAGKQADQRLFTQSDLMVLAMLYPCCEH* |
| Ga0099793_101035721 | 3300007258 | Vadose Zone Soil | VANLTGICVEHVHNFAKSRHLGFIARAAEAAGINADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0099793_102495341 | 3300007258 | Vadose Zone Soil | KSRHLGFIARAAEAAGIQADQWLFTLSDLMVLVTLFPRCSH* |
| Ga0099794_101648982 | 3300007265 | Vadose Zone Soil | IARAAEAAGISADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0066710_1008994471 | 3300009012 | Grasslands Soil | HLGFIARAAEAAGLSADQWLFTLSDLMVLVTLFPKCTH |
| Ga0099829_107204571 | 3300009038 | Vadose Zone Soil | LTGICVEHVHNFAKSRHLGFIARAAEAAGINADQWLFTLSDLMVLVTLFPKCSH* |
| Ga0099829_112153772 | 3300009038 | Vadose Zone Soil | HLGFIARAAEAAGAHADQWLFSLSDLMVLVTLFPKCTH* |
| Ga0099829_112822811 | 3300009038 | Vadose Zone Soil | KSRHLGFIARAAEAAGISADQWLFTLSDLMVLVTLFPKCSH* |
| Ga0099829_114076232 | 3300009038 | Vadose Zone Soil | LGFIARAAEAAGISADQWLFTLSDLMVMVTLFPKCTH* |
| Ga0099830_104114171 | 3300009088 | Vadose Zone Soil | VVADLSGNYVEHVHNFAKSRHLGFIARAAEAAGISADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0099830_107609541 | 3300009088 | Vadose Zone Soil | LEHLHGLARSRRLGFIAHADEAAGKQADQWLFTLPDLMVLAMLYPGCEH* |
| Ga0099828_109512882 | 3300009089 | Vadose Zone Soil | TLTGIGLERLHHLARTRRIGFIARAAEAVGKQAEQWLFTRSDLMVLAMLYHRC* |
| Ga0099828_115346852 | 3300009089 | Vadose Zone Soil | ATLTGICVEHVHNFAKRRRLGFIARAAQAAGINADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0099827_102646952 | 3300009090 | Vadose Zone Soil | RRHLGFIARANEAEGKHADQWLFTLSDLMVLAMLYPCCQH* |
| Ga0099827_102665031 | 3300009090 | Vadose Zone Soil | GFIERAAAAAGKQADQWLFTLSDLMVLATLYRRCQH* |
| Ga0099827_112872332 | 3300009090 | Vadose Zone Soil | FIARADEAAGKQADQWLFTLSDLMLLAMMYPCCEH* |
| Ga0066709_1002498091 | 3300009137 | Grasslands Soil | AKTRHLGFIARAAEAAGKADNWLFTLSDLMVLVTLFPKCTH* |
| Ga0066709_1005143383 | 3300009137 | Grasslands Soil | HLGFIARAAEAAGKQADQWLFTLSDLMVLVTLFPKCSH* |
| Ga0066709_1044488871 | 3300009137 | Grasslands Soil | FARRRHLGFIARAAEAAGKQADQWLFPLSDLMVLVTLFPKCSH* |
| Ga0099792_111841791 | 3300009143 | Vadose Zone Soil | HLHNFAKSRHLGFIARAAEAAGIQADQWLFTLSDLMVLVTLFPRCTH* |
| Ga0105248_107825783 | 3300009177 | Switchgrass Rhizosphere | FIARAAESFGDEAGQWLFTPWDLMVLATLFPRCTH* |
| Ga0116113_11555151 | 3300009638 | Peatland | HLGFIARAAEAAGRQADQWLFTLSDLMVLTTLFEKCSH* |
| Ga0105857_12456731 | 3300009650 | Permafrost Soil | RHLGFIARAAEAASMTADQWLFTLSDLMVLVTLFPRCTH* |
| Ga0116224_104652621 | 3300009683 | Peatlands Soil | LGMIARAAEAAGAQAEQWLFTLSDLMVLTTLFPRCTH* |
| Ga0126374_107001381 | 3300009792 | Tropical Forest Soil | GICVDHIHNFAKSRHLGFIARAAEAAGAQADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0126384_122642601 | 3300010046 | Tropical Forest Soil | FAKSRHLGFIARAAEAAGAQADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0126382_118781252 | 3300010047 | Tropical Forest Soil | MARLARAAEAAGIHADQWLFTLSDLMVLVTLFPKCAH* |
| Ga0126373_100510881 | 3300010048 | Tropical Forest Soil | HNFARSRHLGMIARAAEAAGVQAEQWLFTLSDLMVLVTLFPRCTH* |
| Ga0126373_117806522 | 3300010048 | Tropical Forest Soil | GICVDHLHNFARSRHLGMIARAAEAAGVQAEQWLFTLSDLMVLVTLFPRCTH* |
| Ga0126373_126567212 | 3300010048 | Tropical Forest Soil | VEHLHNFARSRHLGMIARAAEAAGVQAEQWLFTLSDLMVLVTLFPRCTH* |
| Ga0126373_130310072 | 3300010048 | Tropical Forest Soil | LTGICVDHLHNFARSRHLGMIARAAEAAGVQAEQWLFTLSDLMVLVTLFPRCTH* |
| Ga0134084_102451981 | 3300010322 | Grasslands Soil | ARARHIGFIARAAVAAGKQADQWLFTLSDLMVLATLYRRCQH* |
| Ga0134071_104379281 | 3300010336 | Grasslands Soil | VHNFAKSRHLGFIARAAEAAGINADQWLFTLSDLMVLVTLFPKCSH* |
| Ga0126376_120707801 | 3300010359 | Tropical Forest Soil | HNFAKSRHLGFIARAAEAAGARADNWLFTLSDLMVLVTLFPKCTH* |
| Ga0126372_100693274 | 3300010360 | Tropical Forest Soil | GLARSRRLGFIARAAEVPGMQPEQWLFTPSDLMVLVMLHPRCDH* |
| Ga0126372_109617212 | 3300010360 | Tropical Forest Soil | LTGICMEHLHNFARSRHLGMIARAAEAAGAQADQWLFTLSDLMVLVTLFPRCSH* |
| Ga0126378_107720221 | 3300010361 | Tropical Forest Soil | KTRHLGFIARAAEAAGLNADQWLFTLSDLMVMVTLFPKCTH* |
| Ga0126378_118028291 | 3300010361 | Tropical Forest Soil | HLGMIARAAEAAGVQAEQWLFTLSDLMVLVTLFPRCTH* |
| Ga0126379_100786053 | 3300010366 | Tropical Forest Soil | TGICVDHIHNFAKSRHLGFIARAAEAAGAQADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0126381_1021744331 | 3300010376 | Tropical Forest Soil | ICVEHVHNFARTRHLGIIARAAEAAGTQAEQWLFTLSDLMVLATLFPRCTH* |
| Ga0126383_113477251 | 3300010398 | Tropical Forest Soil | FAKSRHLGFIARAAEAAGAQADNWLFTLSDLMVLVTLFPKCTH* |
| Ga0137392_106179941 | 3300011269 | Vadose Zone Soil | IARAAEAAGISADQWLFTLSDLMVMVTLFPKCTH* |
| Ga0137392_110240862 | 3300011269 | Vadose Zone Soil | HGLARRRHIGFIARADEAAGKQADQWLFTLSDLMVLVMLHPCCEH* |
| Ga0137392_114930151 | 3300011269 | Vadose Zone Soil | VATLTGICVDHLHNFAKSRHLGFIARAAEAAGLQADQWLFTLSDLMVLVTLFPRCTH* |
| Ga0137391_113916921 | 3300011270 | Vadose Zone Soil | VHNFAKSRHLGFIARAAEAAGITADQWLFTLSDLMVLVT |
| Ga0137393_106860192 | 3300011271 | Vadose Zone Soil | LEHLHSLARSRHLGFIARAAEVAGKQADQWLFTLSDLMVLAMLYPGCEH* |
| Ga0137393_108487912 | 3300011271 | Vadose Zone Soil | CVDHLHNFAKSRHLGFIARAAEAAGLQADQWLFTLSDLMVLVTLFPRCTH* |
| Ga0137393_110350052 | 3300011271 | Vadose Zone Soil | LHGLARNRRLGFIAHADEAAGKQADQWLFTLPDLMVLAMLYPGCEH* |
| Ga0137393_116256812 | 3300011271 | Vadose Zone Soil | RTRRIGFIARAAEAVGKQAEQWLFTRSDLMVLAMLYHRC* |
| Ga0137389_100269991 | 3300012096 | Vadose Zone Soil | HLGFIARAAEAAGISADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0137389_103843931 | 3300012096 | Vadose Zone Soil | FIARAAEAAGISADQWLFTLSDLMVLVTLFPKCSH* |
| Ga0137389_107394271 | 3300012096 | Vadose Zone Soil | FIARAAEAAGIQADQWLFTLSDLMVLVTLFPRCTH* |
| Ga0137389_108175512 | 3300012096 | Vadose Zone Soil | GFIARAAEAAGISADQWLFSLSDLMVLVTLFPKCTH* |
| Ga0137388_102449411 | 3300012189 | Vadose Zone Soil | RRRRLGFIARAAQAAGINADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0137388_105402452 | 3300012189 | Vadose Zone Soil | EHLHGLAKTRHLGFIARAAEAAGKQADQWLFTLSDLIVLVRLYPRCQH* |
| Ga0137388_105721581 | 3300012189 | Vadose Zone Soil | FIARAAEAAGISADQWLFSLSDLMVLVTLFPKCTH* |
| Ga0137388_115192112 | 3300012189 | Vadose Zone Soil | CVEHVHNFARRRHLGFIARAAEAAGKQADQWLFTLSDLMVLVTLFPKCSH* |
| Ga0137388_116160642 | 3300012189 | Vadose Zone Soil | EHVHNFAKSRHLGFIARAAEAAGISADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0137388_118649801 | 3300012189 | Vadose Zone Soil | IARAAEAAGLQADQWLFTLSDLMVLVTLFPRCTH* |
| Ga0137364_112843812 | 3300012198 | Vadose Zone Soil | IARADEAAGKQADQWLFTLSDLMVLVMLHPCCEH* |
| Ga0137383_108534641 | 3300012199 | Vadose Zone Soil | IARAAEAAGINADQWLFTLSDLMVMVTLFPKCTH* |
| Ga0137383_108942642 | 3300012199 | Vadose Zone Soil | ICVEHVHNFAKSRHLGFIARAAEAAGRSADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0137382_100557871 | 3300012200 | Vadose Zone Soil | IARADEAAGKQADQWLFTLSDLMVLVRLYPRCEH* |
| Ga0137382_102044661 | 3300012200 | Vadose Zone Soil | NLTGICVDHLHNFAKSRHLGFIARAAEAAGIQADQWLFTLSDLMVLVTLFPRCTH* |
| Ga0137382_111815902 | 3300012200 | Vadose Zone Soil | GFIARAAEAAGISADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0137363_101147361 | 3300012202 | Vadose Zone Soil | RHLGFIARAAEAAGAHADQWLFSLSDLMVLVTLFPKCTH* |
| Ga0137363_101565171 | 3300012202 | Vadose Zone Soil | IFTDSEVANLTGICVEHVHNFAKSRHLGFIARAAEAAGINADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0137363_110365931 | 3300012202 | Vadose Zone Soil | TRHIGFIARAAEAVGKQAEQWLFTRSDLMVLAMLYHHC* |
| Ga0137363_113530871 | 3300012202 | Vadose Zone Soil | HIHKFARTRHLGFIARAAEAAGKADNWLFTLSDLMVLVTLFPKCTH* |
| Ga0137399_102568034 | 3300012203 | Vadose Zone Soil | HSLARTRRLGFIARAAEVAGKQADQWLFTLSDLMVLVMLYPGCKH* |
| Ga0137399_107596222 | 3300012203 | Vadose Zone Soil | EVANLTGLCVDHPRNFPKSRHLGFIARAAEAAGIPAAQWLFTLSDLMVLVTLFPRCTH* |
| Ga0137362_100257871 | 3300012205 | Vadose Zone Soil | SRHLGFIAHADEAAGKQADQWLFTLRDLMVLAMLYPGCEH* |
| Ga0137362_104125822 | 3300012205 | Vadose Zone Soil | HNFAKSRHLGFIARAAEAAGAHADQWLFSLSDLMVLVTLFPKCTH* |
| Ga0137362_111426002 | 3300012205 | Vadose Zone Soil | EVANLTGVCVDHLHNFAKSRHLGFIARAAEAAGIQADQWLFTLSDLMVLVTLFPRCTH* |
| Ga0137379_108523112 | 3300012209 | Vadose Zone Soil | HLHNFARRRHLGFIARAAEAAGKQADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0137379_113069581 | 3300012209 | Vadose Zone Soil | NFAKSRHLGFIARAAEAAGRSADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0137379_115761382 | 3300012209 | Vadose Zone Soil | ARRRHLGFIARAAEAAGKQADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0137378_116027011 | 3300012210 | Vadose Zone Soil | KSRHLGFIARAAEAAGINADQWLFTLSDLMVLVTLFPKCSH* |
| Ga0137377_100964693 | 3300012211 | Vadose Zone Soil | FIARAAEVAGMQPDRWLFTLSDLMVLLMLHPRCEH* |
| Ga0137377_102447151 | 3300012211 | Vadose Zone Soil | LARRRHLGFIARAAEVAGMQPDQWLFTLSDVMVLLMLHPHCEH* |
| Ga0137377_115160592 | 3300012211 | Vadose Zone Soil | GICVEHVHNFAKSRHLGFIARAAEAAGRSADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0137370_101650782 | 3300012285 | Vadose Zone Soil | VEHVHNFAKSRHLGFIARAAEAAGISADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0137387_100498661 | 3300012349 | Vadose Zone Soil | RTRHIGFIARAAEAAGKQAEHWLFTRSDLMVLAMLYQHC* |
| Ga0137387_112512262 | 3300012349 | Vadose Zone Soil | EHVHNFAKSRHLGFIARAAEAAGRSADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0137386_105214101 | 3300012351 | Vadose Zone Soil | FIARAAEAASISADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0137371_101501533 | 3300012356 | Vadose Zone Soil | VEHLHNFARRRHLGFIARAAEAAGKQADQWLFTLSDLMVLVTLFPKCSH* |
| Ga0137384_100583627 | 3300012357 | Vadose Zone Soil | LERLHYLARTRHIGFIARAAEAAGKQAEHWLFTRSDLMVLAMLFHSC* |
| Ga0137384_114359391 | 3300012357 | Vadose Zone Soil | IARAAEAAGINADQWLFTLSDLMVLVTLFPKCSH* |
| Ga0137384_114752842 | 3300012357 | Vadose Zone Soil | CVEHVHNFAKTRHLGFIARAAEAAGIKADRWLFTLSDLMVLVTLFPKCTH* |
| Ga0137385_106076371 | 3300012359 | Vadose Zone Soil | EHLHRLARSRRLGFIAHADEAAGKQADQWLFTLPDLMVLAMLYPGCEH* |
| Ga0137360_100080043 | 3300012361 | Vadose Zone Soil | LTGICVEHVHNFAKSRHLGFIARAAEAAGISADQWLFTLSDLMVLVTLFPKCSH* |
| Ga0137360_100282393 | 3300012361 | Vadose Zone Soil | DAEVARLTGICVDHLHNFAKRRHLGFIARAAEAAGIQADQWLFTLSDLMVLVTLFPRCSH |
| Ga0137360_106167402 | 3300012361 | Vadose Zone Soil | GIGLERLRQLARTRHIGFIARAAEAAGKQAEQWLFTRSDLMVLAMLYHHC* |
| Ga0137360_108645242 | 3300012361 | Vadose Zone Soil | FIARAAEAAGISADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0137360_109980631 | 3300012361 | Vadose Zone Soil | NLTGICVEHVHNFAKSRHLGFIARAAEAAGINADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0137360_118395072 | 3300012361 | Vadose Zone Soil | GICVDHLHNFAKRRHLGFIARAAEAAGIQADQWLFTLSDLMVLVTLFPRCSH* |
| Ga0137361_101031184 | 3300012362 | Vadose Zone Soil | DHLHNFAKSRHLGFIARAAEAAGIQADQWLFTLSDLMVLVTLFPRCTH* |
| Ga0137361_111237381 | 3300012362 | Vadose Zone Soil | EHLHNLVKRHRLGFIARAAEAAGTKADRLLFTPWDLTLLVTLFPRCTH* |
| Ga0137361_117897071 | 3300012362 | Vadose Zone Soil | GICVEHLHNFAKRRRLGFIVRAAEAAGVRADQRLFTSWDLTVLVTLFPHCTH* |
| Ga0137358_103251022 | 3300012582 | Vadose Zone Soil | ARTRHIGFIARAAEAAGRQAEQWLFTRSDLMVLAMLYHHC* |
| Ga0137358_110511861 | 3300012582 | Vadose Zone Soil | FIARAAEAAGINADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0137358_110816623 | 3300012582 | Vadose Zone Soil | TGICVDHLHNFAKSRHLGFIARAAEAAGAHADQWLFSLSDLMVLATLFPKCTH* |
| Ga0137398_100603473 | 3300012683 | Vadose Zone Soil | FAKSRHLGFIARAAEAAGAHADQWLFSLSDLMVLVTLFPKCTH* |
| Ga0137398_106009741 | 3300012683 | Vadose Zone Soil | NFAKSRHLGFIARAAEAAGAHADQWLFSLSDLMVLVTLFPKCTH* |
| Ga0137397_105524092 | 3300012685 | Vadose Zone Soil | ICVEHVHNFAKSRHLGMIARAAEAAGAQADQWLFTLSDLMVLVTLFPRCSH* |
| Ga0137397_110725881 | 3300012685 | Vadose Zone Soil | KSRHLGFIARAAEAAGINADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0137396_104902752 | 3300012918 | Vadose Zone Soil | EHVHNFAKSRHLGFIARAAEAAGINADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0137396_112663061 | 3300012918 | Vadose Zone Soil | IFTDSEVANLTGICVEHVHNFAKSRHLGFIARAAEAAGITADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0137394_113994881 | 3300012922 | Vadose Zone Soil | VHNFAKSRHLGMIARAAEAAGAQADQWLFTLSDLMVLVTLFPRCSH* |
| Ga0137359_106121142 | 3300012923 | Vadose Zone Soil | DHIHNFAKSRHLGFIARAAEAAGAHADQWLFSLSDLMVLVTLFPKCTH* |
| Ga0137413_100342013 | 3300012924 | Vadose Zone Soil | TGIGLERLRQLARTRHIGFIARAAEAAGRQAEQWLFTRSDLMVLAMLYHHC* |
| Ga0137413_103573591 | 3300012924 | Vadose Zone Soil | KTRHLGFIARAAEAAGKADNWLFTLSDLMVLVTLFPKCTH* |
| Ga0137413_115582341 | 3300012924 | Vadose Zone Soil | AKSRHLGFIARAAEAAGLSADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0137419_100294481 | 3300012925 | Vadose Zone Soil | HGLARRRHLGFIARANEAAGKQADQWLFTLSDLMVLVMLHPSCEH* |
| Ga0137419_108692202 | 3300012925 | Vadose Zone Soil | CVEHLHNFAKRRRLGFIVRAAEAAGVRADQRLFTSWDLTVLVTLFPHCTH* |
| Ga0137419_116656992 | 3300012925 | Vadose Zone Soil | VEHVHNFAKSRHLGFIARAAEAAGINADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0137416_103213874 | 3300012927 | Vadose Zone Soil | GFIARADQAAGKQADQWLFTLSDLMVLAMLYPCCEH* |
| Ga0137416_114561801 | 3300012927 | Vadose Zone Soil | IHNFAKSRHLGFIARAAEAAGIQADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0137416_119455122 | 3300012927 | Vadose Zone Soil | EVANLTGICVEHVHNFAKSRHLGFIARAAEAAGINADQWLFTLSDLMVLVTLFPKCSH* |
| Ga0137404_101388231 | 3300012929 | Vadose Zone Soil | CVEHVHNFAKSRHLGFIARAAEAAGIHADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0137404_111722283 | 3300012929 | Vadose Zone Soil | DSEVATLTGICIDHIHKFAKTRHLGFIARAAEAAGKADNWLFTLSDLMVLVTLFPKCTH* |
| Ga0137404_115743252 | 3300012929 | Vadose Zone Soil | CVEHVHNFAKSRHLGFIARAAEAAGLSADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0137404_116501301 | 3300012929 | Vadose Zone Soil | MIARAAEAAGAQADQWLFTLSDLMVLVTLFPRCSH* |
| Ga0137407_115827461 | 3300012930 | Vadose Zone Soil | SRHLGFIARAAEAAGAHADQWLFSLSDLMVLATLFPKCTH* |
| Ga0137407_120086761 | 3300012930 | Vadose Zone Soil | TDSEVANLTGICVEHVHNFAKSRHLGFIARAAEAAGINADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0153915_109914102 | 3300012931 | Freshwater Wetlands | NFARSRHLGFIARAAEAAGKQADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0126369_115108821 | 3300012971 | Tropical Forest Soil | GICVEHIHNFAKSRHLGFISRAAEKAGAQADQWLFSLSDLMVLVALFPKCTH* |
| Ga0164305_119315572 | 3300012989 | Soil | LGFIARAAESFGDEAGQWLFTPWDLMVLATLFPRCTH* |
| Ga0181527_11124941 | 3300014153 | Bog | LTGICVEHLHNFARSRHLGFIARAAEAAGARADQWLFTLSDLMVLVTLFPRCTH* |
| Ga0134075_100235431 | 3300014154 | Grasslands Soil | LTGISLEHLHGLARSRHLGFIARSDEAAGKQAEQWMFTLPDLMVLAMLYPGCEH* |
| Ga0181532_101143273 | 3300014164 | Bog | ARSRHLGMIARAAEAAGAQAEQWLFTLSDLMVLTTLFPRCTH* |
| Ga0137420_10207901 | 3300015054 | Vadose Zone Soil | GRGSRPAEAAGIHADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0137420_10990141 | 3300015054 | Vadose Zone Soil | AAEAAGLSADQWLFTDQWLFTLSDLMVLVTLFPKCTH* |
| Ga0137420_11901093 | 3300015054 | Vadose Zone Soil | HLGFIARAAEAAGINADQWLFTLSDLMVLVTLFPKCTH* |
| Ga0137412_100711831 | 3300015242 | Vadose Zone Soil | ATLTGIGLERLRQLARTRHIGFIARAAEAAGRQAEQWLFTRSDLMVLAMLYHHC* |
| Ga0182041_100060244 | 3300016294 | Soil | RHLGFIARAAEAAGINADRWLFTLSDLMVIVTLFPKCTH |
| Ga0182033_104187832 | 3300016319 | Soil | LTGICVDHLHNFARSRHLGMIARAAEAAGVQAEQWLFTLSDLMVLVTLFPRCTH |
| Ga0182039_104255501 | 3300016422 | Soil | RHLGFIARAAEAAGINADQWLFTLSDLMVMVTLFPKCTH |
| Ga0182038_106186422 | 3300016445 | Soil | LHNFARSRHLGIIARAAEAAGAQAEQWLFTLSDLMVLTTLFPRCTH |
| Ga0187803_103725302 | 3300017934 | Freshwater Sediment | FIARAAEAAGIQADQWLFTLSDLMVLVTLFPRCTH |
| Ga0187785_101226842 | 3300017947 | Tropical Peatland | HNFARSRHLGMIARAAEAAGAQAEQWLFTLSDLMVLATLFPRCTH |
| Ga0187817_101068913 | 3300017955 | Freshwater Sediment | LTGICVEHVHNFARSRHLGIIARAAEAAGNQAERWLFTPSDLMVLVTLFPRCTH |
| Ga0187778_105300021 | 3300017961 | Tropical Peatland | SRHLGMIARAAEAAGVQAEQWLFTLSDLMVLATLFPRCTH |
| Ga0187780_101763422 | 3300017973 | Tropical Peatland | LTGICVEHVHNFARSRHLGMIARAAEAAGVQAEQWLFTLSDLMVLATLFPRCTH |
| Ga0187782_113716931 | 3300017975 | Tropical Peatland | SRHLGMIARAAEAAGAQAEQWLFTLSDLMVLTTLFPRCTH |
| Ga0187767_100803351 | 3300017999 | Tropical Peatland | VHNFARSRHLGMIARAAEAAGVQAEQWLFTLSDLMVLATLFPRCTH |
| Ga0187772_111809372 | 3300018085 | Tropical Peatland | HNFARRRHLGMIARAAEAAGAQAEQWLFTLSDLMVLATLFPRCTH |
| Ga0187771_100970241 | 3300018088 | Tropical Peatland | ICVEHVHNFARSRHLGMIARAAEAAGAQAEQWLFTLSDLMVLATLFPRCSH |
| Ga0187771_111498622 | 3300018088 | Tropical Peatland | LTGICVDHLHNFARSRHLGIIARAAEAAGSQAEQWLFTLSDLMVLATLFPRCTH |
| Ga0187774_112944531 | 3300018089 | Tropical Peatland | NFARSRHLGMIARAAEAAGAQADQWLFTLSDLMVLVTLFPRCSH |
| Ga0187770_106798991 | 3300018090 | Tropical Peatland | SRHLGIIARAAEAAGNQAEQWLFTLSDLMVLVTLFPRCTH |
| Ga0187770_110968881 | 3300018090 | Tropical Peatland | NFARSRHLGIIARAAEAAGNQAEQWLFTLSDLMVLVTLFPRCTH |
| Ga0066667_110633101 | 3300018433 | Grasslands Soil | ICVEHVHNFAKSRHLGFIARAAEAAGLSADQWLFTLSDLMVLVTLFPKCTH |
| Ga0193730_10814101 | 3300020002 | Soil | VHNFAKSRHLGFIARAAEAAGISADQWLFTLSDLMVLVTLFPKCTH |
| Ga0179594_101068423 | 3300020170 | Vadose Zone Soil | KSRHLGFIARAAEAAGINADQWLFTLSDLMVLVTLFPKCTH |
| Ga0179592_100992712 | 3300020199 | Vadose Zone Soil | EVANLTGICVEHVHNFAKSRHLGFIARAAEAAGINADQWLFTLSDLMVLVTLFPKCTH |
| Ga0210407_100116046 | 3300020579 | Soil | LGMIARAAEAAGAQADQWLFTLSDLMVLVTLFPRCSH |
| Ga0210407_104220311 | 3300020579 | Soil | LTGICVEHVHNFAKSRHLGFIARAAEAAGKSADQWLFTLSDLMVLVTLFPKCTH |
| Ga0210407_108266482 | 3300020579 | Soil | FIARAAEAAGLSADQWLFTLSDLMVLVTLFPKCTH |
| Ga0210403_105011161 | 3300020580 | Soil | EHLHNFARSRHLGFIARAAEAAGAQADQWLFTLSDLMVLVTLFPRCSH |
| Ga0210399_103280141 | 3300020581 | Soil | AKSRHLGFIARAAEAAGLQADQWLFTLSDLMVLVTLFPRCTH |
| Ga0210399_114907062 | 3300020581 | Soil | HVHNFAKKRHLGFIARAAEAAGISADQWLFTLSDLMVMVTLFPKCTH |
| Ga0210399_115908951 | 3300020581 | Soil | RHLGFIARAAEAAGKQADQWLFTLSDLMVLVTLFPRCTH |
| Ga0210395_114456191 | 3300020582 | Soil | HNFAKSRHLGFIARAAERAGIQADQWLFTLSDLMVLVTLFPRCTH |
| Ga0210401_105382432 | 3300020583 | Soil | LTGICVEHVHNFAKSRHLGMIARAAEAAGAQADQWLFTLSDLMVLVTLFPRCSH |
| Ga0210401_111953252 | 3300020583 | Soil | VDHIRNFAKSRHLGFIARAAEAAGKQADQWLFTLSDLMVLVTLFPRCTH |
| Ga0215015_107921032 | 3300021046 | Soil | CLEHLHGVARRRHLGFIARADEAAGKQADQWLFTLSDLMVLAMLHPCCEH |
| Ga0210404_102998621 | 3300021088 | Soil | HVHNFAKSRHLGMIARAAEAAGAQADQWLFTLSDLMVLVTLFPRCSH |
| Ga0210404_107702082 | 3300021088 | Soil | NFAKSRHLGFIARAAEAAGIQADQWLFTLSDLMVLVTLFPRCTH |
| Ga0210404_107826041 | 3300021088 | Soil | FAKSRHLGFIARAAERAGLQADQWLFTLSDLMVLVALFPRCTH |
| Ga0210406_111959151 | 3300021168 | Soil | HNFARSRHLGFIARAAEAAGAQADQWLFTLSDLMVLTTLFPRCTH |
| Ga0210400_112356001 | 3300021170 | Soil | DHLHNFAKSRHLGFIARAAEAAGIQADQWLFTLSDLMVLVTLFPRCTH |
| Ga0210400_116725601 | 3300021170 | Soil | HLGTIARAAEAAGEHAEQLLFSSSDLNVLTVLVSRCQH |
| Ga0210405_104459562 | 3300021171 | Soil | SLTVICVEHVHNFAKSRHLGFIARAAEAAGINADQWLFTLSDLMVLVTLFPKCTH |
| Ga0210405_106477031 | 3300021171 | Soil | TGICVEHVHNFAKSRHLGFIARAAEAAGISADQWLFTLSDLMVMVTLFPKCTH |
| Ga0210408_102274531 | 3300021178 | Soil | EHVHNFAKSRHLGFIARAAEAAGISADQWLFTLSDLMVMVTLFPKCTH |
| Ga0210408_112689561 | 3300021178 | Soil | KSRHLGFIARAAEAASISADQWLFTLSDLMVMVTLFPKCTH |
| Ga0210393_112137271 | 3300021401 | Soil | ICVDHIRNFAKSRHLGFIARAAEAAGKQADQWLFTLSDLMVLVTLFPRCTH |
| Ga0210387_104092801 | 3300021405 | Soil | FIARAAEAAGNQADQWLFTLSDLMVLVTLFPRCTH |
| Ga0210392_111000341 | 3300021475 | Soil | GMIARAAEAAGAQADQWLFTLSDLMVLVTLFPRCSH |
| Ga0210402_112937302 | 3300021478 | Soil | NNHCRHLGFIARAAEAAGAQADQWLFTLSDLMVLVTLFPRCSH |
| Ga0210402_117062732 | 3300021478 | Soil | GICVEHIRNFAKSRHLGFIARAAEAAGLSADQWLFTLSDLTVLVTLFPKCTH |
| Ga0210410_113519402 | 3300021479 | Soil | LGFIARAAEAAGRQADQWLFTLSDLMVLTTLFEKCSH |
| Ga0210409_115649431 | 3300021559 | Soil | DHLYNFAKRRRLGFIARAAETASSQADQWLFTPWDLTVLVTLFPRCAH |
| Ga0242662_100738641 | 3300022533 | Soil | RLGFIARAAETAKVQADQLLFTPWDLILLVTLFSPCAH |
| Ga0212123_100322644 | 3300022557 | Iron-Sulfur Acid Spring | SRHLGFIARAAEAASMTADQWLFTLSDLMVLVTLFPKCTH |
| Ga0247679_10343001 | 3300024251 | Soil | GFIARAAAAAGKADNWLFTLSDLMVLVTLFPKCSH |
| Ga0137417_14200031 | 3300024330 | Vadose Zone Soil | VANLTGICVDHLHNFAKSRHLGFIARAAEAAGIQADQWLFTLSDLMVLVTLFPRCTH |
| Ga0137417_14724873 | 3300024330 | Vadose Zone Soil | VDHLHNFAKSRHLGFIARAAEAAGIQADQWLFTLSDLMVLVTLFPRCTH |
| Ga0208039_10862532 | 3300025454 | Peatland | FIARAAEAAGARADQWLFTLSDLMVLVTLFPRCTH |
| Ga0207692_110103811 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | GICVDHLHNFARSRHLGFIARAAEAAGAQADQWLFTLSDLMVLTTLFPRCTH |
| Ga0207685_106165042 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | RHLGFIARAAEAAGAHADQWLFSLSDLMVLATLFPKCTH |
| Ga0207663_117047081 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | KTRHLGFIARAAEAAGIRADQWLFTLSDLMVLVTLFPKCTH |
| Ga0207646_101978343 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VNLTGICVEHLHNFAKRRRLGFIARVAAAAGDQADQWLFTPWDLTVLVTLFPRCTH |
| Ga0207665_102782092 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | KSRHLGFIARAAEAASMTADQWLFTLSDLMVLVTLFPKCTH |
| Ga0209240_10821131 | 3300026304 | Grasslands Soil | GLARNRRLGFIAHADEAAGKQADQWLFTLPDLMVLAMLYPGCEH |
| Ga0209240_11699702 | 3300026304 | Grasslands Soil | KSRHLGFIARAAEAAGARADQWLFSLSDLMVIVTLFPKCTH |
| Ga0209469_11091321 | 3300026307 | Soil | HLGFIARAAEAAGINADQWLFTLSDLMVIVTLFPKCTH |
| Ga0209239_10012121 | 3300026310 | Grasslands Soil | GFIARAAEAAGISADQWLFTLSDLMVLVTLFPKCTH |
| Ga0209802_13302531 | 3300026328 | Soil | LGFIARAAEAAGINADQWLFTLSDLMVLVTLFPKCSH |
| Ga0209473_10575851 | 3300026330 | Soil | KTRHLGFIARAAEAAGINADQWLFTLSDLMVIVTLFPKCTH |
| Ga0209158_13700722 | 3300026333 | Soil | HVHNFAKSRHLGFIARAAEAAGLSADQWLFTLSDLMVLVTLFPKCTH |
| Ga0209377_10258524 | 3300026334 | Soil | RRHLGFIARAAEAAGKQADQWLFTLSDLMVLVTLFPKCSH |
| Ga0257163_10508092 | 3300026359 | Soil | KTRHLGFIARAAEVAGEQADQWLFTLSDLMVLVMLHPRCQH |
| Ga0257154_10627371 | 3300026467 | Soil | AKSRHLGMIARAAEAAGAQADQWLFTLSDLMVLVTLFPRCSH |
| Ga0257153_10246311 | 3300026490 | Soil | LGFIARAAEAAGAHADQWLFSLSDLMVLVTLFPKCTH |
| Ga0209378_12227071 | 3300026528 | Soil | ICVEHVHNFAKSRHLGFIARAAEAAGISADQWLFTLSDLMVLVTLFPKCTH |
| Ga0209157_13365992 | 3300026537 | Soil | FIARAAEAAGKQADQWLFTLSDLMVLVTLFPKCSH |
| Ga0209056_104190291 | 3300026538 | Soil | RHLGFIARAAEAAGLSADQWLFTLSDLMVLVTLFPKCTH |
| Ga0209161_100745351 | 3300026548 | Soil | LGFIARAAEVAAMQPDRWLFTLSDLMVLLMLHPRCEH |
| Ga0209648_100672901 | 3300026551 | Grasslands Soil | GICVEHVHNFAKSRHLGFIARAAEAAGISADQWLFTLSDLMVMVTLFPKCTH |
| Ga0209577_100453461 | 3300026552 | Soil | CVEHVHNFAKTRHLGFIARAAEAAGIKADQWLFTLSDLMVLVTLFPKCTH |
| Ga0207728_1171392 | 3300026833 | Tropical Forest Soil | TGICVEHVHNFARSRHLGMIARAAEAAGVQAEQWLFTLSDLMVLVTLFPRCTH |
| Ga0209419_10409312 | 3300027537 | Forest Soil | LTVICVDHLHNFAKSRHLGFIARAAEAAGIQADQWLFTLSDLMVLVTLFPRCTH |
| Ga0209735_10741832 | 3300027562 | Forest Soil | EHVHNFAKSRHLGFIARAAEAAGISADQWLFTLSDLMVLVTLFPKCTH |
| Ga0209331_10601831 | 3300027603 | Forest Soil | EVANLTGICVDHLHNFAKSRHLGFIARAAEAAGLQADQWLFTLSDLMVLVTLFPRCTH |
| Ga0209528_11453922 | 3300027610 | Forest Soil | FAKSRHLGFIARAAERAGLQADQWLFTLSDLMVLVTLFPRCTH |
| Ga0209117_10995822 | 3300027645 | Forest Soil | RHLGFIARAAEAAGISADQWLFTLSDLMVLVTLFPKCTH |
| Ga0209388_10654272 | 3300027655 | Vadose Zone Soil | RLARSRHLGFIAHADEAAGKQADQWLFTLPDLMVLAMLYPGCEH |
| Ga0209588_10911581 | 3300027671 | Vadose Zone Soil | HLGFIARAAEAAGLQADQWLFTLSDLMVLVTLFPRCTH |
| Ga0209581_10045271 | 3300027706 | Surface Soil | KSRHLGFIARAAEAAGLQADQWLFTLSDLMVLVTLFPKCTH |
| Ga0209581_10133319 | 3300027706 | Surface Soil | KSRHLGFIARAAERAGIQADQWLFTLSDLMVLVTLFPKCTH |
| Ga0209655_100912111 | 3300027767 | Bog Forest Soil | NFAKKRHLGFIARAAEAAGRQADQWLFTLSDLMVLTTLFEKCSH |
| Ga0209656_103581402 | 3300027812 | Bog Forest Soil | IHNFAKSRHLGFIARAAEAAGAQADQWLFSLSDLMVLVTLFPKCTH |
| Ga0209039_101796592 | 3300027825 | Bog Forest Soil | LTGICVEHVHNFARSRHLGMIARAAEAAGAQADQWLFTLSDLMVLVTLFPRCSH |
| Ga0209773_104320932 | 3300027829 | Bog Forest Soil | RRHLGFLARAAEAAGAQADQWLFTLSDLMVLVTLFPRCTH |
| Ga0209580_102642252 | 3300027842 | Surface Soil | GICVDHIHNFAKSRHLGFIARAAEAAGAQADQWLFTLSDLMVLVTLFPKCTH |
| Ga0209180_106518931 | 3300027846 | Vadose Zone Soil | HNFAKSRHLGFIARAAEAASLSADQWLFTLSDLMVLVTLFPKCTH |
| Ga0209701_101766631 | 3300027862 | Vadose Zone Soil | GLERLRQLARTRHIGFIARAAEAAGRQAEQWLFTRSDLMVLAMLYHHC |
| Ga0209701_102386152 | 3300027862 | Vadose Zone Soil | LEHLHSLARSRHLGFIARAAEVAGKQADQWLFTLSDLMVLAMLYPGCEH |
| Ga0209167_106745251 | 3300027867 | Surface Soil | LGFIARAAEAAGKQADQWLFTLSDLMVLVTLFPRCTH |
| Ga0209275_100119613 | 3300027884 | Soil | GICVEHVHNFAKSRHLGMIARAAEAAGAQADQWLFTLSDLMVLVTLFPRCSH |
| Ga0209275_102352101 | 3300027884 | Soil | TGICVDHIRNLAKSRHLGFIARAAEAAGKQADQWLFTLSDLMVLVTLFPRCTH |
| Ga0209006_100425001 | 3300027908 | Forest Soil | LTGICVDHLHNFAKSRHLGFIARAAEAASMTADQWLFTLSDLMVLVTLFPKCTH |
| Ga0209526_101426233 | 3300028047 | Forest Soil | VEYVHNFAKSRHLGFIARAAEAAGIHADQWLFTLSDLMVLVTLFPKCTH |
| Ga0247689_10610542 | 3300028281 | Soil | HLGFIARAAEAAGAQADQWLFTLSDLMVLVTLFPKCTH |
| Ga0247662_10651892 | 3300028293 | Soil | VDHIHNFAKSRHLGFIARAAEAAGAQADQWLFTLSDLMVLVTLFPKCTH |
| Ga0137415_111426561 | 3300028536 | Vadose Zone Soil | CLEHLHGLARSRRLGFIAHADEAAGKQADQWLFTLPDLMVLAMLYPGCEH |
| Ga0137415_113225532 | 3300028536 | Vadose Zone Soil | EVANLTGICVEHVHNFAKSRHLGFIARAAEAAGINADQWLFTLSDLMVLVTLFPKCSH |
| Ga0302224_102136921 | 3300028759 | Palsa | RHLGFIARAAERAGIQADQWLFTLSDLMVLVTLFPRCTH |
| Ga0308309_105521032 | 3300028906 | Soil | HLGFIARAAEAAGKSADQWLFTLSDLMVLVTLFPKCTH |
| Ga0308309_109083271 | 3300028906 | Soil | CAKSRHLGFIARAAEAAGKQADQWLFTLSDLMVLVTLFPRCTH |
| Ga0311352_103549662 | 3300029944 | Palsa | VEHLHNFAKKRHLGFIARAAEAAGRQADQWLFTLSDLMVLTTLFEKCTH |
| Ga0311355_111391331 | 3300030580 | Palsa | AKKRHLGFIARAAEAAGRQADQWLFTLSDLMVLTTLFEKCTH |
| Ga0311354_108894001 | 3300030618 | Palsa | KKRHLGFIARAAEAAGRQADQWLFTLSDLMVLTTLFEKCTH |
| Ga0170834_1086395511 | 3300031057 | Forest Soil | NFVKRHRLGFIACAAEAAGTKADQLFFTPWDLTLLVTLFPRCTH |
| Ga0265340_102313691 | 3300031247 | Rhizosphere | FIARAAEAAGKQADQWLFTLSDLMVLVTLFPRCTH |
| Ga0170818_1010767351 | 3300031474 | Forest Soil | SRHLGFIARAAEAAGAHADQWLFSLSDLMVLVTLFPKCTH |
| Ga0310915_111511121 | 3300031573 | Soil | RHLGFIARAAEAAGAQADQWLFTLSDLMVLVTLFPKCTH |
| Ga0318561_100339103 | 3300031679 | Soil | HLHNFARSRHLGMIARAAEAAGVQAEQWLFTLSDLMVLVTLFPRCTH |
| Ga0310813_112570172 | 3300031716 | Soil | LTGICVDHLHNFAKSRHLGFIARAAERAGIQADQWLFTLSDLMVLVTLFPRCTH |
| Ga0307469_101584291 | 3300031720 | Hardwood Forest Soil | LTGICVDHLRNFAKSRHLGFIARAAEAAGIQADQWLFTLSDLMVLVTLFPRCTH |
| Ga0307469_102796861 | 3300031720 | Hardwood Forest Soil | GFIARAAEAAGAKADNWLFTLSDLMVLVTLFPKCTH |
| Ga0307469_103936042 | 3300031720 | Hardwood Forest Soil | VDHLRNFAKSRHLGFIARAAEAAGIQADQWLFTLSDLMVLVTLFPRCTH |
| Ga0307469_108340342 | 3300031720 | Hardwood Forest Soil | RHLGFIARAAEAAGIHADQWLFTLSDLMVLVTLFPKCTH |
| Ga0306918_103897951 | 3300031744 | Soil | ARSRHLGMIARAAEAAGVQAEQWLFTLSDLMVLVTLFPRCTH |
| Ga0306918_111978121 | 3300031744 | Soil | HLGMIARAAEAAGVQAEQWLFTLSDLMVLVTLFPRCTH |
| Ga0307477_105245711 | 3300031753 | Hardwood Forest Soil | ICVDHLRNFAKSRHLGFIARAAEAAGIQADQWLFTLSDLMVLVTLFPRCTH |
| Ga0307477_105384551 | 3300031753 | Hardwood Forest Soil | RHLGFIARAAEAAGITADQWLFTLSDLMVLVTLFPKCTH |
| Ga0307475_100049641 | 3300031754 | Hardwood Forest Soil | GFIARAAEAAGIQADQWLFTLSDLMVLVTLFPRCTH |
| Ga0307475_101744381 | 3300031754 | Hardwood Forest Soil | SEVANLTGICVEHVHNFAKRRHLGFIARAAEAAGITADQWLFTLSDLMVLVTLFPKCTH |
| Ga0307475_113235073 | 3300031754 | Hardwood Forest Soil | HLHNFAKSRHLGFIARAAEAAGIQADQWLFTLSDLMVLVTLFPRCTH |
| Ga0318521_102522541 | 3300031770 | Soil | FTDSEVSTLTGICVEHVHNFAKTRHLGFIARAAEAAGINADQWLFTLSDLMVIVTLFPKCTH |
| Ga0318546_101687861 | 3300031771 | Soil | LGFIARAAEAAGINADRWLFTLSDLMVIVTLFPKCTH |
| Ga0318576_104239792 | 3300031796 | Soil | EHVHNFAKTRHLGFIARAAEAAGINADRWLFTLSDLMVIVTLFPKCTH |
| Ga0307473_106134561 | 3300031820 | Hardwood Forest Soil | HLGFIARAAEAAGISADQWLFTLSDLMVLVTLFPKCTH |
| Ga0307478_112145291 | 3300031823 | Hardwood Forest Soil | NRHLGFIARAAEAAGNQADQWLFTLSDLMVLVTLFPRCTH |
| Ga0306919_102061403 | 3300031879 | Soil | TGICVDHLHNFARSRHLGMIARAAEAAGVQAEQWLFTLSDLMVLVTLFPRCTH |
| Ga0306923_100160884 | 3300031910 | Soil | LTGICVDHLHNFARSRHLGMIARAAEAAGAQAEQWLFTLSDLMVLVTLFPRCTH |
| Ga0310913_110898131 | 3300031945 | Soil | NFARSRHLGIIARAAEAAGAQAEQWLFTLSDLMVLTTLFPRCTH |
| Ga0310910_108488822 | 3300031946 | Soil | LTGICVEHLHNFARSRHLGIIARAAEAAGAQAEQWLFTLSDLMVLTTLFPRCTH |
| Ga0306926_100032161 | 3300031954 | Soil | GICVEHLHNFARRRHLGFLARAAEAAGAQAEQWLFTLSDLMVLVTLFPRCTH |
| Ga0307479_100625634 | 3300031962 | Hardwood Forest Soil | CLEHLHGLARRRHLGFISRADEAAGKQADQWLFTLPDLMVLTMLCPCCEH |
| Ga0307479_105167743 | 3300031962 | Hardwood Forest Soil | VANLTGICVDHLRNFAKRRHLGFIARAAEAAGIQADQWLFTLSDLMVLVTLFPRCTH |
| Ga0307479_106814902 | 3300031962 | Hardwood Forest Soil | RHLGFIARAAEAAGIQADQWLFTLSDLMVLVTLFPRCTH |
| Ga0307479_107279131 | 3300031962 | Hardwood Forest Soil | GICVDHLHNFAKSRHLGFIARAAEAAGIQADQWLFTLSDLMVLVTLFPRCTH |
| Ga0307479_114989342 | 3300031962 | Hardwood Forest Soil | LSHAADEAAGNQADQWLFTLPDLMVLAILYPSCEH |
| Ga0318569_103724041 | 3300032010 | Soil | FTDSEVSTLTGICVEHVHNFAKTRHLGFIARAAEAAGINADRWLFTLSDLMVIVTLFPKCTH |
| Ga0310911_108805171 | 3300032035 | Soil | TGLCTDHLHNFAKRRRLGFIVRTIKETSGGQAEQWLFTPSDLTVLAALFPRCAH |
| Ga0318533_108574841 | 3300032059 | Soil | GMIARAAEAAGVQAEQWLFTLSDLMVLVTLFPRCTH |
| Ga0318540_106256532 | 3300032094 | Soil | CVDHLHNFARSRHLGMIARAAEAAGVQAEQWLFTLSDLMVLVTLFPRCTH |
| Ga0307470_101224632 | 3300032174 | Hardwood Forest Soil | LTGICVDHIHNFAKSRHLGFIARAAEAAGAHADQWLFSLSDLMVLVTLFPKCTH |
| Ga0307470_115564372 | 3300032174 | Hardwood Forest Soil | TGICVDHLHNFAKSRHLGFIARAAEAAGIQADQWLFTLSDLMVLVTLFPRCTH |
| Ga0307471_1006911292 | 3300032180 | Hardwood Forest Soil | SRHLGFIARAAEAAGIQADQWLFTLSDLMVLVTLFPRCTH |
| Ga0307471_1009955832 | 3300032180 | Hardwood Forest Soil | RHLGFIARADEAAGKQADQWLITLPDLMVLAMLYPGCEH |
| Ga0307471_1013696711 | 3300032180 | Hardwood Forest Soil | IHNFAKSRHLGFIARAAEAAGAQADQWLFTLSDLMVLVTLFPKCTH |
| Ga0307471_1022316742 | 3300032180 | Hardwood Forest Soil | ICVEHVHNFAKSRHLGFIARAAEAAGINADQWLFTLSDLMVLVTLFPKCTH |
| Ga0307472_1000766011 | 3300032205 | Hardwood Forest Soil | VEHVHNFAKSRHLGFIARAAEAASINADQWLFTLSDLMVLVTLFPKCTH |
| Ga0307472_1016798071 | 3300032205 | Hardwood Forest Soil | RSRHLGFIARAAEAAGKADNWLFTLSDLMVLVTLFPKCTH |
| Ga0306920_1001917831 | 3300032261 | Soil | ICVDHLHNFARSRHLGMIARAAEAAGVQAEQWLFTLSDLMVLVTLFPRCTH |
| Ga0335085_101408134 | 3300032770 | Soil | LTGICVEHVHNFARSRHLGMIARAAEAAGAQAEQWLFTLSDLMVLATLFPRCTH |
| Ga0335079_113581931 | 3300032783 | Soil | VDHLRNFAKSRHLGFIARAAEAAGKQADQWLFTLSDLMVLVTLFPRCTH |
| Ga0335078_104800741 | 3300032805 | Soil | VHNFAKSRHLGFIARAAERAGIQADQWLFTLSDLMVLVTLFPKCSH |
| Ga0335078_125901411 | 3300032805 | Soil | VATLTGICVDHVHNFAKSRHLGFIARAAERAGIQADQWLFTLSDLMVLVTLFPKCSH |
| Ga0335080_103012863 | 3300032828 | Soil | FARSRHLGFIARAAEAAGAQADQWLFTLSDLMVLTTLFPRCTH |
| Ga0335081_108672111 | 3300032892 | Soil | LRNFAKSRHLGFIARAAEAAGKQADQWLFTLSDLMVLVTLFPRCTH |
| Ga0335074_114409292 | 3300032895 | Soil | LHNFARSRHLGMIARAAEAAGVQAEQWLFTLSDLMVLTTLFKRCTH |
| Ga0335073_104924171 | 3300033134 | Soil | TGICVEHLHNFARSRHLGMIARAAEAAGAQADQWLFTLSDLMVLVTLFPRCTH |
| Ga0335073_109278911 | 3300033134 | Soil | RSRHLGIIARAAEAAGAQAEQWLFTLSDLMVLTTLFPRCTH |
| Ga0335077_109116952 | 3300033158 | Soil | ARSRHLGMIARAAEAAGAQAEQWLFTLSDLMVLATLFPRCTH |
| Ga0326728_105309883 | 3300033402 | Peat Soil | LGFIARAAEAAGARADQWLFTLSDLMVLVTLFPRCTH |
| ⦗Top⦘ |