| Basic Information | |
|---|---|
| Family ID | F006996 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 360 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MTLKRHKHSAVTVHAIRQRAGVPYHVERKVCSSCRRLLDEKTIKRAAA |
| Number of Associated Samples | 242 |
| Number of Associated Scaffolds | 360 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 74.30 % |
| % of genes near scaffold ends (potentially truncated) | 31.39 % |
| % of genes from short scaffolds (< 2000 bps) | 81.94 % |
| Associated GOLD sequencing projects | 233 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (73.333 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (20.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.111 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (60.556 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 38.16% Coil/Unstructured: 61.84% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 360 Family Scaffolds |
|---|---|---|
| PF02146 | SIR2 | 31.94 |
| PF03734 | YkuD | 17.22 |
| PF03061 | 4HBT | 8.06 |
| PF13279 | 4HBT_2 | 3.61 |
| PF03372 | Exo_endo_phos | 2.78 |
| PF07501 | G5 | 2.22 |
| PF02771 | Acyl-CoA_dh_N | 0.83 |
| PF08818 | DUF1801 | 0.83 |
| PF04294 | VanW | 0.56 |
| PF11734 | TilS_C | 0.56 |
| PF00781 | DAGK_cat | 0.56 |
| PF07040 | DUF1326 | 0.28 |
| PF13627 | LPAM_2 | 0.28 |
| PF13312 | DUF4081 | 0.28 |
| PF07196 | Flagellin_IN | 0.28 |
| PF04981 | NMD3 | 0.28 |
| PF00412 | LIM | 0.28 |
| PF07136 | DUF1385 | 0.28 |
| PF01048 | PNP_UDP_1 | 0.28 |
| PF04032 | Rpr2 | 0.28 |
| PF02538 | Hydantoinase_B | 0.28 |
| PF13489 | Methyltransf_23 | 0.28 |
| PF13561 | adh_short_C2 | 0.28 |
| PF03401 | TctC | 0.28 |
| COG ID | Name | Functional Category | % Frequency in 360 Family Scaffolds |
|---|---|---|---|
| COG0846 | NAD-dependent protein deacetylase, SIR2 family | Posttranslational modification, protein turnover, chaperones [O] | 31.94 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 17.22 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 17.22 |
| COG1597 | Phosphatidylglycerol kinase, diacylglycerol kinase family | Lipid transport and metabolism [I] | 1.11 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.83 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.83 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.83 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.83 |
| COG0146 | N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunit | Amino acid transport and metabolism [E] | 0.56 |
| COG2720 | Vancomycin resistance protein YoaR (function unknown), contains peptidoglycan-binding and VanW domains | Defense mechanisms [V] | 0.56 |
| COG1499 | NMD protein affecting ribosome stability and mRNA decay | Translation, ribosomal structure and biogenesis [J] | 0.28 |
| COG1345 | Flagellar capping protein FliD | Cell motility [N] | 0.28 |
| COG2023 | Ribonuclease P protein subunit RPR2 | Translation, ribosomal structure and biogenesis [J] | 0.28 |
| COG2820 | Uridine phosphorylase | Nucleotide transport and metabolism [F] | 0.28 |
| COG1344 | Flagellin and related hook-associated protein FlgL | Cell motility [N] | 0.28 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.28 |
| COG3872 | Uncharacterized conserved protein YqhQ, DUF1385 family | Function unknown [S] | 0.28 |
| COG1256 | Flagellar hook-associated protein FlgK | Cell motility [N] | 0.28 |
| COG5588 | Uncharacterized conserved protein, DUF1326 domain | Function unknown [S] | 0.28 |
| COG0813 | Purine-nucleoside phosphorylase | Nucleotide transport and metabolism [F] | 0.28 |
| COG0775 | Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnB | Nucleotide transport and metabolism [F] | 0.28 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.33 % |
| Unclassified | root | N/A | 26.67 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908045|KansclcFeb2_ConsensusfromContig507403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1366 | Open in IMG/M |
| 2170459007|GJ8XV2H01AT1YC | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 508 | Open in IMG/M |
| 2228664022|INPgaii200_c1115241 | Not Available | 541 | Open in IMG/M |
| 3300000363|ICChiseqgaiiFebDRAFT_11041012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1113 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101666406 | Not Available | 762 | Open in IMG/M |
| 3300000550|F24TB_16502109 | Not Available | 625 | Open in IMG/M |
| 3300000887|AL16A1W_10173412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 664 | Open in IMG/M |
| 3300000891|JGI10214J12806_11324128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 554 | Open in IMG/M |
| 3300000956|JGI10216J12902_100956292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1345 | Open in IMG/M |
| 3300000956|JGI10216J12902_101674404 | Not Available | 1303 | Open in IMG/M |
| 3300000956|JGI10216J12902_102179471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 828 | Open in IMG/M |
| 3300000956|JGI10216J12902_103355381 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
| 3300000956|JGI10216J12902_103738662 | All Organisms → cellular organisms → Bacteria | 2767 | Open in IMG/M |
| 3300000956|JGI10216J12902_104487900 | Not Available | 756 | Open in IMG/M |
| 3300000956|JGI10216J12902_105593734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1353 | Open in IMG/M |
| 3300000956|JGI10216J12902_109404563 | Not Available | 651 | Open in IMG/M |
| 3300000956|JGI10216J12902_109809470 | Not Available | 725 | Open in IMG/M |
| 3300000956|JGI10216J12902_113644293 | All Organisms → cellular organisms → Bacteria | 2485 | Open in IMG/M |
| 3300001536|A1565W1_10767937 | Not Available | 1549 | Open in IMG/M |
| 3300001538|A10PFW1_10058489 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300002568|C688J35102_118627185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 579 | Open in IMG/M |
| 3300002568|C688J35102_120103149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 881 | Open in IMG/M |
| 3300002568|C688J35102_120497593 | Not Available | 1119 | Open in IMG/M |
| 3300002568|C688J35102_120985542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 6228 | Open in IMG/M |
| 3300003324|soilH2_10047514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1595 | Open in IMG/M |
| 3300004114|Ga0062593_100089482 | All Organisms → cellular organisms → Bacteria | 2122 | Open in IMG/M |
| 3300004114|Ga0062593_100635817 | Not Available | 1026 | Open in IMG/M |
| 3300004114|Ga0062593_102209844 | Not Available | 617 | Open in IMG/M |
| 3300004114|Ga0062593_103235891 | Not Available | 522 | Open in IMG/M |
| 3300004156|Ga0062589_101549380 | Not Available | 654 | Open in IMG/M |
| 3300004157|Ga0062590_102608131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 537 | Open in IMG/M |
| 3300004463|Ga0063356_105509319 | Not Available | 543 | Open in IMG/M |
| 3300004463|Ga0063356_105565714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 540 | Open in IMG/M |
| 3300004479|Ga0062595_100017742 | All Organisms → cellular organisms → Bacteria | 2593 | Open in IMG/M |
| 3300004479|Ga0062595_100148088 | All Organisms → cellular organisms → Bacteria | 1360 | Open in IMG/M |
| 3300004479|Ga0062595_100894584 | Not Available | 747 | Open in IMG/M |
| 3300004633|Ga0066395_10978074 | Not Available | 515 | Open in IMG/M |
| 3300004643|Ga0062591_101129679 | Not Available | 757 | Open in IMG/M |
| 3300005093|Ga0062594_100004251 | All Organisms → cellular organisms → Bacteria | 4231 | Open in IMG/M |
| 3300005093|Ga0062594_101386809 | Not Available | 712 | Open in IMG/M |
| 3300005103|Ga0066813_1009367 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300005164|Ga0066815_10013901 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
| 3300005166|Ga0066674_10026812 | All Organisms → cellular organisms → Bacteria | 2527 | Open in IMG/M |
| 3300005167|Ga0066672_10056418 | All Organisms → cellular organisms → Bacteria | 2274 | Open in IMG/M |
| 3300005167|Ga0066672_10435212 | Not Available | 857 | Open in IMG/M |
| 3300005172|Ga0066683_10150560 | All Organisms → cellular organisms → Bacteria | 1429 | Open in IMG/M |
| 3300005172|Ga0066683_10820717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 539 | Open in IMG/M |
| 3300005174|Ga0066680_10001361 | All Organisms → cellular organisms → Bacteria | 9858 | Open in IMG/M |
| 3300005174|Ga0066680_10953192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 506 | Open in IMG/M |
| 3300005175|Ga0066673_10045845 | All Organisms → cellular organisms → Bacteria | 2183 | Open in IMG/M |
| 3300005176|Ga0066679_10530685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 767 | Open in IMG/M |
| 3300005177|Ga0066690_10036735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2901 | Open in IMG/M |
| 3300005177|Ga0066690_10237747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1220 | Open in IMG/M |
| 3300005177|Ga0066690_10271352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1141 | Open in IMG/M |
| 3300005178|Ga0066688_10154940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1437 | Open in IMG/M |
| 3300005178|Ga0066688_10221361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1206 | Open in IMG/M |
| 3300005180|Ga0066685_10124992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1735 | Open in IMG/M |
| 3300005180|Ga0066685_10946156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 573 | Open in IMG/M |
| 3300005181|Ga0066678_10121727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1604 | Open in IMG/M |
| 3300005184|Ga0066671_10033614 | All Organisms → cellular organisms → Bacteria | 2438 | Open in IMG/M |
| 3300005184|Ga0066671_10622682 | Not Available | 701 | Open in IMG/M |
| 3300005186|Ga0066676_10219698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1229 | Open in IMG/M |
| 3300005187|Ga0066675_10244232 | Not Available | 1280 | Open in IMG/M |
| 3300005187|Ga0066675_10630638 | Not Available | 805 | Open in IMG/M |
| 3300005187|Ga0066675_10910912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 664 | Open in IMG/M |
| 3300005294|Ga0065705_10413783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 867 | Open in IMG/M |
| 3300005332|Ga0066388_100082721 | All Organisms → cellular organisms → Bacteria | 3593 | Open in IMG/M |
| 3300005436|Ga0070713_100085730 | All Organisms → cellular organisms → Bacteria | 2699 | Open in IMG/M |
| 3300005436|Ga0070713_101655758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 621 | Open in IMG/M |
| 3300005437|Ga0070710_10204622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1248 | Open in IMG/M |
| 3300005438|Ga0070701_10793227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 645 | Open in IMG/M |
| 3300005440|Ga0070705_100029038 | All Organisms → cellular organisms → Bacteria | 3036 | Open in IMG/M |
| 3300005440|Ga0070705_101367086 | Not Available | 589 | Open in IMG/M |
| 3300005445|Ga0070708_100120034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2425 | Open in IMG/M |
| 3300005445|Ga0070708_101375921 | Not Available | 659 | Open in IMG/M |
| 3300005447|Ga0066689_10498324 | Not Available | 768 | Open in IMG/M |
| 3300005450|Ga0066682_10883682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 534 | Open in IMG/M |
| 3300005451|Ga0066681_10256045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1063 | Open in IMG/M |
| 3300005451|Ga0066681_10266310 | Not Available | 1043 | Open in IMG/M |
| 3300005467|Ga0070706_100178627 | All Organisms → cellular organisms → Bacteria | 1982 | Open in IMG/M |
| 3300005468|Ga0070707_100501372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 1176 | Open in IMG/M |
| 3300005468|Ga0070707_101128789 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300005526|Ga0073909_10020519 | All Organisms → cellular organisms → Bacteria | 2148 | Open in IMG/M |
| 3300005530|Ga0070679_100947326 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300005536|Ga0070697_100363060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1252 | Open in IMG/M |
| 3300005536|Ga0070697_101896113 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 533 | Open in IMG/M |
| 3300005552|Ga0066701_10304698 | Not Available | 988 | Open in IMG/M |
| 3300005554|Ga0066661_10186989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1279 | Open in IMG/M |
| 3300005555|Ga0066692_10017018 | All Organisms → cellular organisms → Bacteria | 3602 | Open in IMG/M |
| 3300005555|Ga0066692_10871243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 552 | Open in IMG/M |
| 3300005556|Ga0066707_10493193 | Not Available | 795 | Open in IMG/M |
| 3300005557|Ga0066704_10143167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1599 | Open in IMG/M |
| 3300005559|Ga0066700_10351525 | Not Available | 1041 | Open in IMG/M |
| 3300005559|Ga0066700_10353845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1037 | Open in IMG/M |
| 3300005560|Ga0066670_10263727 | Not Available | 1045 | Open in IMG/M |
| 3300005578|Ga0068854_101409572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 630 | Open in IMG/M |
| 3300005586|Ga0066691_10489505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 735 | Open in IMG/M |
| 3300005586|Ga0066691_10726658 | Not Available | 587 | Open in IMG/M |
| 3300005598|Ga0066706_10754704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 771 | Open in IMG/M |
| 3300005614|Ga0068856_100500441 | All Organisms → cellular organisms → Bacteria | 1236 | Open in IMG/M |
| 3300005713|Ga0066905_100527127 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300005719|Ga0068861_100233597 | All Organisms → cellular organisms → Bacteria | 1561 | Open in IMG/M |
| 3300005937|Ga0081455_10078432 | All Organisms → cellular organisms → Bacteria | 2714 | Open in IMG/M |
| 3300005937|Ga0081455_10572493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 742 | Open in IMG/M |
| 3300005985|Ga0081539_10027868 | All Organisms → cellular organisms → Bacteria | 3566 | Open in IMG/M |
| 3300006031|Ga0066651_10136234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1275 | Open in IMG/M |
| 3300006032|Ga0066696_10292610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1057 | Open in IMG/M |
| 3300006034|Ga0066656_10631150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 692 | Open in IMG/M |
| 3300006046|Ga0066652_100081341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2558 | Open in IMG/M |
| 3300006046|Ga0066652_100316028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1393 | Open in IMG/M |
| 3300006046|Ga0066652_100440167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1197 | Open in IMG/M |
| 3300006046|Ga0066652_102087942 | Not Available | 502 | Open in IMG/M |
| 3300006173|Ga0070716_101232818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 602 | Open in IMG/M |
| 3300006175|Ga0070712_100010028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5972 | Open in IMG/M |
| 3300006575|Ga0074053_10025750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 591 | Open in IMG/M |
| 3300006577|Ga0074050_11386661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 614 | Open in IMG/M |
| 3300006580|Ga0074049_12906354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 560 | Open in IMG/M |
| 3300006581|Ga0074048_10058018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1192 | Open in IMG/M |
| 3300006755|Ga0079222_12067009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 562 | Open in IMG/M |
| 3300006791|Ga0066653_10728899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 515 | Open in IMG/M |
| 3300006797|Ga0066659_11418139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 580 | Open in IMG/M |
| 3300006800|Ga0066660_10080746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2240 | Open in IMG/M |
| 3300006804|Ga0079221_10193943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1107 | Open in IMG/M |
| 3300006806|Ga0079220_10098899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1507 | Open in IMG/M |
| 3300006806|Ga0079220_10804577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 712 | Open in IMG/M |
| 3300006852|Ga0075433_11616803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 559 | Open in IMG/M |
| 3300006854|Ga0075425_100808541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1074 | Open in IMG/M |
| 3300006854|Ga0075425_101457301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 774 | Open in IMG/M |
| 3300006871|Ga0075434_100636359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1085 | Open in IMG/M |
| 3300006876|Ga0079217_10588778 | Not Available | 718 | Open in IMG/M |
| 3300007790|Ga0105679_10024579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1022 | Open in IMG/M |
| 3300009012|Ga0066710_100011616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8985 | Open in IMG/M |
| 3300009012|Ga0066710_100348802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2188 | Open in IMG/M |
| 3300009012|Ga0066710_100840358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1410 | Open in IMG/M |
| 3300009012|Ga0066710_100995088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1294 | Open in IMG/M |
| 3300009012|Ga0066710_101179978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1186 | Open in IMG/M |
| 3300009012|Ga0066710_101420052 | Not Available | 1075 | Open in IMG/M |
| 3300009012|Ga0066710_101913322 | Not Available | 887 | Open in IMG/M |
| 3300009012|Ga0066710_102524812 | Not Available | 742 | Open in IMG/M |
| 3300009012|Ga0066710_102563901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 735 | Open in IMG/M |
| 3300009012|Ga0066710_102638132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 720 | Open in IMG/M |
| 3300009012|Ga0066710_103598397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 584 | Open in IMG/M |
| 3300009012|Ga0066710_104267457 | Not Available | 534 | Open in IMG/M |
| 3300009038|Ga0099829_10286143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1349 | Open in IMG/M |
| 3300009089|Ga0099828_10065732 | All Organisms → cellular organisms → Bacteria | 3056 | Open in IMG/M |
| 3300009090|Ga0099827_10171514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1788 | Open in IMG/M |
| 3300009090|Ga0099827_10419655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1145 | Open in IMG/M |
| 3300009090|Ga0099827_11105539 | Not Available | 688 | Open in IMG/M |
| 3300009137|Ga0066709_100233955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2445 | Open in IMG/M |
| 3300009137|Ga0066709_100401810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1901 | Open in IMG/M |
| 3300009137|Ga0066709_100594432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1575 | Open in IMG/M |
| 3300009137|Ga0066709_101965127 | Not Available | 811 | Open in IMG/M |
| 3300009137|Ga0066709_102013268 | Not Available | 800 | Open in IMG/M |
| 3300009137|Ga0066709_102820210 | Not Available | 644 | Open in IMG/M |
| 3300009137|Ga0066709_104021484 | Not Available | 535 | Open in IMG/M |
| 3300009137|Ga0066709_104647558 | Not Available | 502 | Open in IMG/M |
| 3300009147|Ga0114129_11772384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 751 | Open in IMG/M |
| 3300009147|Ga0114129_12669706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 595 | Open in IMG/M |
| 3300009148|Ga0105243_11890804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 629 | Open in IMG/M |
| 3300009789|Ga0126307_10740612 | Not Available | 793 | Open in IMG/M |
| 3300009792|Ga0126374_10016896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3085 | Open in IMG/M |
| 3300009811|Ga0105084_1038622 | Not Available | 829 | Open in IMG/M |
| 3300009811|Ga0105084_1041905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 800 | Open in IMG/M |
| 3300010037|Ga0126304_10460224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 852 | Open in IMG/M |
| 3300010038|Ga0126315_10773795 | Not Available | 631 | Open in IMG/M |
| 3300010039|Ga0126309_10028222 | All Organisms → cellular organisms → Bacteria | 2527 | Open in IMG/M |
| 3300010039|Ga0126309_10124432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1357 | Open in IMG/M |
| 3300010039|Ga0126309_10676760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 659 | Open in IMG/M |
| 3300010040|Ga0126308_10814745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 647 | Open in IMG/M |
| 3300010041|Ga0126312_10686732 | Not Available | 739 | Open in IMG/M |
| 3300010044|Ga0126310_10065027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2086 | Open in IMG/M |
| 3300010044|Ga0126310_10481038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 903 | Open in IMG/M |
| 3300010046|Ga0126384_11763725 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 587 | Open in IMG/M |
| 3300010047|Ga0126382_10374317 | All Organisms → cellular organisms → Bacteria | 1101 | Open in IMG/M |
| 3300010047|Ga0126382_11426980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 633 | Open in IMG/M |
| 3300010154|Ga0127503_10504492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 1379 | Open in IMG/M |
| 3300010322|Ga0134084_10056622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1168 | Open in IMG/M |
| 3300010333|Ga0134080_10567498 | Not Available | 548 | Open in IMG/M |
| 3300010335|Ga0134063_10313313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 757 | Open in IMG/M |
| 3300010336|Ga0134071_10061398 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1727 | Open in IMG/M |
| 3300010337|Ga0134062_10087046 | All Organisms → cellular organisms → Bacteria | 1325 | Open in IMG/M |
| 3300010358|Ga0126370_10865927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 812 | Open in IMG/M |
| 3300010373|Ga0134128_13116378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 509 | Open in IMG/M |
| 3300010399|Ga0134127_10124176 | All Organisms → cellular organisms → Bacteria | 2302 | Open in IMG/M |
| 3300010999|Ga0138505_100041607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 650 | Open in IMG/M |
| 3300011003|Ga0138514_100008469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1619 | Open in IMG/M |
| 3300011269|Ga0137392_11219737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 611 | Open in IMG/M |
| 3300012008|Ga0120174_1067058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 946 | Open in IMG/M |
| 3300012019|Ga0120139_1051858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 979 | Open in IMG/M |
| 3300012096|Ga0137389_10149582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1910 | Open in IMG/M |
| 3300012096|Ga0137389_10423118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1139 | Open in IMG/M |
| 3300012189|Ga0137388_10986759 | Not Available | 777 | Open in IMG/M |
| 3300012198|Ga0137364_10120981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1866 | Open in IMG/M |
| 3300012198|Ga0137364_11356867 | Not Available | 528 | Open in IMG/M |
| 3300012199|Ga0137383_11107124 | Not Available | 573 | Open in IMG/M |
| 3300012200|Ga0137382_10017882 | All Organisms → cellular organisms → Bacteria | 3992 | Open in IMG/M |
| 3300012200|Ga0137382_10789220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 683 | Open in IMG/M |
| 3300012200|Ga0137382_10807020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 675 | Open in IMG/M |
| 3300012201|Ga0137365_10700447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 740 | Open in IMG/M |
| 3300012201|Ga0137365_10849210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 667 | Open in IMG/M |
| 3300012204|Ga0137374_10079339 | All Organisms → cellular organisms → Bacteria | 3188 | Open in IMG/M |
| 3300012204|Ga0137374_10103091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2683 | Open in IMG/M |
| 3300012204|Ga0137374_10112789 | All Organisms → cellular organisms → Bacteria | 2525 | Open in IMG/M |
| 3300012204|Ga0137374_10195967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1746 | Open in IMG/M |
| 3300012204|Ga0137374_10213605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1649 | Open in IMG/M |
| 3300012204|Ga0137374_11117239 | Not Available | 559 | Open in IMG/M |
| 3300012206|Ga0137380_10014658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7150 | Open in IMG/M |
| 3300012206|Ga0137380_10056857 | All Organisms → cellular organisms → Bacteria | 3583 | Open in IMG/M |
| 3300012206|Ga0137380_11295657 | Not Available | 613 | Open in IMG/M |
| 3300012207|Ga0137381_11225539 | Not Available | 643 | Open in IMG/M |
| 3300012208|Ga0137376_10051208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3378 | Open in IMG/M |
| 3300012210|Ga0137378_10494119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1130 | Open in IMG/M |
| 3300012211|Ga0137377_11390180 | Not Available | 631 | Open in IMG/M |
| 3300012212|Ga0150985_120817841 | Not Available | 503 | Open in IMG/M |
| 3300012285|Ga0137370_10847472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 566 | Open in IMG/M |
| 3300012285|Ga0137370_10910436 | Not Available | 544 | Open in IMG/M |
| 3300012285|Ga0137370_10940883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 534 | Open in IMG/M |
| 3300012350|Ga0137372_10037671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4385 | Open in IMG/M |
| 3300012350|Ga0137372_10807429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 673 | Open in IMG/M |
| 3300012354|Ga0137366_11161997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 527 | Open in IMG/M |
| 3300012355|Ga0137369_10028059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5198 | Open in IMG/M |
| 3300012355|Ga0137369_10420229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 960 | Open in IMG/M |
| 3300012355|Ga0137369_10483194 | Not Available | 878 | Open in IMG/M |
| 3300012356|Ga0137371_11283896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 542 | Open in IMG/M |
| 3300012357|Ga0137384_11153456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 618 | Open in IMG/M |
| 3300012358|Ga0137368_10008048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 10915 | Open in IMG/M |
| 3300012360|Ga0137375_10010843 | All Organisms → cellular organisms → Bacteria | 10779 | Open in IMG/M |
| 3300012360|Ga0137375_11002739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 657 | Open in IMG/M |
| 3300012469|Ga0150984_120231464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 613 | Open in IMG/M |
| 3300012532|Ga0137373_10063099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 3384 | Open in IMG/M |
| 3300012532|Ga0137373_10222250 | All Organisms → cellular organisms → Bacteria | 1541 | Open in IMG/M |
| 3300012925|Ga0137419_11971944 | Not Available | 502 | Open in IMG/M |
| 3300012930|Ga0137407_11988747 | Not Available | 555 | Open in IMG/M |
| 3300012937|Ga0162653_100025639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 822 | Open in IMG/M |
| 3300012938|Ga0162651_100087899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 523 | Open in IMG/M |
| 3300012951|Ga0164300_10882915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 563 | Open in IMG/M |
| 3300012955|Ga0164298_10348352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 937 | Open in IMG/M |
| 3300012958|Ga0164299_10055452 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1875 | Open in IMG/M |
| 3300012977|Ga0134087_10117482 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
| 3300012977|Ga0134087_10724695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 530 | Open in IMG/M |
| 3300012989|Ga0164305_10660003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 849 | Open in IMG/M |
| 3300013294|Ga0120150_1030234 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
| 3300013764|Ga0120111_1080151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 783 | Open in IMG/M |
| 3300013772|Ga0120158_10028873 | All Organisms → cellular organisms → Bacteria | 4288 | Open in IMG/M |
| 3300014150|Ga0134081_10170323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 725 | Open in IMG/M |
| 3300015209|Ga0167629_1194619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 517 | Open in IMG/M |
| 3300015374|Ga0132255_100050429 | All Organisms → cellular organisms → Bacteria | 5416 | Open in IMG/M |
| 3300017654|Ga0134069_1357223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 526 | Open in IMG/M |
| 3300017939|Ga0187775_10325817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 614 | Open in IMG/M |
| 3300017997|Ga0184610_1269907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 563 | Open in IMG/M |
| 3300018027|Ga0184605_10000159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 19455 | Open in IMG/M |
| 3300018027|Ga0184605_10013064 | All Organisms → cellular organisms → Bacteria | 3221 | Open in IMG/M |
| 3300018027|Ga0184605_10322105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 699 | Open in IMG/M |
| 3300018028|Ga0184608_10155118 | Not Available | 989 | Open in IMG/M |
| 3300018056|Ga0184623_10082614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1480 | Open in IMG/M |
| 3300018056|Ga0184623_10331369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 684 | Open in IMG/M |
| 3300018061|Ga0184619_10514200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 527 | Open in IMG/M |
| 3300018061|Ga0184619_10554581 | Not Available | 503 | Open in IMG/M |
| 3300018066|Ga0184617_1265014 | Not Available | 516 | Open in IMG/M |
| 3300018071|Ga0184618_10355554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 624 | Open in IMG/M |
| 3300018071|Ga0184618_10405961 | Not Available | 577 | Open in IMG/M |
| 3300018075|Ga0184632_10290465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 709 | Open in IMG/M |
| 3300018076|Ga0184609_10066236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1573 | Open in IMG/M |
| 3300018076|Ga0184609_10253306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 823 | Open in IMG/M |
| 3300018431|Ga0066655_10083951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1743 | Open in IMG/M |
| 3300018431|Ga0066655_10569358 | Not Available | 759 | Open in IMG/M |
| 3300018431|Ga0066655_10957236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 589 | Open in IMG/M |
| 3300018433|Ga0066667_10017877 | All Organisms → cellular organisms → Bacteria | 3675 | Open in IMG/M |
| 3300018433|Ga0066667_10276985 | Not Available | 1289 | Open in IMG/M |
| 3300018433|Ga0066667_11115467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 683 | Open in IMG/M |
| 3300018468|Ga0066662_10441618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1161 | Open in IMG/M |
| 3300018468|Ga0066662_11842020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 633 | Open in IMG/M |
| 3300018482|Ga0066669_10006658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5502 | Open in IMG/M |
| 3300018482|Ga0066669_10126731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1831 | Open in IMG/M |
| 3300018920|Ga0190273_11271172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 632 | Open in IMG/M |
| 3300019255|Ga0184643_1290878 | Not Available | 647 | Open in IMG/M |
| 3300019361|Ga0173482_10336058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 679 | Open in IMG/M |
| 3300019869|Ga0193705_1004406 | All Organisms → cellular organisms → Bacteria | 3089 | Open in IMG/M |
| 3300019875|Ga0193701_1071339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 684 | Open in IMG/M |
| 3300019881|Ga0193707_1147493 | Not Available | 660 | Open in IMG/M |
| 3300019886|Ga0193727_1001883 | All Organisms → cellular organisms → Bacteria | 8774 | Open in IMG/M |
| 3300019887|Ga0193729_1000007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 116559 | Open in IMG/M |
| 3300020005|Ga0193697_1137953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 552 | Open in IMG/M |
| 3300021073|Ga0210378_10002051 | All Organisms → cellular organisms → Bacteria | 10344 | Open in IMG/M |
| 3300021078|Ga0210381_10350200 | Not Available | 540 | Open in IMG/M |
| 3300022534|Ga0224452_1258967 | Not Available | 532 | Open in IMG/M |
| 3300022694|Ga0222623_10074490 | All Organisms → cellular organisms → Bacteria | 1316 | Open in IMG/M |
| 3300025905|Ga0207685_10574106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 602 | Open in IMG/M |
| 3300025910|Ga0207684_10687287 | Not Available | 870 | Open in IMG/M |
| 3300025915|Ga0207693_11081520 | Not Available | 610 | Open in IMG/M |
| 3300025917|Ga0207660_10095478 | All Organisms → cellular organisms → Bacteria | 2212 | Open in IMG/M |
| 3300025927|Ga0207687_10373326 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
| 3300025939|Ga0207665_10137954 | All Organisms → cellular organisms → Bacteria | 1737 | Open in IMG/M |
| 3300025939|Ga0207665_11049656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 649 | Open in IMG/M |
| 3300025961|Ga0207712_10050692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2900 | Open in IMG/M |
| 3300026023|Ga0207677_11598850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 603 | Open in IMG/M |
| 3300026088|Ga0207641_12244519 | Not Available | 546 | Open in IMG/M |
| 3300026121|Ga0207683_11853809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 552 | Open in IMG/M |
| 3300026300|Ga0209027_1231901 | Not Available | 592 | Open in IMG/M |
| 3300026328|Ga0209802_1003304 | All Organisms → cellular organisms → Bacteria | 10860 | Open in IMG/M |
| 3300026331|Ga0209267_1059938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1690 | Open in IMG/M |
| 3300026523|Ga0209808_1083112 | Not Available | 1377 | Open in IMG/M |
| 3300026530|Ga0209807_1177800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 781 | Open in IMG/M |
| 3300026532|Ga0209160_1030477 | All Organisms → cellular organisms → Bacteria | 3407 | Open in IMG/M |
| 3300026536|Ga0209058_1155721 | Not Available | 1062 | Open in IMG/M |
| 3300026550|Ga0209474_10156260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1482 | Open in IMG/M |
| 3300026552|Ga0209577_10035586 | All Organisms → cellular organisms → Bacteria | 4301 | Open in IMG/M |
| 3300026552|Ga0209577_10468122 | Not Available | 864 | Open in IMG/M |
| 3300027379|Ga0209842_1051080 | Not Available | 748 | Open in IMG/M |
| 3300027587|Ga0209220_1108449 | Not Available | 727 | Open in IMG/M |
| 3300028381|Ga0268264_10128689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2241 | Open in IMG/M |
| 3300028381|Ga0268264_10314986 | All Organisms → cellular organisms → Bacteria | 1477 | Open in IMG/M |
| 3300028536|Ga0137415_10219396 | All Organisms → cellular organisms → Bacteria | 1716 | Open in IMG/M |
| 3300028704|Ga0307321_1016925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1266 | Open in IMG/M |
| 3300028705|Ga0307276_10009742 | All Organisms → cellular organisms → Bacteria | 1682 | Open in IMG/M |
| 3300028707|Ga0307291_1080512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 802 | Open in IMG/M |
| 3300028707|Ga0307291_1147640 | Not Available | 598 | Open in IMG/M |
| 3300028709|Ga0307279_10001663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1988 | Open in IMG/M |
| 3300028711|Ga0307293_10265400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 545 | Open in IMG/M |
| 3300028713|Ga0307303_10106445 | Not Available | 646 | Open in IMG/M |
| 3300028713|Ga0307303_10155204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 551 | Open in IMG/M |
| 3300028716|Ga0307311_10000350 | All Organisms → cellular organisms → Bacteria | 8326 | Open in IMG/M |
| 3300028716|Ga0307311_10103131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 798 | Open in IMG/M |
| 3300028717|Ga0307298_10273835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 503 | Open in IMG/M |
| 3300028719|Ga0307301_10176539 | Not Available | 691 | Open in IMG/M |
| 3300028719|Ga0307301_10323663 | Not Available | 506 | Open in IMG/M |
| 3300028720|Ga0307317_10000867 | All Organisms → cellular organisms → Bacteria | 9071 | Open in IMG/M |
| 3300028722|Ga0307319_10166212 | Not Available | 718 | Open in IMG/M |
| 3300028722|Ga0307319_10176448 | Not Available | 696 | Open in IMG/M |
| 3300028722|Ga0307319_10305914 | Not Available | 526 | Open in IMG/M |
| 3300028744|Ga0307318_10131970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 853 | Open in IMG/M |
| 3300028755|Ga0307316_10407960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 503 | Open in IMG/M |
| 3300028771|Ga0307320_10399017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 552 | Open in IMG/M |
| 3300028791|Ga0307290_10066878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1303 | Open in IMG/M |
| 3300028791|Ga0307290_10165663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 810 | Open in IMG/M |
| 3300028791|Ga0307290_10173398 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 790 | Open in IMG/M |
| 3300028793|Ga0307299_10196114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 759 | Open in IMG/M |
| 3300028799|Ga0307284_10231573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 731 | Open in IMG/M |
| 3300028802|Ga0307503_10375751 | Not Available | 736 | Open in IMG/M |
| 3300028811|Ga0307292_10001342 | All Organisms → cellular organisms → Bacteria | 8638 | Open in IMG/M |
| 3300028819|Ga0307296_10534647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 641 | Open in IMG/M |
| 3300028824|Ga0307310_10211607 | Not Available | 919 | Open in IMG/M |
| 3300028828|Ga0307312_10853457 | Not Available | 603 | Open in IMG/M |
| 3300028872|Ga0307314_10133913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 704 | Open in IMG/M |
| 3300028878|Ga0307278_10019020 | All Organisms → cellular organisms → Bacteria | 3182 | Open in IMG/M |
| 3300028878|Ga0307278_10532290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 512 | Open in IMG/M |
| 3300028880|Ga0307300_10309189 | Not Available | 537 | Open in IMG/M |
| 3300028884|Ga0307308_10313912 | Not Available | 751 | Open in IMG/M |
| 3300028884|Ga0307308_10457092 | Not Available | 612 | Open in IMG/M |
| 3300031226|Ga0307497_10140173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 992 | Open in IMG/M |
| 3300031231|Ga0170824_115184020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 569 | Open in IMG/M |
| 3300031716|Ga0310813_11663623 | Not Available | 597 | Open in IMG/M |
| 3300031720|Ga0307469_10604966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 980 | Open in IMG/M |
| 3300031720|Ga0307469_11211062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 714 | Open in IMG/M |
| 3300031938|Ga0308175_101659917 | Not Available | 715 | Open in IMG/M |
| 3300031938|Ga0308175_102932148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 532 | Open in IMG/M |
| 3300032180|Ga0307471_101606089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 806 | Open in IMG/M |
| 3300032205|Ga0307472_100695180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 914 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 20.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 14.17% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.61% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 8.61% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.56% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.33% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.78% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.22% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.67% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.67% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.67% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.67% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.39% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.11% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 1.11% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.11% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.83% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.83% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.83% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.56% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.56% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.56% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.56% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.28% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.28% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.28% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.28% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.28% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.28% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.28% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.28% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.28% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.28% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.28% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.28% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.28% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.28% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.28% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.28% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 2170459007 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 10-21cm | Environmental | Open in IMG/M |
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000887 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-65cm-16A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001536 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001538 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005103 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAA | Environmental | Open in IMG/M |
| 3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300007790 | Microbial communities of desert soil contaminated with blood from dead anthrax infected zebra in Etosha National Park, Namibia. Combined Assembly of 14 sequencing projects | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009811 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010999 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015 | Environmental | Open in IMG/M |
| 3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012008 | Permafrost microbial communities from Nunavut, Canada - A39_80cm_12M | Environmental | Open in IMG/M |
| 3300012019 | Permafrost microbial communities from Nunavut, Canada - A7_5cm_12M | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012937 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015 | Environmental | Open in IMG/M |
| 3300012938 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013294 | Permafrost microbial communities from Nunavut, Canada - A3_65cm_0M | Environmental | Open in IMG/M |
| 3300013764 | Permafrost microbial communities from Nunavut, Canada - A28_35cm_6M | Environmental | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015209 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G3B, Proglacial river margin, by glacier terminus) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019255 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019869 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2 | Environmental | Open in IMG/M |
| 3300019875 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2 | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020005 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2 | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027379 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028704 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379 | Environmental | Open in IMG/M |
| 3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
| 3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
| 3300028709 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_118 | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| KansclcFeb2_05482980 | 2124908045 | Soil | MAPKGQHKHTAVTIHAIRQRGGVPYHVERKVCRNCRRLLDEKTIRRAAA |
| L02_06411560 | 2170459007 | Grass Soil | MTLRRHKHTAITVHALRQRAGVPYHVERKVCSNCKRLLEEKTIKRAAA |
| INPgaii200_11152411 | 2228664022 | Soil | MTLKRHRHNAVTIHAIRQRAGVPYHVERKVCSRCQKMLDEKTLKRAAA |
| ICChiseqgaiiFebDRAFT_110410123 | 3300000363 | Soil | VNRDMTLKRPHKHTAVTIHAIRQRGGVPYHVERKVCRNCSRLLDEKTIRRAAA* |
| INPhiseqgaiiFebDRAFT_1016664062 | 3300000364 | Soil | MTLKRHRHNAVTIHAIRQRAGVPYHVERKVCSRCQKMLDEKTLKRAAA* |
| F24TB_165021091 | 3300000550 | Soil | MALKRIHKHTAVTTVAIRQRSGVPYQVERTVCASCRTLLEEKPVRRAAAA* |
| AL16A1W_101734121 | 3300000887 | Permafrost | MTLRRHKHTAITVHALRQRAGVPYHVERKICSNCQRLLEEKTLKRAAA* |
| JGI10214J12806_113241282 | 3300000891 | Soil | MTLRRHKHIAITVHAIRQRAGVPYHVERKVCSNCKRLLEEKTIKRAAA* |
| JGI10216J12902_1009562922 | 3300000956 | Soil | MTLRRHKHTAITVHAIRQRAGVPYHVERKVCSNCRRLLEEKTIKRAAA* |
| JGI10216J12902_1016744043 | 3300000956 | Soil | MTFKRIHKHRPVTTIAIRQRGGVPYEVERKVCADCRTVLGETPVRRAAAA* |
| JGI10216J12902_1021794712 | 3300000956 | Soil | MTLRRHKHTAITIHAIRQRAGVPYHVERKVCSNCRRLLDEKTIKRAAA* |
| JGI10216J12902_1033553811 | 3300000956 | Soil | MTLKRHKHSTVTIHAIRQRAGVPYHVERQVCSRCQKMLDEKTIRRAAA* |
| JGI10216J12902_1037386624 | 3300000956 | Soil | RLITLRRRMTLRRHKHTAVTIHAIRQRAGVPYHVERKVCSDCRRLLEEKTIKRAAA* |
| JGI10216J12902_1044879001 | 3300000956 | Soil | MTLKRTHKHTAVTIHAIRQRGGVPYHVERKVCRNCSRLLDEKTIRRAAA* |
| JGI10216J12902_1055937342 | 3300000956 | Soil | MTLKRHKHSTITIHAIRQRAGVPYHVERKVCSGCQRLLDEKTIKRAAA* |
| JGI10216J12902_1094045631 | 3300000956 | Soil | MTLKRHKHSAVTIHAIRQRAGVPYHVERKVCSSCQKMLDEKTIRRAAA* |
| JGI10216J12902_1098094702 | 3300000956 | Soil | TEMALKRIHKHTAVTTVAIRQRSGVPYQVERKVCASCRTLLEEKPVKRAAAA* |
| JGI10216J12902_1136442932 | 3300000956 | Soil | MTLKRRHKHTAVTVHAIRQRGGVPYHVERKVCSDCRRLLDERTIRRAAT* |
| A1565W1_107679371 | 3300001536 | Permafrost | MTLRRHKHTAITIHAIRQRSGVPYHVERKVCSNCRRLLEEKTLKRAAA* |
| A10PFW1_100584893 | 3300001538 | Permafrost | LRRHKHTAITVHAIRQRAGVPYHVERQVCSNCRRLLEEKTIKRAAA* |
| C688J35102_1186271851 | 3300002568 | Soil | TEMTLMRRHKHTAVTVHALRQRHGVPYHVERKVCSNCQRLLDEKFIKRAAA* |
| C688J35102_1201031492 | 3300002568 | Soil | MTLKRHRHSAVTIHAIRQRAGVPYHVERKVCSSCQRLLDEKTLRRAAA |
| C688J35102_1204975932 | 3300002568 | Soil | MTLKRHKHHAVTVHAIRQRAGVPYHVERQICSSCRRLLDEKTLRRAAA* |
| C688J35102_1209855427 | 3300002568 | Soil | VKAIHQHTKVTTLALVQRHGVPYEVQRTVCSTCRSLLDEKPVKRAAA* |
| soilH2_100475142 | 3300003324 | Sugarcane Root And Bulk Soil | MTLKRHKHSEVTVHAIRQRAGVPYHVERKVCSSCRRLLEEKTIKRAAA* |
| Ga0062593_1000894824 | 3300004114 | Soil | MTLKRHKHSTITIHAIRQRAGVPYHVERKVCSSCQKMLDERTIKRAAA* |
| Ga0062593_1006358172 | 3300004114 | Soil | MTLRRHKHTAVTIHAIRQRAGVPYHVERKVCSNCRRLLEEKTIKRAAA* |
| Ga0062593_1022098442 | 3300004114 | Soil | MTLKRPHKHTAVTIHAIRQRGGVPYHVERKVCRNCSRLLDEKTIRRAAA* |
| Ga0062593_1032358912 | 3300004114 | Soil | MTLKRHKHNAVTIHAIRQRAGVPYHVERKVCSRCQKMLDEKTLKRAAA* |
| Ga0062589_1015493801 | 3300004156 | Soil | MTLKRHKHSTVTIHAIRQRAGVPYHVERKVCSRCQKTLDEKTIRRAAA* |
| Ga0062590_1026081311 | 3300004157 | Soil | MALNVKRRHKHTAVTVHAIRQRAGIPYHVERKICSDCSRVLAEKTLRRAAT* |
| Ga0063356_1055093192 | 3300004463 | Arabidopsis Thaliana Rhizosphere | HKHTAVTIHAIRQRGGVPYHVERKVCRNCSRLLDEKTIRRAAA* |
| Ga0063356_1055657142 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MTLKRHKHNAVTVHAIRQRGGVPYHVERKVCSRCRRLLDEKTIK |
| Ga0062595_1000177422 | 3300004479 | Soil | MTLRRHKHTAVTIHAIRQRAGVPYHVERKICSNCQRLLEEKTIKRAAA* |
| Ga0062595_1001480881 | 3300004479 | Soil | MTLKRHKHNAVTVHAIRQRAGVPYHVERQVCSRCQKMLDEKTIKRAAA* |
| Ga0062595_1008945842 | 3300004479 | Soil | MTLKRHKHSAVTVHAIRQRAGVPYHVERQVCSSCRRLLDEKTIKRAAA* |
| Ga0066395_109780742 | 3300004633 | Tropical Forest Soil | MTLKRHKHSTVTIHAIRQRAGVPYHVERKVCSSCQKMLDEKTIRRAAA* |
| Ga0062591_1011296792 | 3300004643 | Soil | RHKHTAVTIHAIRQRAGVPYHVERKVCSNCRRLLEEKTIKRAAA* |
| Ga0062594_1000042512 | 3300005093 | Soil | MALNVKRRHKHTTVTVHAIRQRAGIPYHVERRICSDCSRVLAEKTLRRAAT* |
| Ga0062594_1013868091 | 3300005093 | Soil | MRVNRIHKHTTVTTLAIRQRQGVPYQVEQKVCSTCRRLLDEKPVKRAAA* |
| Ga0066813_10093672 | 3300005103 | Soil | MTLMRKHKHTAVTVHALRQRHGVPYHVERQVCSNCKRLLDEKFIKRAAA* |
| Ga0066815_100139011 | 3300005164 | Soil | ERLSTVRDTEMTLMRKHKHTAVTVHALRQRHGVPYHVERQVCSNCKRLLDEKFIKRAAA* |
| Ga0066674_100268121 | 3300005166 | Soil | MTLRRHKHTAITVHAIRQQAGVPYHVERKVCSNCRRLLEEKTIKRA |
| Ga0066672_100564183 | 3300005167 | Soil | MTLKRSHKHDAVTVHAIRQRAGVPYHVERKICASCRRLLDERTIKRAAA* |
| Ga0066672_104352121 | 3300005167 | Soil | MTLRRHKHTAITIHAIRQRAGVPYHVERKVCANCQRLLEEKTIKRAAA* |
| Ga0066683_101505601 | 3300005172 | Soil | MTLRRHKHTAVTIHAIRQRAGVPYHVERKICSNCQRLLEEKTIKRAA |
| Ga0066683_108207172 | 3300005172 | Soil | MTLKRHKHSAVTVHAIRQRAGVPYHVERKVCSSCRRLLDEKTIKRAAA* |
| Ga0066680_1000136112 | 3300005174 | Soil | MSLTRAHKHTAVTVRAIRQRNGVPFEVERQVCKDCRRLLDEKPVRRAVTS* |
| Ga0066680_109531921 | 3300005174 | Soil | MTLRRHKHTAITIHAIRQRAGVPYHVERKVCSNCRRLLEEKTIKRAAA* |
| Ga0066673_100458451 | 3300005175 | Soil | MTLKRIHKHNAVTVHAIRQRAGVPYHVERSVCSSCRRLLDEKTIKRAAA* |
| Ga0066679_105306852 | 3300005176 | Soil | MTLKRSHKHDAVTVHAIRQRAGVPYHVERKICASCRRLLDEKTIKRAAA* |
| Ga0066690_100367355 | 3300005177 | Soil | MTMKRIHKHNAVTTLAIRQRSGVPYQVERKICADCRRLLDEKPVRRAEAA* |
| Ga0066690_102377473 | 3300005177 | Soil | MTLKRRHKHTAVTVHAIRQRGGVPYHVERKVCSDCRRLLDETTIKRATA* |
| Ga0066690_102713522 | 3300005177 | Soil | MTLNRKHKHTAVTVHAIRQRGGVPYHVERKICSDCRRTLDERTIRRAAA* |
| Ga0066688_101549402 | 3300005178 | Soil | MILRSHKHTAVTIHAIRQRAGVPYHVERKICSNCQRLLEEKTIKRAAA* |
| Ga0066688_102213611 | 3300005178 | Soil | MTLRRHKHTAITIHAIRQRSGVPYHVERKVCSNCRRLLEEKTIKRAAA* |
| Ga0066685_101249923 | 3300005180 | Soil | MTLMRRHKHNTVTVHAIRQRAGVPYHVERKVCSSCRRLLDEKTIKRAAA* |
| Ga0066685_109461561 | 3300005180 | Soil | MTLRRHKHTAVTVHAIRQRAGVPYHVERKVCSNCKRLLEEKTIKRAAA* |
| Ga0066678_101217272 | 3300005181 | Soil | VKRGHKHTAVTVRAIRQRNGVPFEVERKVCKDCRRLLDEKPLKRATAV* |
| Ga0066671_100336142 | 3300005184 | Soil | MTLKRHKHNAVTVHAIRQRAGVPYHVERKVCSSCRRLLDEKTIKRAAA* |
| Ga0066671_106226822 | 3300005184 | Soil | VKVTRAHTHQAVTIRAIRQRSGISYEVERSVCRDCRRVLEEKPLKRASAA* |
| Ga0066676_102196982 | 3300005186 | Soil | MTLRRHKHSAVTVHAIRQRAGVPYHVERKVCSRCQRLLDEKTIKRAAA* |
| Ga0066675_102442322 | 3300005187 | Soil | MTLRHKHTTVTIHAIRQRAGVPYHVERKICSNCQRLLEEKTIKRAAA* |
| Ga0066675_106306382 | 3300005187 | Soil | MTLTLKRKHKHTAVTVHAIRQRGGVPYHVERKVCSSCRTLLGEKTLRRAAT* |
| Ga0066675_109109121 | 3300005187 | Soil | MTLKRHKHNAVTVHAIRQRAGVPYHVERKVCSSCRRLLDEK |
| Ga0065705_104137832 | 3300005294 | Switchgrass Rhizosphere | MTLMRKHKHTAVTVHALRQRHGVPYHVERKVCSDCKRLLDEKFIKRAAA* |
| Ga0066388_1000827212 | 3300005332 | Tropical Forest Soil | LRANGVKRAHKHTAVTTRAIRQRNGVPFEVERKVCRECRRLLDEKPLKRVPA* |
| Ga0070713_1000857302 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLKRHKHSTVTVHAIRQRAGVPYHVERQVCSSCRRLLDEKTIKRAAA* |
| Ga0070713_1016557582 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | HKHTAVTVHALRQRHGVPYHVERKVCSDCKRLLDEKFIKRAAA* |
| Ga0070710_102046222 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVNRIHKHTTVTTLAIRQRQGVPYQVEQKVCSICRRLLDEKPVKRAAA* |
| Ga0070701_107932272 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLRRHKHTAITVHAIRQQAGVPYHVERKVCSNCRRLLEEKTLKRAAA* |
| Ga0070705_1000290383 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLMRRHKHNAVTVHALRQRHGVPYHVERKVCSDCKRLLDEKFIKRAAA* |
| Ga0070705_1013670861 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLKRMHRHNAITVHAIRQRAGVPYHVERKVCAKCSRLLDEKTIKRAAA* |
| Ga0070708_1001200343 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLMRRHKHDTVTIHAIRQRAGVPYHVERKICSSCKRLLDEKTIKRAAA* |
| Ga0070708_1013759212 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLKRPHKHTAVTIHAIRQRAGVPYHVERKVCSNCQRLLDEKTIRRAAA* |
| Ga0066689_104983241 | 3300005447 | Soil | MTLRRHKHTAITIHAIRQRAGVPYHVERKVCSNCSRLLEEKTIKRAAA* |
| Ga0066682_108836821 | 3300005450 | Soil | MTLRRHKHTTVTIHAIRQRAGVPYHVERKVCSNCRRLLEEKTIKRAAA* |
| Ga0066681_102560452 | 3300005451 | Soil | MTLMRMHKHNTVTVHAIRQRAGVPYHVERKVCASCRRLLDEKTIKRAAA* |
| Ga0066681_102663101 | 3300005451 | Soil | MTLKRHKHSSITIHAIRQRAGVPYHVERKVCSGCQRLLDEKTIKRAAA* |
| Ga0070706_1001786271 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLMRRHKHDTVTIHAIRQRAGVPYHVERKICSSCKQLLDEKTIKRAAA* |
| Ga0070707_1005013721 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLKRMHRHNAITVHAIRQRAGVPYHVERKVCAKCSRLLDEK |
| Ga0070707_1011287892 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLMRRHKHTAVTVHALRQRHGVPYHVERKVCSDCKRLLDEKFIKRAAA* |
| Ga0073909_100205193 | 3300005526 | Surface Soil | MTLMRKHKHTAVTVHALRQRHGVPYHVERKVCSNCKRLLDEKFIKRAAA* |
| Ga0070679_1009473261 | 3300005530 | Corn Rhizosphere | VRDTEMTLMRKHKHTAVTVHALRQRHGVPYHVERKVCSDCKRLLDEKFIKRAAA* |
| Ga0070697_1003630601 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLRRHKHTAITVHAIRQRAGVPYHVERKVCSNCKRLLEEKTIKRAAA* |
| Ga0070697_1018961131 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLMRRHKHDTVTIHAIRQRAGVPYHVERKICSSCKRLLDEK |
| Ga0066701_103046981 | 3300005552 | Soil | SLTRAHKHTAVTVRAIRQRNGVPFEVERQVCKDCRRLLDEKPMRRAVTS* |
| Ga0066661_101869892 | 3300005554 | Soil | MSLRRAHKHTAVTVRAIRQRNGVPFEVERQVCKDCRRLLDEKPVRRAVTS* |
| Ga0066692_100170182 | 3300005555 | Soil | MSLRRAHKHTAVTVRAIRQRNGVPFEVERQVCKDCRRLLDESLCDGP* |
| Ga0066692_108712432 | 3300005555 | Soil | MTLTLKRRHKHTAVTVHAIRQRDGVPYHVERKICSSCSRLL |
| Ga0066707_104931931 | 3300005556 | Soil | VKRGHKHSAVTVRAIRQRNGVPFEVERKVCKDCRRLLDEKPLKRATAV* |
| Ga0066704_101431671 | 3300005557 | Soil | MSLRRAHKHTAVTVRAIRQRNGVPFEVERQVCKDCRRLLDEKPMRRAVTS* |
| Ga0066700_103515252 | 3300005559 | Soil | MSLRRLHKHTAVTVRAIRQRNGVPFEVERQVCKDCRRLLDEKPVKRAAA* |
| Ga0066700_103538452 | 3300005559 | Soil | MTLKHKHKHTAVTVHAIRQRGGVPYHVERKICSDCRRTLDEKTIKRAAA* |
| Ga0066670_102637272 | 3300005560 | Soil | MNVKDIHKHTAVTVHTLGQRSGVPYEVERTVCSDCRRLLDEKPLRRAAA* |
| Ga0068854_1014095722 | 3300005578 | Corn Rhizosphere | MTLKRHKHSTITIHAIRQRAGVPYHVERKVCSSCQKMLDE* |
| Ga0066691_104895052 | 3300005586 | Soil | MSLKRVHKHTAVTVRAIRQRNGVPFEVERQVCKDCRRLLDEKPVR |
| Ga0066691_107266582 | 3300005586 | Soil | MTLNRKHKHTAVTVHAIRQRGGVPYHVERKICSDCRRTLDEKTIKRAAA* |
| Ga0066706_107547042 | 3300005598 | Soil | MTLKRSHKHDAVTVHAIRQRAGVPYHVERKVCSSCSRLLDERTIKRAAA* |
| Ga0068856_1005004413 | 3300005614 | Corn Rhizosphere | VHAIRQRAGVPYHVERQVCSRCQKMLDEKTIKRAAA* |
| Ga0066905_1005271273 | 3300005713 | Tropical Forest Soil | MTLKRHKHSTITIHAIRQRAGVPYHVERQVCSRCQKTLDEKTIKRAAA* |
| Ga0068861_1002335973 | 3300005719 | Switchgrass Rhizosphere | RKHKHTAVTVHALRQRHGVPYHVERKVCSDCKRLLDEKFIKRAAA* |
| Ga0081455_100784324 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MALKRIHKHNAVTTIAIRQRSGVPYQVERKVCADCHRLLDEKPLKRAAA* |
| Ga0081455_105724932 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MALNVKRRHKHTSVTVHAIRQRAGVPYHVERKICSDCSRVLAEKTLRRAAT* |
| Ga0081539_100278682 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MTLKRHKHSAVTVHAIRQRAGVPYHVERQVCSSCRRLLEEKTIKRAAA* |
| Ga0066651_101362342 | 3300006031 | Soil | RHRHSAVTIHAIRQRAGVPYHVERKVCSSCQRLLDEKTLRRAAA* |
| Ga0066696_102926103 | 3300006032 | Soil | AIRQRAGVPYHVERKICSNCQRLLEEKTIKRAAA* |
| Ga0066656_106311501 | 3300006034 | Soil | MTLRRHKHTAITIHAIRQRAGVPYHVERKVCSNCSRLLEEKTIKR |
| Ga0066652_1000813412 | 3300006046 | Soil | MTLRRHKHTAITVHAIRQQAGVPYHVERKVCSNCRRLLEEKTIKRAAA* |
| Ga0066652_1003160282 | 3300006046 | Soil | MTLKRHKHSAVTVHAIRQRAGVPYHVERQVCSRCQRLLDEKTLKRAAA* |
| Ga0066652_1004401671 | 3300006046 | Soil | MTLRRHKHTTVTIHAIRQRAGVPYHVERKVCSNCQRLLEEKTI |
| Ga0066652_1020879421 | 3300006046 | Soil | MALKRIHKHNAVTTVAIRQRSGVPYQVERKICADCRTLLEEKPVKRAEAA* |
| Ga0070716_1012328181 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLKRHKHSSVTVHAIRQRAGVPYHVERQVCSSCRRLLDEKTIKRAAA* |
| Ga0070712_1000100286 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVSRIHKHTTVTTLAIRQRQGVPYQVEQKVCSTCRRLLDEKPVKRAAA* |
| Ga0074053_100257501 | 3300006575 | Soil | AVTVHALRQRHGVPYHVERQVCSNCKRLLDEKFIKRAAA* |
| Ga0074050_113866611 | 3300006577 | Soil | TEMTLMRRHKHTAVTVHALRQRHGVPYHVERKVCSDCKRLLDEKFIKRAAA* |
| Ga0074049_129063541 | 3300006580 | Soil | TVHALRQRHGVPYHVERQVCSNCKRLLDEKFIKRAAA* |
| Ga0074048_100580183 | 3300006581 | Soil | HKHTAVTVHALRQRHGVPYHVERKVSSDCKRLLDEKFIKRAAA* |
| Ga0079222_120670092 | 3300006755 | Agricultural Soil | MTLKRHKHSTVTVHAIRQRAGVPYHVERKVCPSCQKLL |
| Ga0066653_107288992 | 3300006791 | Soil | MTLKRIHKHDAVTVHAIRQRSGVPYHVERKVCASCQRLLDEKTIKRAAA* |
| Ga0066659_114181392 | 3300006797 | Soil | MTLKRRHKHTTVTVHAIRQRGGVPYHVERKVCSDCRRLLDETTIKRATA* |
| Ga0066660_100807463 | 3300006800 | Soil | MTLKRHKHNAVTVHAIRQRAGVPYHVERQVCSSCRRLLDEKTIKRAAA* |
| Ga0079221_101939432 | 3300006804 | Agricultural Soil | VKRAHKHSAVTTRAIRQRNGVPFEVERKICRECRRLLDEKPLKRVPA* |
| Ga0079220_100988992 | 3300006806 | Agricultural Soil | MTLKRHKHSMITIHAIRQRAGVPYHVERQVCSRCQKTLDEKTLKRAAA* |
| Ga0079220_108045772 | 3300006806 | Agricultural Soil | MTLKRHKHSTVTVHAIRQRAGVPYHVERKVCSSCQRLLDEKTLRRAAA* |
| Ga0075433_116168032 | 3300006852 | Populus Rhizosphere | MTLKRHKHSAVTIHAIRQRAGVPYHVERKVCSRCQKMLDEKTIKRAAA* |
| Ga0075425_1008085412 | 3300006854 | Populus Rhizosphere | MTLKRHKHSAVTIHAIRQRAGVPYHVERKVCSRCQKMLDEKTLKRAAA* |
| Ga0075425_1014573012 | 3300006854 | Populus Rhizosphere | LKVDDVKRAHKHTAVTTRAIRQRNGIPFEVERKICRECRRLLDEKPLKRVPA* |
| Ga0075434_1006363592 | 3300006871 | Populus Rhizosphere | LKVDDVKRAHKHTAVTTRAIRQRNGVPFEVERKICRECRRLLDEKPLKRVPA* |
| Ga0079217_105887782 | 3300006876 | Agricultural Soil | MTLKRPHKHTAVTIHAIRQRAGVPYHVERKVCSNCRRLLDEKTIKRAAA* |
| Ga0105679_100245792 | 3300007790 | Soil | MTLKRPHKHTAVTIHAIRQRAGVPYHVERKVCSNCSRLLEEKTIRRAAA* |
| Ga0066710_10001161612 | 3300009012 | Grasslands Soil | VKRGHKHSAVTVRAIRQRNGVPFEVERKVCKDCRRLLDEKPLKRATAV |
| Ga0066710_1003488024 | 3300009012 | Grasslands Soil | MTLTLKRKHKHTAVTVHAIQQRSGVPYHVERKICSSCRTLLGERTLRRAAT |
| Ga0066710_1008403581 | 3300009012 | Grasslands Soil | MTLRRHKHTAITIHAIRQRAGVPYHVERKVCSNCSRLLEEKTIKRA |
| Ga0066710_1009950882 | 3300009012 | Grasslands Soil | MTLKRHKHTAVTVHAIRQRAGVPYHVERKICSNCRRLLEEKTIKRAAA |
| Ga0066710_1011799782 | 3300009012 | Grasslands Soil | MTLTLKRKHKHTAVTVHAIRQRGGVPYHVERKVCSSCRTLLGEKTLRRAAT |
| Ga0066710_1014200522 | 3300009012 | Grasslands Soil | MKRVHKHTAVIMRAIRQRNGVPFEVERKVCKDCRRLLDEKPVKRALA |
| Ga0066710_1019133222 | 3300009012 | Grasslands Soil | MTLKRRHKHDAVTVHAIRQRAGVPYHVERKVCSSCRRLLDEKTIKRAAA |
| Ga0066710_1025248122 | 3300009012 | Grasslands Soil | MTLKRHKHTAITIHAIRQRAGVPYHVERQVCSGCRRVIEEKTIRRAAA |
| Ga0066710_1025639011 | 3300009012 | Grasslands Soil | MTLRRHKHTAITIHAIRQRAGVPYHVERKVCSNCSRLLEEK |
| Ga0066710_1026381322 | 3300009012 | Grasslands Soil | MTLRRHKHTTVTIHAIRQRAGVPYHVERKVCSNCQRLLEEKTIKRAAA |
| Ga0066710_1035983972 | 3300009012 | Grasslands Soil | MTLKRSHKHNAVTVHAIRQRAGVPYHVERQVCASCRRLLDEKTIKRAAA |
| Ga0066710_1042674572 | 3300009012 | Grasslands Soil | HKHTAITIHAIRQRAGVPYHVERKVCSNCSRLVEEKTIKRAAA |
| Ga0099829_102861432 | 3300009038 | Vadose Zone Soil | MSLRRAHKHTAVTVRAIRQRNGVPFEVERQVCKDCRRLLDEKPVKRAVA* |
| Ga0099828_100657323 | 3300009089 | Vadose Zone Soil | MTLRRHKHTAITIHAIRQRAGVPYHVERKVCSNCRRLLEEKTIKRAVA* |
| Ga0099827_101715141 | 3300009090 | Vadose Zone Soil | MMLKRPHKHTAVTIHAIRQSAGVPYHVERKVCSDCRRLLDEKTIRRAAT* |
| Ga0099827_104196552 | 3300009090 | Vadose Zone Soil | MTLRRHKHTANTIHAIRQRAGVPYHVERKVCSNCRRLLEEKTIKRAAA* |
| Ga0099827_111055391 | 3300009090 | Vadose Zone Soil | PMTAKRAHKHTTVTTRAIGQRNGVPYVVERKVCKDCRRLLAERALRRASAA* |
| Ga0066709_1002339552 | 3300009137 | Grasslands Soil | MKRVHKHTAVIMRAIRQRNGVPFEVERKVCKDCRRLLDEKPVKRALA* |
| Ga0066709_1004018103 | 3300009137 | Grasslands Soil | MTLKRHKHTAVTVHAIRQRAGVPYHVERKICSNCRRLLEEKTIKRAAA* |
| Ga0066709_1005944322 | 3300009137 | Grasslands Soil | LRSTSVKRGHKHTAVTVRAIRQRNGVPFEVERKVCKDCRRLLDEKPLKRATAV* |
| Ga0066709_1019651271 | 3300009137 | Grasslands Soil | VRRNRLRTMNVKDIHKHTAVTVHTLGQRSGVPYEVERTVCSDCRRLLDEKPLRRAAA* |
| Ga0066709_1020132682 | 3300009137 | Grasslands Soil | MSLKRVHKHTAVTVRAIRQRNGVPFEVERQVCKDCRRLLDEKPVRRAAA* |
| Ga0066709_1028202102 | 3300009137 | Grasslands Soil | MTLKRRHKHDAVTVHAIRQRAGVPYHVERQVCSSCRRLLDEKTLKRAAA* |
| Ga0066709_1040214841 | 3300009137 | Grasslands Soil | KHNAVTVHAIRQRAGVPYHVERKVCSSCRRLLDEKTIKRAAA* |
| Ga0066709_1046475581 | 3300009137 | Grasslands Soil | MTLKRSHKHDAVTVHAIRQRAGVPYHVERKICASCSRLLDEKTIKRAAA* |
| Ga0114129_117723842 | 3300009147 | Populus Rhizosphere | MTLRRHKHTAVTIHAIRQHSGVPYHVERKVCSNCRRLLEEKTIKRAAA* |
| Ga0114129_126697061 | 3300009147 | Populus Rhizosphere | MTLRRHKHTAVTIHAIRQRAGVPYHVERKVCSNCQRLLEEKTIKRAAA* |
| Ga0105243_118908042 | 3300009148 | Miscanthus Rhizosphere | MTLRRHKHTAITVHALRQRAGVPYHVERKVCSNCKRLLEEKTIKRAAA* |
| Ga0126307_107406122 | 3300009789 | Serpentine Soil | MTLKDSHKHTTVTIHAIRQRAGVPYHVERKVCSNCSKTLDEKTIKRAAA* |
| Ga0126374_100168964 | 3300009792 | Tropical Forest Soil | MTLKRHKHSTVTIHAIRQRAGVPYHVERKVCSSCQKTLDEKTIRRAAA* |
| Ga0105084_10386222 | 3300009811 | Groundwater Sand | MTLKRPHKHTTVTVHAIRQRAGVPYHVERKVCSNCSKTLDEKTIKRAAA* |
| Ga0105084_10419051 | 3300009811 | Groundwater Sand | LTLKRPHKHTTITIHAIRQRAGVPYHVERKVCSNCSRLLDEKTIKRATA* |
| Ga0126304_104602242 | 3300010037 | Serpentine Soil | MALNVTSRHKHTSVTVHAIRQRAGVPYHVERKICSDCSRVLAEKTLRRAAT* |
| Ga0126315_107737952 | 3300010038 | Serpentine Soil | MTLKHRHKHNAVTIHAIRQRAGVPYHVERQVCSRCRRLLDEKTIKRAAA* |
| Ga0126309_100282222 | 3300010039 | Serpentine Soil | MTLKRPHKHTTVTVHAIRQRAGVPYHVERQVCSNCSKTLDEKTIRRAAA* |
| Ga0126309_101244322 | 3300010039 | Serpentine Soil | MTLKRHKHSAVTVHAIRQRAGVPYHVERQVCSSCHRLLDEKTLKRAAA* |
| Ga0126309_106767601 | 3300010039 | Serpentine Soil | MTLKRPHKHTAVTVHAIRQRAGVPYQVERKVCSNCQQLLDEKPIRRAVA* |
| Ga0126308_108147452 | 3300010040 | Serpentine Soil | MALNVKRRHKHTAVTVHAIRQRAGVPYHVERKVCSGCSHVLDERTIRRAAT* |
| Ga0126312_106867322 | 3300010041 | Serpentine Soil | MTLKRTHKHNAVTVHAIRQRAGVPYHVERKVCSDCRRLLDEKTLRRAAT* |
| Ga0126310_100650273 | 3300010044 | Serpentine Soil | MTLKRHKHSAVTVHAIRQRAGVPYHVERQVCSSCRRLLDEKTLKRAAA* |
| Ga0126310_104810382 | 3300010044 | Serpentine Soil | MTLKRRHKHSAVTVHAIRQRAGVPYHVERQVCSGCNRLLDEKTLRRAAA* |
| Ga0126384_117637252 | 3300010046 | Tropical Forest Soil | MTLKRHKHSTVTIHAIRQRAGVPYHVERKVCSRCQKMLDEKTIRRAAA* |
| Ga0126382_103743171 | 3300010047 | Tropical Forest Soil | MTLKRHKHSAITIHAIRQRAGVPYHVERKVCSSCRKM |
| Ga0126382_114269801 | 3300010047 | Tropical Forest Soil | MTLKHPHKHTAVTIHAIRQRGGVPYHVERKVCRNCSRLLDEKTIRRAAA* |
| Ga0127503_105044921 | 3300010154 | Soil | EMTLMRKHKHTAVTVHALRQRHGVPYHVERQVCSNCKRLLDEKFIKRAAA* |
| Ga0134084_100566221 | 3300010322 | Grasslands Soil | MTLKRHRHSAVTIHAIRQRAGVPYHVERKVCSGCQRLLDEKTIKRAAA* |
| Ga0134080_105674982 | 3300010333 | Grasslands Soil | MTLRRHKHTTVTIHAIRQRAGVPYHVERKVCSNCQRLLEEKTIKRAAA* |
| Ga0134063_103133131 | 3300010335 | Grasslands Soil | MTLSRHKHTTVTIHAIRQRAGVPYHVERKICSNCQRLLEEKTIRRA |
| Ga0134071_100613983 | 3300010336 | Grasslands Soil | MTLRRHKHTAITVHAIRQQAGVPYHVERKVCSNCRQLLEEKTIK |
| Ga0134062_100870461 | 3300010337 | Grasslands Soil | MTLKRHKHSSITIHAIRQRAGVPYHVERKVCSGCQRL |
| Ga0126370_108659272 | 3300010358 | Tropical Forest Soil | MTLKRHKHSTVTIHAIRQRAGVPYHVERKVCSSCQKMLDE |
| Ga0126379_125597462 | 3300010366 | Tropical Forest Soil | AIRQRAGVPYHVERKVCSSCQKMLDEKTIRRAAA* |
| Ga0134128_131163781 | 3300010373 | Terrestrial Soil | MTLRRHKHTAITVHAIRQRAGVPYHVERKVCSNCQRLLEEKTLKRAAA* |
| Ga0134127_101241763 | 3300010399 | Terrestrial Soil | MTLKRHKHNAVTVHAIRQRGGVPYHVERKVCSRCQRLLDEKTIKRAAA* |
| Ga0138505_1000416072 | 3300010999 | Soil | VRDTEMTLMRRHKHTAVTVHALRQRHGVPYHVERKVCSNCQRLLDEKFIKRAAA* |
| Ga0138514_1000084692 | 3300011003 | Soil | MTLRRHKHTAITIHAIRQRAGVPYHVERKVCSNCSRLLEEKTLKRAAA* |
| Ga0137392_112197371 | 3300011269 | Vadose Zone Soil | AIRQRAGVPYHVERKVCSNCRRLLEEKTIKRAAA* |
| Ga0120174_10670582 | 3300012008 | Permafrost | MTLRRHKHTAITIHAIRQRAGVPYHVERKICSNCQRLLEEKTLKRAAA* |
| Ga0120139_10518582 | 3300012019 | Permafrost | MTLRRHKHTAITIHAIRQRAGVPYHVERKVCSNCRRLLEERTIKRAAA* |
| Ga0137389_101495822 | 3300012096 | Vadose Zone Soil | MTLRRHKHTAITIHAIRQRAGVPYHVERKVCSNCRRLLEETTIKRAAA* |
| Ga0137389_104231183 | 3300012096 | Vadose Zone Soil | MSLRRAHKHTAVTVRAIRQRNGVPFEVERQVCKDCRRLLDEKPVKR |
| Ga0137388_109867592 | 3300012189 | Vadose Zone Soil | TIHAIRQRAGVPYHVERKVCSNCRRLLEEKTIKRAAA* |
| Ga0137364_101209811 | 3300012198 | Vadose Zone Soil | MTLKRHKHSSVTIHAIRQRAGVPYHVERKVCSSCQRLLDEKTLRRAAA* |
| Ga0137364_113568672 | 3300012198 | Vadose Zone Soil | MKRVHKHTAVTVRAIRQRNGVPFEVERKVCRDCRRLLDEKPLKRAPT* |
| Ga0137383_111071241 | 3300012199 | Vadose Zone Soil | SMKRAHKHSAVTVRAIRQRNGVPFEVERKVCRDCRRLLDEKPLKRAPT* |
| Ga0137382_100178824 | 3300012200 | Vadose Zone Soil | MTLKRHKHSSVTVHAIRQHAGVPYQVERQVCSRCRRLLDEKTIKRAAA* |
| Ga0137382_107892201 | 3300012200 | Vadose Zone Soil | MTLRRHKHTAITIHAIRQQSGVPYHVERKVCSNCRRLLEEKTLRRAAA* |
| Ga0137382_108070202 | 3300012200 | Vadose Zone Soil | MTLRRHKHTTVTIHAIRQRAGVPYHVERKVCSNCQRLLEEKTIRRAAA* |
| Ga0137365_107004472 | 3300012201 | Vadose Zone Soil | MTMKPIHKHNAVTTVAIRQRSGVPYQVERQVCADCHRLLDEKPVKRAAAA* |
| Ga0137365_108492102 | 3300012201 | Vadose Zone Soil | MTVMRRHKHNAVTVHAIRQRAGVPYHVERKVCSSCRRLLDEKTIKRAAA* |
| Ga0137374_100793392 | 3300012204 | Vadose Zone Soil | MTLKRRHKHTAVTVHAIRQRGGVPYHVERKVCSDCRRLLDEKTIRRAAT* |
| Ga0137374_101030913 | 3300012204 | Vadose Zone Soil | MTLKRRHKHTAVTVHAIRQRGGVPYHVERKVCSNCRRLLDEKTIRRAAA* |
| Ga0137374_101127891 | 3300012204 | Vadose Zone Soil | MTLKRRHKHNAVTIHAIRQRAGVPYHVERKVCSGCSRLLDEKTLKRAAA* |
| Ga0137374_101959672 | 3300012204 | Vadose Zone Soil | MTLKRIHKHNAVTTVAIRQRNGVPYQVERKVCADCRRLLDEKPVKRAAAA* |
| Ga0137374_102136052 | 3300012204 | Vadose Zone Soil | MNLKRIHKHNAVTTVAIRQRNGVPYQVERKVCADCRRLLDEKPVKRAAAA* |
| Ga0137374_111172391 | 3300012204 | Vadose Zone Soil | MTLKRHKHDAVTVHVIRQRAGVPYHVERKVCSRCRRLLDEKTIKRAAA* |
| Ga0137380_1001465812 | 3300012206 | Vadose Zone Soil | MTLRRHKHTAVTVHAIRQRAGVPYHVERKVCSNCKRLLEEKTLKRAAA* |
| Ga0137380_100568574 | 3300012206 | Vadose Zone Soil | MTLMRRHKHNAVTVHAIRQRAGVPYHVERKVCSSCRRLLDEKTIKRAAA* |
| Ga0137380_112956571 | 3300012206 | Vadose Zone Soil | MTLRRHKHTAVTIHAIRQRAGVPYHVERKVCSNCRRLLEEKTIRRAAA* |
| Ga0137381_112255391 | 3300012207 | Vadose Zone Soil | HKHTAVTVHAIRQRGGVPYHVERQICSDCRRTLDEKTLKRAAT* |
| Ga0137376_100512082 | 3300012208 | Vadose Zone Soil | MTLRRHKHTAITVHAIRQRAGVPYHVERQVCSNCKRLLEEKTIKRAAA* |
| Ga0137378_104941192 | 3300012210 | Vadose Zone Soil | MTLKRAHKHTAITIHALHQRNGVPYEVERKVCADCRRLLDEKPVKRAVA* |
| Ga0137377_113901802 | 3300012211 | Vadose Zone Soil | MKRAHKHTAVTVRAIRQRNGVPFEVERKVCRDCRRLLDEKPLKRAPT* |
| Ga0150985_1208178411 | 3300012212 | Avena Fatua Rhizosphere | GMTLKRHKHHAVTVHAIRQRAGVPYHVERQICSSCRRLLDEKTLRRAAA* |
| Ga0137370_108474722 | 3300012285 | Vadose Zone Soil | MTLRRHKHTAITIHAIRQRAGVPYHVERKVCSNCSRLLEEKTIKRAAS* |
| Ga0137370_109104361 | 3300012285 | Vadose Zone Soil | HKHTAITIHAIRQQSGVPYHVERKVCSNCSRLLEEKTLKRAAA* |
| Ga0137370_109408832 | 3300012285 | Vadose Zone Soil | MTLRRHKHTAITVHAIRQRSGVPYHVERKVCSNCKRLLEEKTIKRAAA* |
| Ga0137372_100376716 | 3300012350 | Vadose Zone Soil | MTLMRRHKHNAVTIHAIRQRAGVPYHVERKVCSGCRRLLEEKTIKRAAA* |
| Ga0137372_108074292 | 3300012350 | Vadose Zone Soil | MTLKRHKHTAVTIHAIRQRAGVPYHVERKVCSACSRVIEEKTIRRAAA* |
| Ga0137366_111619972 | 3300012354 | Vadose Zone Soil | MTLRRHKHTAITVHAIRQRAGVPYHVERRVCSNCKRLLEEKTIKRAAA* |
| Ga0137369_100280595 | 3300012355 | Vadose Zone Soil | MTLKRRHKHDAVTIHAIRQRAGVPYHVERKVCSSCRRLLDEKTIRRAAA* |
| Ga0137369_104202291 | 3300012355 | Vadose Zone Soil | MTLTQLKRHKHKAITVVALRQLGGVPYQVERKVCADCHRLLDERPVKRIAA* |
| Ga0137369_104831942 | 3300012355 | Vadose Zone Soil | MTLKRPHKHTTVTVHAIRQRAGVPYHVERKVCSDCRRLLDEKTIRRAAT* |
| Ga0137371_112838962 | 3300012356 | Vadose Zone Soil | MTMKRIHKHNAVTTVAIRQRSGVPYQVERQVCADCHRLLDEK |
| Ga0137384_111534562 | 3300012357 | Vadose Zone Soil | MTVMRRHKHNAVTVHAIRQRAGVPYHVERKVCSSCRRLLDEK |
| Ga0137368_1000804812 | 3300012358 | Vadose Zone Soil | MTLRRHKHTAITVHAIRQRAGVPYHVERKVCSNCRRLLEEKTIKRATA* |
| Ga0137375_100108435 | 3300012360 | Vadose Zone Soil | MTLKRSHKHDAVTIHAIRQRAGVPYHVERKICSSCRRLLDEKTIRRAAA* |
| Ga0137375_110027391 | 3300012360 | Vadose Zone Soil | MALNVKRRHKHTAVTVHAIRQRAGIPYHVERKVCSDCSQLLAERPIKRAAT* |
| Ga0150984_1202314642 | 3300012469 | Avena Fatua Rhizosphere | MTLMRRHKHTAVTVHALRQRHGVPYHVERKVCSNCQRLLDEKFIKRAAA* |
| Ga0137373_100630992 | 3300012532 | Vadose Zone Soil | MTLKRRHKHDAVTIHAIRQRAGVPYHVERKVCSSCMRLLDEKTIRRAAA* |
| Ga0137373_102222503 | 3300012532 | Vadose Zone Soil | MTLKRHKHDAVTVHAIRQRAGVPYHVERKVCSRCRRLLDEKTIKRAAA* |
| Ga0137419_119719442 | 3300012925 | Vadose Zone Soil | EDLMTLRRHKHTAITIHAIRQRSGVPYHVERKVCSNCRRLLEEKTLKRAAA* |
| Ga0137407_119887472 | 3300012930 | Vadose Zone Soil | HTAITIHAIRQRAGVPYHVERKVCSNCSRLLEEKTLKRAAA* |
| Ga0162653_1000256391 | 3300012937 | Soil | MALNVKRRHKHTAVTVHALRQRHGVPYHVERKVCSNCQRLLDEKFIKRAAA* |
| Ga0162651_1000878992 | 3300012938 | Soil | MTLRRHKHTAITIHAIRQRAGVPYHVERKVCSNCRFTSASV |
| Ga0164300_108829152 | 3300012951 | Soil | MTLRRHKHTAITVHAIRQRAGVPYHVERKVCSNCRRLLEEKTLKRAAA* |
| Ga0164298_103483522 | 3300012955 | Soil | MTLMRRHKHNAVTVHALRQRHGVPYHVERKVCSGCKRLLDEKFIKRAAA* |
| Ga0164299_100554521 | 3300012958 | Soil | MTLRRHKHTAVTVHAIRQRAGVPYHVESKVCSNCKRLLEEKTIKRAAA* |
| Ga0134087_101174821 | 3300012977 | Grasslands Soil | LKRHKHSTVTVHAIRQRAGVPYHVERQVCSSCRRLLEEKTIKRAAA* |
| Ga0134087_107246951 | 3300012977 | Grasslands Soil | VTVHAIRQRAGVPYHVERSVCSSCRRLLDEKTIKRAAA* |
| Ga0164305_106600031 | 3300012989 | Soil | TLRRHKHTAITVHAIRQRAGVPYHVERKVCSNCKRLLEEKTIKRAAA* |
| Ga0120150_10302343 | 3300013294 | Permafrost | TLRRHKHTAITVHALRQRAGVPYHVERKICSNCQRLLEEKTLKRAAA* |
| Ga0120111_10801512 | 3300013764 | Permafrost | MTLRRHKHTAITVHAIRQRAGVPYHVERKVCANCKRLLEEKTIKRAAA* |
| Ga0120158_100288732 | 3300013772 | Permafrost | MTLRRHKHTAITVHAIRQRAGVPYHVERQVCSNCRRLLEEKTIKRAAA* |
| Ga0134081_101703231 | 3300014150 | Grasslands Soil | MTLKRIHKHRAVTVHAIRQRAGVPYHVERKVCTSCSRLLDERTIKRAAA* |
| Ga0167629_11946191 | 3300015209 | Glacier Forefield Soil | MTLRRHKHTAITVHAIRQRAGVPYHVERKVCSNCRRLLEETTIKRAAA* |
| Ga0132255_1000504296 | 3300015374 | Arabidopsis Rhizosphere | MTLKGHKHSTVTVHAIRQRAGVPYHVERKVCSSCQKMLDEKTLRRAAA* |
| Ga0134069_13572231 | 3300017654 | Grasslands Soil | MTLRRHKHTAITIHAIRQRAGVPYHVERKVCSNCSR |
| Ga0187775_103258172 | 3300017939 | Tropical Peatland | MTLKRHKHSTVTIHAIRQRAGVPYHVERKVCSSCQKMLDEKTIRRAAA |
| Ga0184610_12699072 | 3300017997 | Groundwater Sediment | MTLKRPHKHTTVTVHAIRQRAGVPYHVERKVCSNCSKTLGEKTIKRAAA |
| Ga0184605_100001592 | 3300018027 | Groundwater Sediment | MTLRRHKHTAITIHAIRQRAGVPYHVERKVCSNCRRLLEEKTIKRAAA |
| Ga0184605_100130643 | 3300018027 | Groundwater Sediment | MTLRRHKHTAITVHAIRQRAGVPYHVERKVCSNCRRLLEEKTIKRAAA |
| Ga0184605_103221052 | 3300018027 | Groundwater Sediment | MTLKRPHKHTAVTIHAIRQRAGVPYHVERRVCSNCQRLLDEKTIKRAAA |
| Ga0184608_101551182 | 3300018028 | Groundwater Sediment | MTLKRHKHSSVTVHAIRQRAGVPYHVERQVCSRCRRLLDEKTIKRAAA |
| Ga0184623_100826141 | 3300018056 | Groundwater Sediment | MALNVKRRHKHTAVTVHAIRQRAGVPYHVERKVCSDCSRLLAERTIKRAST |
| Ga0184623_103313693 | 3300018056 | Groundwater Sediment | VHALRQRHGVPYHVERKVCSNCQRLLDEKFIKRAAA |
| Ga0184619_105142001 | 3300018061 | Groundwater Sediment | MTLKRHKHSSVTVHAIRQRAGVPYHVERQVCSRCRRLLDE |
| Ga0184619_105545811 | 3300018061 | Groundwater Sediment | GMTLKRHKHSSVTVHAIRQRAGVPYHVERQVCSRCRRLLDEKTIKRAAA |
| Ga0184617_12650142 | 3300018066 | Groundwater Sediment | MTLRRHKHIAITVHAIRQRAGVPYHVERKVCSNCKRLLEEKTIKRAAA |
| Ga0184618_103555541 | 3300018071 | Groundwater Sediment | MALNVKRRHKHTAVTVHAIRQRAGVPYHVERKVCSDCSRLLSERTIKRAAT |
| Ga0184618_104059611 | 3300018071 | Groundwater Sediment | MTLRRHKHTAITIHAIRQRAGVPYHVERKVCSNCSRLLAEKTLKRAAA |
| Ga0184632_102904651 | 3300018075 | Groundwater Sediment | MALNVKRRHKHTAVTVHAIRQRAGVPYHVERKVCADCSRLLAERTIKRAAT |
| Ga0184609_100662362 | 3300018076 | Groundwater Sediment | MALNVKRRHKHTAVTVHAIRQRAGVPYHVERKVCSDCSRLLAERTIKRAAT |
| Ga0184609_102533062 | 3300018076 | Groundwater Sediment | MTLRRHKHTAITVHAIRQRAGVPYHVERKVCSNCQRLLEEKTIKRAAA |
| Ga0066655_100839513 | 3300018431 | Grasslands Soil | MNVKDIHKHTAVTVHTLGQRSGVPYEVERTVCSDCRRLLDEKPLRRAAA |
| Ga0066655_105693581 | 3300018431 | Grasslands Soil | ITLRRRMTLGRHKHTAVTIHAIRQRAGVPYHVERKVCSNCRRLLEEKTIKRAAA |
| Ga0066655_109572362 | 3300018431 | Grasslands Soil | ERLITLRRRMTLRRHKHTTVTIHAIRQRAGVPYHVERKVCSNCQRLLEEKTIRRAAA |
| Ga0066667_100178775 | 3300018433 | Grasslands Soil | MTLMRRHKHNTVTVHAIRQRAGVPYHVERKVCSSCRRLLDEKTIKRAAA |
| Ga0066667_102769852 | 3300018433 | Grasslands Soil | MILRSHKHTAVTIHAIRQRAGVPYHVERKICSNCQRLLEEKTIKRAAA |
| Ga0066667_111154672 | 3300018433 | Grasslands Soil | MNVKDIHKHTAVTVHTLGQRSGVPYEVERTVCSDCRRLLDEK |
| Ga0066662_104416182 | 3300018468 | Grasslands Soil | MTLRRHKHTAITIHAIRQRAGVPYHVERKVCADCQRLLEEKTIKRAAA |
| Ga0066662_118420201 | 3300018468 | Grasslands Soil | MSLRRAHEHTAVTVRAIRQRNGVPFEVERQVCKDCRRLLDEKP |
| Ga0066669_100066587 | 3300018482 | Grasslands Soil | MTLKRHKHSSITIHAIRQRAGVPYHVERKVCSGCQRLLDEKTIKRAAA |
| Ga0066669_101267312 | 3300018482 | Grasslands Soil | MTLKRIHKHNAVTVHAIRQRAGAPYHVERSVCSSCRRLLDEKTIKRAAA |
| Ga0190273_112711722 | 3300018920 | Soil | MTLRRHKHTAITVHAIRQRAGVPYHVERQVCSNCRRLLEEKTIKRAAA |
| Ga0184643_12908782 | 3300019255 | Groundwater Sediment | MTLRRHKHTAITIHAIRQRAGVPYHVERKVCSNCSRLLEEKTLKRAAA |
| Ga0173482_103360582 | 3300019361 | Soil | MTLKRHKHSTVTIHAIRQRAGVPYHVERKVCSRCQKTLDEKTIRRAAA |
| Ga0193705_10044063 | 3300019869 | Soil | MTLKRHKHSSVTVHAIRQRAGVPYHVERQVCSHCRQLLDEKTIKRAAA |
| Ga0193701_10713392 | 3300019875 | Soil | MTLRRHKHTAITVHAIRQRAGVPYHVERKVCANCKRLLEEKTIKRAAA |
| Ga0193707_11474931 | 3300019881 | Soil | MTLRRHKHTAITIHAIRQRAGVPYHVERKVCSNCRRLLEETTIKRAAA |
| Ga0193727_10018835 | 3300019886 | Soil | MTLMRKHKHTAVTVHALRQRHGVPYHVERQVCSNCKRLLDEKFIKRAAA |
| Ga0193729_100000788 | 3300019887 | Soil | MTLRRHKHTAITIHAIRQRAGVPYHVERQVCSNCRRLLEEKTIKRAAA |
| Ga0193697_11379532 | 3300020005 | Soil | MTLMRKHKHTAVTVHALRQRHGVPYHVERKVCSNCKRLLDEKFIKRAAA |
| Ga0210378_100020512 | 3300021073 | Groundwater Sediment | MTLKRPHKHTTVTVHAIRQRAGVPYHVERKVCSNCSKTLDEKTIKRAAA |
| Ga0210381_103502001 | 3300021078 | Groundwater Sediment | MTLRRHKHTAITVHAIRQRAGVPYHVERKVCSNCKRLLEEKTIKRAAA |
| Ga0224452_12589672 | 3300022534 | Groundwater Sediment | KHIAITVHAIRQRAGVPYHVERKVCSNCKRLLEEKTIKRAAA |
| Ga0222623_100744903 | 3300022694 | Groundwater Sediment | TAITVHAIRQRAGVPYHVERKVCSNCRRLLEEKTIKRAAA |
| Ga0207685_105741062 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVSRIHKHTTVTTLAIRQRQGVPYQVEQKVCSTCRRLLDEKPVKRAAA |
| Ga0207684_106872871 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLKRPHKHTAVTIHAIRQRAGVPYHVERKVCSNCQRLLDEKTIRRAAA |
| Ga0207693_110815202 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | KHTAITIHAIRQRAGVPYHVERKVCSNCRRLLEEKTIKRAAA |
| Ga0207660_100954783 | 3300025917 | Corn Rhizosphere | TRNMTLMRKHKHTAVTVHALRQRHGVPYHVERKVCSDCKRLLDEKFIKRAAA |
| Ga0207687_103733261 | 3300025927 | Miscanthus Rhizosphere | MTLKRHKHNAVTVHAIRQRAGVPYHVERQVCSRCQK |
| Ga0207665_101379543 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLMRKHKHTAVTVHALRQRHGVPYHVERKVCSDCKRLLDEKFIK |
| Ga0207665_110496561 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLRRHKHTAITIHAIRQRAGVPYHVERKVCSNCRRLLGEKTIKRAAA |
| Ga0207712_100506921 | 3300025961 | Switchgrass Rhizosphere | NMTLMRKHKHTAVTVHALRQRHGVPYHVERKVCSDCKRLLDEKFIKRAAA |
| Ga0207677_115988501 | 3300026023 | Miscanthus Rhizosphere | MTLKRHKHNAVTVHAIRQRAGVPYHVERQVCSRCQKMLDEKTIKR |
| Ga0207641_122445192 | 3300026088 | Switchgrass Rhizosphere | EDVMTLRRHKHTAITVHAIRQQAGVPYHVERKVCSNCRRLLEEKTLKRAAA |
| Ga0207683_118538092 | 3300026121 | Miscanthus Rhizosphere | MTLRRHKHTAITVHAIRQQAGVPYHVERKVCSNCRRL |
| Ga0209027_12319012 | 3300026300 | Grasslands Soil | VKRVHKHNTMTVRAIRQRNGVPFEVERKVCKECLRLLDETPLKRATAA |
| Ga0209802_100330412 | 3300026328 | Soil | MSLTRAHKHTAVTVRAIRQRNGVPFEVERQVCKDCRRLLDEKPVRRAVTS |
| Ga0209267_10599382 | 3300026331 | Soil | MTLRRHKHTAITIHAIRQRAGVPYHVERKVCANCQRLLEEKTIKRAAA |
| Ga0209808_10831122 | 3300026523 | Soil | MTLKRIHKHNAVTVHAIRQRAGVPYHVERSVCSSCRRLLDEKTIKRAAA |
| Ga0209807_11778002 | 3300026530 | Soil | MTLMRRHKHNTVTVHAIRQRAGVPYHVERKVCSSCSRLLDERTIKRAAA |
| Ga0209160_10304771 | 3300026532 | Soil | KHTAVTVRAIRQRNGVPFEVERQVCKDCRRLLDEKPVRRAVTS |
| Ga0209058_11557211 | 3300026536 | Soil | MTLRRHKHTAVTIHAIRQRAGVPYHVERKICSNCQRLLEEKTIKRAAA |
| Ga0209474_101562602 | 3300026550 | Soil | GRLTTLRRPMTLRRHKHTAVTIHAIRQRAGVPYHVERKICSNCQRLLEEKTIKRAAA |
| Ga0209577_100355862 | 3300026552 | Soil | MTLKRHKHNAVTVHAIRQRAGVPYHVERQVCSSCRRLLDEKTIKRAAA |
| Ga0209577_104681222 | 3300026552 | Soil | FVTTVRRIRLRTMNVKDIHKHTAVTVHTLGQRSGVPYEVERTVCSDCRRLLDEKPLRRAA |
| Ga0209842_10510802 | 3300027379 | Groundwater Sand | LTLKRPHKHTTITIHAIRQRAGVPYHVERKVCSNCSRLLDEKTIKRATA |
| Ga0209220_11084492 | 3300027587 | Forest Soil | MTLRRHKHTAVTVHAIRQRAGVPYHVERKVCSNCRRLLEEKTLKRAAA |
| Ga0268264_101286894 | 3300028381 | Switchgrass Rhizosphere | MTLMRKHKHTAVTVHALRQRHGVPYHVERKVCSDCKRLLDEK |
| Ga0268264_103149863 | 3300028381 | Switchgrass Rhizosphere | VRDTEMTLMRKHKHTAVTVHALRQRHGVPYHVERKVCSDCKRLLDEKFIKRAAA |
| Ga0137415_102193961 | 3300028536 | Vadose Zone Soil | MTLRRHKHTAITIHAIRQRAGVPYHVERKVCSNCSRLLEEKTIKRAAA |
| Ga0307321_10169251 | 3300028704 | Soil | RLITVRDTEMTLMRKHKHTAVTVHALRQRHGVPYHVERKVCSNCKRLLDEKFIKRAAA |
| Ga0307276_100097423 | 3300028705 | Soil | MTLKRHKHSAVTIHAIRQRAGVPYHVERQVCSGCRRLLDEKTLKRAAA |
| Ga0307291_10805121 | 3300028707 | Soil | DIEMTLMRRHKHTAVTVHALRQRHGVPYHVERKVCSNCQRLLDEKFIKRAAA |
| Ga0307291_11476401 | 3300028707 | Soil | MTLRRHKHTAITVHAIRQHAGVPYHVERKVCSNCRRLLEEKTIKRAAA |
| Ga0307279_100016631 | 3300028709 | Soil | MTLRRHKHTAITVHALRQRAGVPYHVERKVCANCKRLLEEKTIKRAAA |
| Ga0307293_102654001 | 3300028711 | Soil | AVTVHALRQRHGVPYHVERKVCSNCKRLLDEKFIKRAAA |
| Ga0307303_101064451 | 3300028713 | Soil | MTLKRHKHDAVTVHAIRQRAGVPYHVERKVCSRCSRLLDEKTLKRAAA |
| Ga0307303_101552041 | 3300028713 | Soil | MTLRRHKHTAITVHALRQRAGVPYHVERKVCANCKRLLEEKTIK |
| Ga0307311_100003501 | 3300028716 | Soil | HNAVTVHALRQRHGVPYHVERKVCSNCQRLLDEKFIKRAAA |
| Ga0307311_101031311 | 3300028716 | Soil | MTLKRPHKHTAVTIHAIRQRAGVPYHVERRVCSNCQRLLDEKTI |
| Ga0307298_102738352 | 3300028717 | Soil | LMRKHKHTAVTVHALRQRHGVPYHVERKVCSNCKRLLDEKFIKRAAA |
| Ga0307301_101765391 | 3300028719 | Soil | HKHTAITVHAIRQRAGVPYHVERKVCSNCRRLLEEKTIKRAAA |
| Ga0307301_103236631 | 3300028719 | Soil | VLLLWTGRMTLKRPHKHTAVTIHAIRQRAGVPYHVERRVCSNCQRLLDEKTIKRAAA |
| Ga0307317_100008673 | 3300028720 | Soil | MTLMRRHKHTAVTVHALRQRHGVPYHVERKVCSNCQRLLDEKFIKRAAA |
| Ga0307319_101662122 | 3300028722 | Soil | MTLRRHKHTAVTIHAIPQRSGVPYHVERKVCSNCSRLLEEKTIRRAAA |
| Ga0307319_101764481 | 3300028722 | Soil | HTAITVHAIRQRAGVPYHVERKVCSNCKRLLEEKTIKRAAA |
| Ga0307319_103059142 | 3300028722 | Soil | MALNVKRRHKHTAVTVHALRQRAGVPYHVERKVCSDCSRLLGERTIKRAAT |
| Ga0307318_101319701 | 3300028744 | Soil | EMTLMRRHKHTAVTVHALRQRHGVPYHVERKVCSNCQRLLDEKFIKRAAA |
| Ga0307316_104079601 | 3300028755 | Soil | MTLKRHKHSSVTVHAIRQRAGVPYHVERQVCSRCRRLLDEK |
| Ga0307320_103990171 | 3300028771 | Soil | MTLKRPHRHKSVTVHAIRQHAGVPYHVERKVCSNCSKTLGETTIKRAAA |
| Ga0307290_100111171 | 3300028791 | Soil | MTLMRKHKHTAVTVHALRQRHGVPYHVERKVCSNC |
| Ga0307290_100668782 | 3300028791 | Soil | HTAITIHAIRQRAGVPYHVERKVCSNCSRLLEEKTLKRAAA |
| Ga0307290_101656632 | 3300028791 | Soil | MTLRRHKHTAITIHAIRQRAGVPYHVERKVCSNCS |
| Ga0307290_101733982 | 3300028791 | Soil | MTLKRHKHSSVTVHAIRQRAGVPYHVERQVCSRCRLLLDEKT |
| Ga0307299_101961142 | 3300028793 | Soil | MTLKRHKHSSVTVHAIRQRAGVPYHVERQVCSHCRQLLDEK |
| Ga0307284_102315731 | 3300028799 | Soil | MTLKRHKHDAVTVHAIRQRGGVPYHVERKVCSGCKRLLDEK |
| Ga0307503_103757511 | 3300028802 | Soil | MTLRRHKHTAITVHAIRQQAGVPYHVERKVCSNCRRLLEEKTLKRAAA |
| Ga0307292_100013421 | 3300028811 | Soil | KHTAVTVHALRQRHGVPYHVERKVCSNCQRLLDEKFIKRAAA |
| Ga0307296_105346471 | 3300028819 | Soil | MTLRRHKHTAITVHAIRQRAGVPYHVERKVCSNCRRL |
| Ga0307310_102116072 | 3300028824 | Soil | KHTAITVHAIRQRAGVPYHVERKVCSNCKRLLEEKTIKRAAA |
| Ga0307312_108534571 | 3300028828 | Soil | HAIRQRAGVPYHVERKVCSNCRRLLEEKTIKRAAA |
| Ga0307314_101339131 | 3300028872 | Soil | MTLRRHKHTAITVHAIRQRAGVPYHVERKVCSNCRRLL |
| Ga0307278_100190202 | 3300028878 | Soil | MTLKRHKHSSVTVHAIRQRGGVPYHVERQVCSRCRRLLDEKTIKRAAA |
| Ga0307278_105322902 | 3300028878 | Soil | MALNVKRRHKHTAVTVHAIRQRAGVPYHVERKVCSDCSRLLSERTIKRAAA |
| Ga0307300_103091891 | 3300028880 | Soil | HIAITVHAIRQRAGVPYHVERKVCSNCKRLLEEKTIKRAAA |
| Ga0307308_103139122 | 3300028884 | Soil | KHTAITVHAIRQRAGVPYHVERKVCSNCRRLLEEKTIKRAAA |
| Ga0307308_104570922 | 3300028884 | Soil | MTLKRHKHTAVTIHAIRQRAGVPYHVERQVCSSCRRVIDEKTIKRAAA |
| Ga0307497_101401732 | 3300031226 | Soil | MTLMRRHKHTAVTVHALRQRHGVPYHVERQVCSNCKRLLDEKFIKRAAA |
| Ga0170824_1151840201 | 3300031231 | Forest Soil | EMTLMRKHKHTAVTVHALQQRHGVPYHVERKVCSNCKRLLDEKFIKRAAA |
| Ga0310813_116636232 | 3300031716 | Soil | MTLKRHKHNAVTIHAIRQRAGVPYHVERKVCSRCQKMLDEKTLKRAAA |
| Ga0307469_106049662 | 3300031720 | Hardwood Forest Soil | MTLRRHKHNAITVHAIRQRAGVPYHVERKICSNCRRLLDEKTIRRAAA |
| Ga0307469_112110622 | 3300031720 | Hardwood Forest Soil | MTLMRRHKHTAVTVHALRQRHGVPYHVERKVCSDCKRLLDEKFIKRAAA |
| Ga0308175_1016599172 | 3300031938 | Soil | MTLKRHKHNAVTIHAIRQRAGVPYHVERKVCAHCQRLLDEKTLRRAAA |
| Ga0308175_1029321482 | 3300031938 | Soil | MTLKRHKHSTVTVHAIRQRAGVPYHVERKVCASCQRLLDEKTL |
| Ga0307471_1016060892 | 3300032180 | Hardwood Forest Soil | VKRAHKHTAVTTRAIRQRNGVPFEVERKICRECRRLLDEKPLKRVPA |
| Ga0307472_1006951801 | 3300032205 | Hardwood Forest Soil | MTLMRRHKHTAVTVHALRQRHGVPYHVERKVCSNCKRLLDEKFIKRA |
| ⦗Top⦘ |