| Basic Information | |
|---|---|
| Family ID | F006744 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 365 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MNLDEFKKHVLATREASKAEALSVLSATITTSTNERENLNG |
| Number of Associated Samples | 203 |
| Number of Associated Scaffolds | 364 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 85.95 % |
| % of genes near scaffold ends (potentially truncated) | 16.71 % |
| % of genes from short scaffolds (< 2000 bps) | 70.41 % |
| Associated GOLD sequencing projects | 181 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (43.562 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (16.712 % of family members) |
| Environment Ontology (ENVO) | Unclassified (46.849 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (63.562 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.62% β-sheet: 0.00% Coil/Unstructured: 46.38% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 364 Family Scaffolds |
|---|---|---|
| PF06067 | DUF932 | 7.69 |
| PF01464 | SLT | 1.10 |
| PF03567 | Sulfotransfer_2 | 0.82 |
| PF13578 | Methyltransf_24 | 0.55 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.55 |
| PF01844 | HNH | 0.27 |
| PF05257 | CHAP | 0.27 |
| PF05711 | TylF | 0.27 |
| PF00685 | Sulfotransfer_1 | 0.27 |
| PF01755 | Glyco_transf_25 | 0.27 |
| PF12804 | NTP_transf_3 | 0.27 |
| PF14279 | HNH_5 | 0.27 |
| PF00011 | HSP20 | 0.27 |
| PF04577 | Glyco_transf_61 | 0.27 |
| PF00041 | fn3 | 0.27 |
| PF04860 | Phage_portal | 0.27 |
| PF02945 | Endonuclease_7 | 0.27 |
| PF09834 | DUF2061 | 0.27 |
| PF00534 | Glycos_transf_1 | 0.27 |
| PF13203 | DUF2201_N | 0.27 |
| PF08007 | JmjC_2 | 0.27 |
| COG ID | Name | Functional Category | % Frequency in 364 Family Scaffolds |
|---|---|---|---|
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.27 |
| COG2850 | Ribosomal protein L16 Arg81 hydroxylase, contains JmjC domain | Translation, ribosomal structure and biogenesis [J] | 0.27 |
| COG3306 | Glycosyltransferase involved in LPS biosynthesis, GR25 family | Cell wall/membrane/envelope biogenesis [M] | 0.27 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 63.01 % |
| Unclassified | root | N/A | 36.99 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559019|stn_contig02957 | Not Available | 795 | Open in IMG/M |
| 3300000756|JGI12421J11937_10002483 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7424 | Open in IMG/M |
| 3300000756|JGI12421J11937_10094980 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 827 | Open in IMG/M |
| 3300000756|JGI12421J11937_10125901 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 662 | Open in IMG/M |
| 3300000882|FwDRAFT_10005955 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1490 | Open in IMG/M |
| 3300000929|NpDRAFT_10053611 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 2792 | Open in IMG/M |
| 3300001844|RCM35_1013144 | All Organisms → Viruses → Predicted Viral | 1027 | Open in IMG/M |
| 3300001850|RCM37_1268320 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 837 | Open in IMG/M |
| 3300002161|JGI24766J26685_10002305 | Not Available | 5663 | Open in IMG/M |
| 3300002203|metazooDRAFT_1307052 | Not Available | 802 | Open in IMG/M |
| 3300002307|JGI24890J29729_1001481 | Not Available | 10487 | Open in IMG/M |
| 3300002835|B570J40625_100013477 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 14526 | Open in IMG/M |
| 3300002835|B570J40625_100033440 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7959 | Open in IMG/M |
| 3300003277|JGI25908J49247_10016387 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 2251 | Open in IMG/M |
| 3300003277|JGI25908J49247_10169265 | Not Available | 506 | Open in IMG/M |
| 3300003388|JGI25910J50241_10040664 | All Organisms → Viruses → Predicted Viral | 1507 | Open in IMG/M |
| 3300003393|JGI25909J50240_1021315 | All Organisms → Viruses → Predicted Viral | 1489 | Open in IMG/M |
| 3300003413|JGI25922J50271_10000566 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 10826 | Open in IMG/M |
| 3300003413|JGI25922J50271_10062938 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 815 | Open in IMG/M |
| 3300003429|JGI25914J50564_10059085 | All Organisms → Viruses → Predicted Viral | 1012 | Open in IMG/M |
| 3300003429|JGI25914J50564_10123901 | Not Available | 630 | Open in IMG/M |
| 3300003430|JGI25921J50272_10005554 | Not Available | 3947 | Open in IMG/M |
| 3300003430|JGI25921J50272_10010002 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 2816 | Open in IMG/M |
| 3300003430|JGI25921J50272_10053874 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 908 | Open in IMG/M |
| 3300003490|JGI25926J51410_1026135 | All Organisms → Viruses → Predicted Viral | 1108 | Open in IMG/M |
| 3300003490|JGI25926J51410_1069995 | Not Available | 582 | Open in IMG/M |
| 3300003493|JGI25923J51411_1027983 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1102 | Open in IMG/M |
| 3300003815|Ga0007856_1003746 | Not Available | 1227 | Open in IMG/M |
| 3300004124|Ga0066178_10195535 | Not Available | 579 | Open in IMG/M |
| 3300004460|Ga0066222_1258765 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 716 | Open in IMG/M |
| 3300004460|Ga0066222_1458556 | Not Available | 657 | Open in IMG/M |
| 3300004792|Ga0007761_11176618 | Not Available | 876 | Open in IMG/M |
| 3300004792|Ga0007761_11243791 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 513 | Open in IMG/M |
| 3300004793|Ga0007760_11449063 | All Organisms → Viruses → Predicted Viral | 1468 | Open in IMG/M |
| 3300005069|Ga0071350_1045285 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1672 | Open in IMG/M |
| 3300005517|Ga0070374_10046874 | All Organisms → Viruses → Predicted Viral | 2247 | Open in IMG/M |
| 3300005517|Ga0070374_10126165 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1331 | Open in IMG/M |
| 3300005517|Ga0070374_10276553 | Not Available | 855 | Open in IMG/M |
| 3300005517|Ga0070374_10376193 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 715 | Open in IMG/M |
| 3300005517|Ga0070374_10394981 | Not Available | 695 | Open in IMG/M |
| 3300005527|Ga0068876_10088948 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1849 | Open in IMG/M |
| 3300005527|Ga0068876_10249446 | All Organisms → Viruses → Predicted Viral | 1018 | Open in IMG/M |
| 3300005527|Ga0068876_10442172 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 720 | Open in IMG/M |
| 3300005528|Ga0068872_10128712 | Not Available | 1491 | Open in IMG/M |
| 3300005580|Ga0049083_10255583 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 589 | Open in IMG/M |
| 3300005581|Ga0049081_10216861 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 681 | Open in IMG/M |
| 3300005581|Ga0049081_10328007 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 523 | Open in IMG/M |
| 3300005582|Ga0049080_10117854 | Not Available | 898 | Open in IMG/M |
| 3300005582|Ga0049080_10225504 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 615 | Open in IMG/M |
| 3300005583|Ga0049085_10101550 | Not Available | 992 | Open in IMG/M |
| 3300005583|Ga0049085_10117790 | Not Available | 908 | Open in IMG/M |
| 3300005584|Ga0049082_10000092 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 20339 | Open in IMG/M |
| 3300005662|Ga0078894_10091940 | All Organisms → Viruses → Predicted Viral | 2663 | Open in IMG/M |
| 3300005662|Ga0078894_10304900 | All Organisms → Viruses → Predicted Viral | 1444 | Open in IMG/M |
| 3300005662|Ga0078894_10318421 | Not Available | 1410 | Open in IMG/M |
| 3300005662|Ga0078894_10736440 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 867 | Open in IMG/M |
| 3300005662|Ga0078894_10909887 | Not Available | 762 | Open in IMG/M |
| 3300005662|Ga0078894_10913493 | Not Available | 761 | Open in IMG/M |
| 3300005662|Ga0078894_10918164 | Not Available | 758 | Open in IMG/M |
| 3300005662|Ga0078894_11349978 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 597 | Open in IMG/M |
| 3300005662|Ga0078894_11467799 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 567 | Open in IMG/M |
| 3300005662|Ga0078894_11510025 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
| 3300005662|Ga0078894_11685794 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
| 3300005662|Ga0078894_11686605 | Not Available | 520 | Open in IMG/M |
| 3300005662|Ga0078894_11734840 | Not Available | 511 | Open in IMG/M |
| 3300005662|Ga0078894_11785327 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
| 3300005805|Ga0079957_1019106 | Not Available | 4845 | Open in IMG/M |
| 3300005941|Ga0070743_10003710 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5595 | Open in IMG/M |
| 3300005941|Ga0070743_10012584 | Not Available | 2976 | Open in IMG/M |
| 3300005941|Ga0070743_10037213 | All Organisms → Viruses → Predicted Viral | 1670 | Open in IMG/M |
| 3300005941|Ga0070743_10100981 | Not Available | 970 | Open in IMG/M |
| 3300006484|Ga0070744_10019561 | Not Available | 2011 | Open in IMG/M |
| 3300006484|Ga0070744_10141407 | Not Available | 691 | Open in IMG/M |
| 3300006484|Ga0070744_10242970 | Not Available | 510 | Open in IMG/M |
| 3300006639|Ga0079301_1005843 | All Organisms → Viruses → Predicted Viral | 4969 | Open in IMG/M |
| 3300006641|Ga0075471_10207787 | All Organisms → Viruses → Predicted Viral | 1018 | Open in IMG/M |
| 3300006875|Ga0075473_10085625 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1242 | Open in IMG/M |
| 3300007216|Ga0103961_1093383 | All Organisms → Viruses → Predicted Viral | 2213 | Open in IMG/M |
| 3300007545|Ga0102873_1112086 | Not Available | 824 | Open in IMG/M |
| 3300007546|Ga0102874_1041057 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1502 | Open in IMG/M |
| 3300007546|Ga0102874_1180149 | Not Available | 651 | Open in IMG/M |
| 3300007547|Ga0102875_1083196 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1030 | Open in IMG/M |
| 3300007548|Ga0102877_1124649 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 731 | Open in IMG/M |
| 3300007550|Ga0102880_1146918 | Not Available | 617 | Open in IMG/M |
| 3300007555|Ga0102817_1060773 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 824 | Open in IMG/M |
| 3300007561|Ga0102914_1185626 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 640 | Open in IMG/M |
| 3300007590|Ga0102917_1141616 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 845 | Open in IMG/M |
| 3300007603|Ga0102921_1179622 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 763 | Open in IMG/M |
| 3300007606|Ga0102923_1154195 | Not Available | 717 | Open in IMG/M |
| 3300007620|Ga0102871_1085752 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 908 | Open in IMG/M |
| 3300007622|Ga0102863_1192242 | Not Available | 600 | Open in IMG/M |
| 3300007639|Ga0102865_1216193 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 571 | Open in IMG/M |
| 3300007642|Ga0102876_1111008 | Not Available | 740 | Open in IMG/M |
| 3300007644|Ga0102902_1101181 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 861 | Open in IMG/M |
| 3300007644|Ga0102902_1246624 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 525 | Open in IMG/M |
| 3300007665|Ga0102908_1004019 | Not Available | 2817 | Open in IMG/M |
| 3300007692|Ga0102823_1023720 | All Organisms → Viruses → Predicted Viral | 1688 | Open in IMG/M |
| 3300007706|Ga0102899_1072010 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 832 | Open in IMG/M |
| 3300007706|Ga0102899_1072010 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 832 | Open in IMG/M |
| 3300007708|Ga0102859_1224972 | Not Available | 560 | Open in IMG/M |
| 3300007716|Ga0102867_1054822 | All Organisms → Viruses → Predicted Viral | 1049 | Open in IMG/M |
| 3300007861|Ga0105736_1079296 | Not Available | 692 | Open in IMG/M |
| 3300007954|Ga0105739_1090782 | Not Available | 693 | Open in IMG/M |
| 3300007973|Ga0105746_1298091 | Not Available | 559 | Open in IMG/M |
| 3300008021|Ga0102922_1181466 | Not Available | 663 | Open in IMG/M |
| 3300008055|Ga0108970_10143309 | Not Available | 1816 | Open in IMG/M |
| 3300008055|Ga0108970_10744538 | Not Available | 620 | Open in IMG/M |
| 3300008107|Ga0114340_1000057 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 96832 | Open in IMG/M |
| 3300008107|Ga0114340_1001257 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 25585 | Open in IMG/M |
| 3300008107|Ga0114340_1009071 | Not Available | 5031 | Open in IMG/M |
| 3300008107|Ga0114340_1012540 | Not Available | 4736 | Open in IMG/M |
| 3300008107|Ga0114340_1013115 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4047 | Open in IMG/M |
| 3300008107|Ga0114340_1014866 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 3744 | Open in IMG/M |
| 3300008107|Ga0114340_1016805 | All Organisms → Viruses → Predicted Viral | 3490 | Open in IMG/M |
| 3300008107|Ga0114340_1020571 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5120 | Open in IMG/M |
| 3300008107|Ga0114340_1063927 | Not Available | 1570 | Open in IMG/M |
| 3300008107|Ga0114340_1083902 | All Organisms → Viruses → Predicted Viral | 2096 | Open in IMG/M |
| 3300008107|Ga0114340_1102955 | All Organisms → Viruses → Predicted Viral | 2304 | Open in IMG/M |
| 3300008107|Ga0114340_1123377 | Not Available | 999 | Open in IMG/M |
| 3300008107|Ga0114340_1130188 | Not Available | 959 | Open in IMG/M |
| 3300008107|Ga0114340_1163576 | Not Available | 802 | Open in IMG/M |
| 3300008107|Ga0114340_1168453 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 783 | Open in IMG/M |
| 3300008107|Ga0114340_1200419 | Not Available | 670 | Open in IMG/M |
| 3300008108|Ga0114341_10191531 | All Organisms → Viruses → Predicted Viral | 1151 | Open in IMG/M |
| 3300008110|Ga0114343_1040116 | All Organisms → Viruses → Predicted Viral | 3805 | Open in IMG/M |
| 3300008110|Ga0114343_1114728 | Not Available | 911 | Open in IMG/M |
| 3300008111|Ga0114344_1000371 | Not Available | 43404 | Open in IMG/M |
| 3300008111|Ga0114344_1131570 | Not Available | 1458 | Open in IMG/M |
| 3300008111|Ga0114344_1134545 | Not Available | 1457 | Open in IMG/M |
| 3300008113|Ga0114346_1027324 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 11445 | Open in IMG/M |
| 3300008113|Ga0114346_1064060 | Not Available | 1783 | Open in IMG/M |
| 3300008113|Ga0114346_1181144 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 864 | Open in IMG/M |
| 3300008113|Ga0114346_1235712 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 696 | Open in IMG/M |
| 3300008113|Ga0114346_1330968 | Not Available | 507 | Open in IMG/M |
| 3300008114|Ga0114347_1083897 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1268 | Open in IMG/M |
| 3300008261|Ga0114336_1005715 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 17834 | Open in IMG/M |
| 3300008261|Ga0114336_1055146 | Not Available | 2034 | Open in IMG/M |
| 3300008261|Ga0114336_1066599 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2360 | Open in IMG/M |
| 3300008261|Ga0114336_1142118 | All Organisms → Viruses → Predicted Viral | 1074 | Open in IMG/M |
| 3300008261|Ga0114336_1208472 | Not Available | 815 | Open in IMG/M |
| 3300008261|Ga0114336_1251160 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 704 | Open in IMG/M |
| 3300008448|Ga0114876_1081554 | All Organisms → Viruses → Predicted Viral | 1341 | Open in IMG/M |
| 3300008950|Ga0102891_1185858 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
| 3300008953|Ga0104241_1001038 | All Organisms → Viruses → Predicted Viral | 2197 | Open in IMG/M |
| 3300008961|Ga0102887_1037393 | Not Available | 1640 | Open in IMG/M |
| 3300008961|Ga0102887_1096390 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 937 | Open in IMG/M |
| 3300008962|Ga0104242_1002954 | Not Available | 3277 | Open in IMG/M |
| 3300008962|Ga0104242_1023353 | Not Available | 1066 | Open in IMG/M |
| 3300008996|Ga0102831_1295909 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 535 | Open in IMG/M |
| 3300008999|Ga0102816_1104083 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 868 | Open in IMG/M |
| 3300009024|Ga0102811_1060836 | All Organisms → Viruses → Predicted Viral | 1422 | Open in IMG/M |
| 3300009026|Ga0102829_1016262 | Not Available | 2091 | Open in IMG/M |
| 3300009026|Ga0102829_1064862 | All Organisms → Viruses → Predicted Viral | 1109 | Open in IMG/M |
| 3300009049|Ga0102911_1215783 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 540 | Open in IMG/M |
| 3300009057|Ga0102892_1085622 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
| 3300009068|Ga0114973_10036456 | All Organisms → Viruses → Predicted Viral | 2951 | Open in IMG/M |
| 3300009068|Ga0114973_10297699 | Not Available | 860 | Open in IMG/M |
| 3300009151|Ga0114962_10007902 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8051 | Open in IMG/M |
| 3300009152|Ga0114980_10001933 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14816 | Open in IMG/M |
| 3300009152|Ga0114980_10052152 | All Organisms → Viruses → Predicted Viral | 2479 | Open in IMG/M |
| 3300009155|Ga0114968_10420026 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 727 | Open in IMG/M |
| 3300009155|Ga0114968_10565858 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 605 | Open in IMG/M |
| 3300009159|Ga0114978_10288038 | All Organisms → Viruses → Predicted Viral | 1009 | Open in IMG/M |
| 3300009159|Ga0114978_10855072 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 510 | Open in IMG/M |
| 3300009161|Ga0114966_10190495 | All Organisms → Viruses → Predicted Viral | 1306 | Open in IMG/M |
| 3300009164|Ga0114975_10665710 | Not Available | 552 | Open in IMG/M |
| 3300009180|Ga0114979_10147186 | All Organisms → Viruses → Predicted Viral | 1442 | Open in IMG/M |
| 3300009181|Ga0114969_10132381 | All Organisms → Viruses → Predicted Viral | 1581 | Open in IMG/M |
| 3300009181|Ga0114969_10213607 | All Organisms → Viruses → Predicted Viral | 1178 | Open in IMG/M |
| 3300009183|Ga0114974_10589577 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 614 | Open in IMG/M |
| 3300009233|Ga0103856_10066313 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 658 | Open in IMG/M |
| 3300010156|Ga0068873_1036184 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
| 3300010160|Ga0114967_10143678 | All Organisms → Viruses → Predicted Viral | 1333 | Open in IMG/M |
| 3300010312|Ga0102883_1033839 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1533 | Open in IMG/M |
| 3300010312|Ga0102883_1110557 | Not Available | 794 | Open in IMG/M |
| 3300010312|Ga0102883_1143996 | Not Available | 683 | Open in IMG/M |
| 3300010354|Ga0129333_10086079 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2910 | Open in IMG/M |
| 3300010354|Ga0129333_10208410 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1775 | Open in IMG/M |
| 3300010388|Ga0136551_1001113 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7063 | Open in IMG/M |
| 3300010388|Ga0136551_1012870 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1702 | Open in IMG/M |
| 3300011268|Ga0151620_1039987 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1571 | Open in IMG/M |
| 3300012017|Ga0153801_1042686 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 801 | Open in IMG/M |
| 3300012017|Ga0153801_1054335 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 704 | Open in IMG/M |
| 3300012352|Ga0157138_1005196 | All Organisms → Viruses → Predicted Viral | 2191 | Open in IMG/M |
| 3300012663|Ga0157203_1001006 | Not Available | 7304 | Open in IMG/M |
| 3300012663|Ga0157203_1001153 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6659 | Open in IMG/M |
| 3300012663|Ga0157203_1026984 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 817 | Open in IMG/M |
| 3300012665|Ga0157210_1008735 | All Organisms → Viruses → Predicted Viral | 1851 | Open in IMG/M |
| 3300012665|Ga0157210_1039220 | Not Available | 732 | Open in IMG/M |
| 3300012779|Ga0138284_1211279 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 624 | Open in IMG/M |
| 3300012968|Ga0129337_1028801 | All Organisms → Viruses → Predicted Viral | 1574 | Open in IMG/M |
| 3300013004|Ga0164293_10005179 | Not Available | 11106 | Open in IMG/M |
| 3300013006|Ga0164294_10034434 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 4032 | Open in IMG/M |
| 3300013006|Ga0164294_10173301 | All Organisms → Viruses → Predicted Viral | 1545 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10588419 | Not Available | 599 | Open in IMG/M |
| (restricted) 3300013137|Ga0172375_10898635 | Not Available | 536 | Open in IMG/M |
| 3300013286|Ga0136641_1016991 | All Organisms → Viruses → Predicted Viral | 2291 | Open in IMG/M |
| 3300013286|Ga0136641_1061788 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1075 | Open in IMG/M |
| 3300013295|Ga0170791_10230573 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1114 | Open in IMG/M |
| 3300013295|Ga0170791_10897441 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 951 | Open in IMG/M |
| 3300013295|Ga0170791_13733282 | Not Available | 671 | Open in IMG/M |
| 3300013372|Ga0177922_10407124 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 3337 | Open in IMG/M |
| 3300013372|Ga0177922_10976895 | Not Available | 589 | Open in IMG/M |
| 3300014050|Ga0119952_1020912 | All Organisms → Viruses → Predicted Viral | 2190 | Open in IMG/M |
| 3300014050|Ga0119952_1064287 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 945 | Open in IMG/M |
| 3300014050|Ga0119952_1147119 | Not Available | 505 | Open in IMG/M |
| 3300017785|Ga0181355_1208299 | Not Available | 765 | Open in IMG/M |
| 3300017788|Ga0169931_10813284 | Not Available | 599 | Open in IMG/M |
| 3300019784|Ga0181359_1027099 | All Organisms → Viruses → Predicted Viral | 2201 | Open in IMG/M |
| 3300019784|Ga0181359_1036869 | All Organisms → Viruses → Predicted Viral | 1895 | Open in IMG/M |
| 3300019784|Ga0181359_1081269 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1214 | Open in IMG/M |
| 3300019784|Ga0181359_1156804 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 775 | Open in IMG/M |
| 3300020151|Ga0211736_10227362 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 729 | Open in IMG/M |
| 3300020151|Ga0211736_10554409 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 812 | Open in IMG/M |
| 3300020159|Ga0211734_10326470 | All Organisms → Viruses → Predicted Viral | 3113 | Open in IMG/M |
| 3300020160|Ga0211733_11122769 | All Organisms → Viruses → Predicted Viral | 1164 | Open in IMG/M |
| 3300020483|Ga0207418_100326 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8933 | Open in IMG/M |
| 3300020498|Ga0208050_1018861 | Not Available | 724 | Open in IMG/M |
| 3300020526|Ga0208085_1022266 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 875 | Open in IMG/M |
| 3300020572|Ga0207909_1047134 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 680 | Open in IMG/M |
| 3300021070|Ga0194056_10117475 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 954 | Open in IMG/M |
| 3300021131|Ga0214206_1002040 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4385 | Open in IMG/M |
| 3300021131|Ga0214206_1040326 | Not Available | 516 | Open in IMG/M |
| 3300021438|Ga0213920_1001123 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15966 | Open in IMG/M |
| 3300021519|Ga0194048_10002662 | Not Available | 8831 | Open in IMG/M |
| 3300021519|Ga0194048_10042301 | All Organisms → Viruses → Predicted Viral | 1868 | Open in IMG/M |
| 3300021956|Ga0213922_1036673 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1145 | Open in IMG/M |
| 3300021961|Ga0222714_10011850 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7362 | Open in IMG/M |
| 3300021961|Ga0222714_10018495 | Not Available | 5534 | Open in IMG/M |
| 3300021962|Ga0222713_10032004 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Gaiavirus → Mycobacterium virus Gaia | 4227 | Open in IMG/M |
| 3300021962|Ga0222713_10045543 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 3395 | Open in IMG/M |
| 3300021962|Ga0222713_10074056 | All Organisms → Viruses → Predicted Viral | 2506 | Open in IMG/M |
| 3300021962|Ga0222713_10112550 | All Organisms → Viruses → Predicted Viral | 1931 | Open in IMG/M |
| 3300021962|Ga0222713_10289253 | All Organisms → Viruses → Predicted Viral | 1049 | Open in IMG/M |
| 3300021962|Ga0222713_10390348 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 859 | Open in IMG/M |
| 3300021963|Ga0222712_10296012 | All Organisms → Viruses → Predicted Viral | 1016 | Open in IMG/M |
| 3300021963|Ga0222712_10434551 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 790 | Open in IMG/M |
| 3300022407|Ga0181351_1130722 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 929 | Open in IMG/M |
| 3300022407|Ga0181351_1224476 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 607 | Open in IMG/M |
| 3300022748|Ga0228702_1084935 | Not Available | 770 | Open in IMG/M |
| 3300022752|Ga0214917_10006047 | Not Available | 12715 | Open in IMG/M |
| 3300023174|Ga0214921_10001139 | Not Available | 46199 | Open in IMG/M |
| 3300023174|Ga0214921_10011400 | Not Available | 10810 | Open in IMG/M |
| 3300023174|Ga0214921_10014579 | Not Available | 9086 | Open in IMG/M |
| 3300023174|Ga0214921_10018591 | Not Available | 7604 | Open in IMG/M |
| 3300023174|Ga0214921_10033004 | Not Available | 5006 | Open in IMG/M |
| 3300023174|Ga0214921_10073285 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 2773 | Open in IMG/M |
| 3300023174|Ga0214921_10137338 | All Organisms → Viruses → Predicted Viral | 1702 | Open in IMG/M |
| 3300023174|Ga0214921_10142691 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1652 | Open in IMG/M |
| 3300023174|Ga0214921_10217847 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1166 | Open in IMG/M |
| 3300023174|Ga0214921_10268030 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 983 | Open in IMG/M |
| 3300023174|Ga0214921_10320075 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 848 | Open in IMG/M |
| 3300023174|Ga0214921_10469859 | Not Available | 611 | Open in IMG/M |
| 3300024289|Ga0255147_1000020 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 112301 | Open in IMG/M |
| 3300024289|Ga0255147_1000810 | Not Available | 8151 | Open in IMG/M |
| 3300024289|Ga0255147_1025468 | All Organisms → Viruses → Predicted Viral | 1221 | Open in IMG/M |
| 3300024306|Ga0255148_1046685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 773 | Open in IMG/M |
| 3300024343|Ga0244777_10000910 | Not Available | 22200 | Open in IMG/M |
| 3300024343|Ga0244777_10002138 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 13731 | Open in IMG/M |
| 3300024343|Ga0244777_10019933 | Not Available | 4233 | Open in IMG/M |
| 3300024343|Ga0244777_10298739 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1017 | Open in IMG/M |
| 3300024343|Ga0244777_10394748 | Not Available | 862 | Open in IMG/M |
| 3300024343|Ga0244777_10398425 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 857 | Open in IMG/M |
| 3300024343|Ga0244777_10690188 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 612 | Open in IMG/M |
| 3300024346|Ga0244775_10018903 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6325 | Open in IMG/M |
| 3300024346|Ga0244775_10044152 | All Organisms → Viruses → Predicted Viral | 3911 | Open in IMG/M |
| 3300024346|Ga0244775_10048054 | All Organisms → Viruses → Predicted Viral | 3726 | Open in IMG/M |
| 3300024346|Ga0244775_10237207 | All Organisms → Viruses → Predicted Viral | 1523 | Open in IMG/M |
| 3300024346|Ga0244775_10357210 | All Organisms → Viruses → Predicted Viral | 1205 | Open in IMG/M |
| 3300024346|Ga0244775_10637717 | Not Available | 862 | Open in IMG/M |
| 3300024346|Ga0244775_10687773 | Not Available | 825 | Open in IMG/M |
| 3300024346|Ga0244775_11348219 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 550 | Open in IMG/M |
| 3300024346|Ga0244775_11432007 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 530 | Open in IMG/M |
| 3300024346|Ga0244775_11445530 | Not Available | 527 | Open in IMG/M |
| 3300024346|Ga0244775_11536102 | Not Available | 508 | Open in IMG/M |
| 3300024348|Ga0244776_10020650 | Not Available | 5434 | Open in IMG/M |
| 3300024348|Ga0244776_10150631 | All Organisms → Viruses → Predicted Viral | 1694 | Open in IMG/M |
| 3300024348|Ga0244776_10183334 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1502 | Open in IMG/M |
| 3300024348|Ga0244776_10249434 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1236 | Open in IMG/M |
| 3300024483|Ga0255224_1084125 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 663 | Open in IMG/M |
| 3300024484|Ga0256332_1108548 | Not Available | 593 | Open in IMG/M |
| 3300025635|Ga0208147_1000705 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 11345 | Open in IMG/M |
| 3300025732|Ga0208784_1061048 | All Organisms → Viruses → Predicted Viral | 1150 | Open in IMG/M |
| 3300026435|Ga0256297_1048629 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 664 | Open in IMG/M |
| 3300026455|Ga0255155_1065336 | Not Available | 602 | Open in IMG/M |
| 3300027084|Ga0208443_1037824 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1050 | Open in IMG/M |
| 3300027138|Ga0255064_1006223 | Not Available | 2240 | Open in IMG/M |
| 3300027193|Ga0208800_1047110 | Not Available | 585 | Open in IMG/M |
| 3300027222|Ga0208024_1001997 | Not Available | 4481 | Open in IMG/M |
| 3300027222|Ga0208024_1015335 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1563 | Open in IMG/M |
| 3300027242|Ga0208806_1018880 | All Organisms → Viruses → Predicted Viral | 1454 | Open in IMG/M |
| 3300027244|Ga0208173_1039267 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 882 | Open in IMG/M |
| 3300027314|Ga0208811_1076265 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 709 | Open in IMG/M |
| 3300027468|Ga0209247_1018244 | Not Available | 948 | Open in IMG/M |
| 3300027468|Ga0209247_1026805 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 798 | Open in IMG/M |
| 3300027503|Ga0255182_1036228 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1353 | Open in IMG/M |
| 3300027531|Ga0208682_1053561 | All Organisms → Viruses → Predicted Viral | 1033 | Open in IMG/M |
| 3300027563|Ga0209552_1180621 | Not Available | 532 | Open in IMG/M |
| 3300027571|Ga0208897_1182572 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 510 | Open in IMG/M |
| 3300027581|Ga0209651_1125357 | Not Available | 709 | Open in IMG/M |
| 3300027608|Ga0208974_1079632 | Not Available | 898 | Open in IMG/M |
| 3300027608|Ga0208974_1173606 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
| 3300027627|Ga0208942_1115959 | Not Available | 748 | Open in IMG/M |
| 3300027631|Ga0208133_1051931 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 990 | Open in IMG/M |
| 3300027656|Ga0209357_1100447 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 820 | Open in IMG/M |
| 3300027689|Ga0209551_1212762 | Not Available | 589 | Open in IMG/M |
| 3300027710|Ga0209599_10000780 | Not Available | 18129 | Open in IMG/M |
| 3300027710|Ga0209599_10005440 | All Organisms → Viruses → Predicted Viral | 4428 | Open in IMG/M |
| 3300027710|Ga0209599_10204900 | Not Available | 533 | Open in IMG/M |
| 3300027720|Ga0209617_10027723 | All Organisms → Viruses → Predicted Viral | 2459 | Open in IMG/M |
| 3300027733|Ga0209297_1000564 | Not Available | 23317 | Open in IMG/M |
| 3300027733|Ga0209297_1050693 | All Organisms → Viruses → Predicted Viral | 1876 | Open in IMG/M |
| 3300027736|Ga0209190_1006147 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7587 | Open in IMG/M |
| 3300027741|Ga0209085_1347274 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 550 | Open in IMG/M |
| 3300027749|Ga0209084_1013574 | All Organisms → Viruses → Predicted Viral | 4724 | Open in IMG/M |
| 3300027754|Ga0209596_1001217 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 22549 | Open in IMG/M |
| 3300027754|Ga0209596_1136233 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1108 | Open in IMG/M |
| 3300027759|Ga0209296_1373420 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
| 3300027760|Ga0209598_10171620 | Not Available | 942 | Open in IMG/M |
| 3300027763|Ga0209088_10275376 | Not Available | 690 | Open in IMG/M |
| 3300027769|Ga0209770_10000016 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 113800 | Open in IMG/M |
| 3300027769|Ga0209770_10025402 | Not Available | 2591 | Open in IMG/M |
| 3300027782|Ga0209500_10016490 | All Organisms → Viruses → Predicted Viral | 4391 | Open in IMG/M |
| 3300027782|Ga0209500_10412587 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 540 | Open in IMG/M |
| 3300027797|Ga0209107_10284032 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 784 | Open in IMG/M |
| 3300027804|Ga0209358_10338355 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 728 | Open in IMG/M |
| 3300027804|Ga0209358_10453257 | Not Available | 593 | Open in IMG/M |
| 3300027805|Ga0209229_10000176 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 24904 | Open in IMG/M |
| 3300027805|Ga0209229_10006425 | Not Available | 4909 | Open in IMG/M |
| 3300027805|Ga0209229_10013125 | All Organisms → Viruses → Predicted Viral | 3524 | Open in IMG/M |
| 3300027805|Ga0209229_10111494 | Not Available | 1233 | Open in IMG/M |
| 3300027805|Ga0209229_10284075 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 732 | Open in IMG/M |
| 3300027805|Ga0209229_10343495 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 653 | Open in IMG/M |
| 3300027892|Ga0209550_10126007 | All Organisms → Viruses → Predicted Viral | 1867 | Open in IMG/M |
| 3300027892|Ga0209550_10571344 | Not Available | 668 | Open in IMG/M |
| 3300027963|Ga0209400_1005322 | Not Available | 8870 | Open in IMG/M |
| 3300027963|Ga0209400_1306958 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 605 | Open in IMG/M |
| 3300027963|Ga0209400_1377334 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
| 3300027971|Ga0209401_1072263 | All Organisms → Viruses → Predicted Viral | 1491 | Open in IMG/M |
| 3300027973|Ga0209298_10001557 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14823 | Open in IMG/M |
| 3300028025|Ga0247723_1000074 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 58778 | Open in IMG/M |
| 3300029930|Ga0119944_1001017 | Not Available | 5035 | Open in IMG/M |
| 3300031758|Ga0315907_10003962 | Not Available | 16938 | Open in IMG/M |
| 3300031758|Ga0315907_10230980 | Not Available | 1540 | Open in IMG/M |
| 3300031784|Ga0315899_10178088 | Not Available | 2155 | Open in IMG/M |
| 3300031784|Ga0315899_10369763 | Not Available | 1401 | Open in IMG/M |
| 3300031784|Ga0315899_10394173 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1348 | Open in IMG/M |
| 3300031857|Ga0315909_10017800 | Not Available | 7246 | Open in IMG/M |
| 3300031857|Ga0315909_10537488 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 797 | Open in IMG/M |
| 3300031857|Ga0315909_10613159 | Not Available | 724 | Open in IMG/M |
| 3300031963|Ga0315901_10160222 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1994 | Open in IMG/M |
| 3300032092|Ga0315905_10003501 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16187 | Open in IMG/M |
| 3300033521|Ga0316616_100513916 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1377 | Open in IMG/M |
| 3300033992|Ga0334992_0038822 | Not Available | 2781 | Open in IMG/M |
| 3300034066|Ga0335019_0607307 | Not Available | 640 | Open in IMG/M |
| 3300034073|Ga0310130_0087073 | Not Available | 935 | Open in IMG/M |
| 3300034093|Ga0335012_0126875 | All Organisms → Viruses → Predicted Viral | 1408 | Open in IMG/M |
| 3300034102|Ga0335029_0126353 | All Organisms → Viruses → Predicted Viral | 1775 | Open in IMG/M |
| 3300034102|Ga0335029_0620513 | Not Available | 602 | Open in IMG/M |
| 3300034122|Ga0335060_0597180 | Not Available | 556 | Open in IMG/M |
| 3300034166|Ga0335016_0395974 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 808 | Open in IMG/M |
| 3300034280|Ga0334997_0609836 | Not Available | 672 | Open in IMG/M |
| 3300034523|Ga0310143_00917 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 11783 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 16.71% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 15.34% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 9.32% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 9.59% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.40% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 5.48% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.21% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 3.01% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.74% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 2.74% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.74% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.92% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.92% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.64% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.37% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 1.10% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.10% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.82% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.82% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.82% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.82% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.82% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.55% |
| Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 0.55% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.55% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.55% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.55% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.55% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 0.27% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.27% |
| Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 0.27% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.27% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.27% |
| Freshwater And Marine | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine | 0.27% |
| Stentor Amethystinus | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Stentor Amethystinus | 0.27% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 0.27% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 0.27% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.27% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.27% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.27% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559019 | Stentor MTG 1 | Environmental | Open in IMG/M |
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300000882 | Freshwater microbial communities from the Columbia River | Environmental | Open in IMG/M |
| 3300000929 | Marine plume microbial communities from the Columbia River - 15 PSU | Environmental | Open in IMG/M |
| 3300001844 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM35, ROCA_DNA220_0.2um_bLM_C_3a | Environmental | Open in IMG/M |
| 3300001849 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM26, ROCA_DNA190_2.0um_MCP-N_C_2b | Environmental | Open in IMG/M |
| 3300001850 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2a | Environmental | Open in IMG/M |
| 3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
| 3300002203 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - MAR 2013 | Environmental | Open in IMG/M |
| 3300002307 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-C2 co-culture F-D7 | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003388 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300003413 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD | Environmental | Open in IMG/M |
| 3300003429 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
| 3300003490 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003493 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003815 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jun07 | Environmental | Open in IMG/M |
| 3300004124 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (version 2) | Environmental | Open in IMG/M |
| 3300004460 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004792 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004793 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005069 | Metagenomes from Harmful Algal Blooms in Lake Erie, HABS-E2014-0024 | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007216 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface and Bottom layer) 16 sequencing projects | Environmental | Open in IMG/M |
| 3300007545 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3 | Environmental | Open in IMG/M |
| 3300007546 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-02 | Environmental | Open in IMG/M |
| 3300007547 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 | Environmental | Open in IMG/M |
| 3300007548 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3 | Environmental | Open in IMG/M |
| 3300007550 | Estuarine microbial communities from the Columbia River estuary - metaG 1549A-3 | Environmental | Open in IMG/M |
| 3300007555 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 | Environmental | Open in IMG/M |
| 3300007561 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3 | Environmental | Open in IMG/M |
| 3300007590 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-02 | Environmental | Open in IMG/M |
| 3300007603 | Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 | Environmental | Open in IMG/M |
| 3300007606 | Estuarine microbial communities from the Columbia River estuary - metaG 1569-02 | Environmental | Open in IMG/M |
| 3300007620 | Estuarine microbial communities from the Columbia River estuary - metaG 1546C-02 | Environmental | Open in IMG/M |
| 3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
| 3300007639 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02 | Environmental | Open in IMG/M |
| 3300007642 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-3 | Environmental | Open in IMG/M |
| 3300007644 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02 | Environmental | Open in IMG/M |
| 3300007665 | Estuarine microbial communities from the Columbia River estuary - metaG 1557A-3 | Environmental | Open in IMG/M |
| 3300007692 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743 | Environmental | Open in IMG/M |
| 3300007706 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-3 | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300007716 | Estuarine microbial communities from the Columbia River estuary - metaG 1546B-3 | Environmental | Open in IMG/M |
| 3300007861 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372B_3um | Environmental | Open in IMG/M |
| 3300007954 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373B_0.2um | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300008021 | Estuarine microbial communities from the Columbia River estuary - metaG 1569A-3 | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008950 | Estuarine microbial communities from the Columbia River estuary - metaG 1552A-02 | Environmental | Open in IMG/M |
| 3300008953 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT4 | Environmental | Open in IMG/M |
| 3300008961 | Estuarine microbial communities from the Columbia River estuary - metaG 1550B-02 | Environmental | Open in IMG/M |
| 3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300008999 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 | Environmental | Open in IMG/M |
| 3300009024 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009049 | Estuarine microbial communities from the Columbia River estuary - metaG 1558A-02 | Environmental | Open in IMG/M |
| 3300009057 | Estuarine microbial communities from the Columbia River estuary - metaG 1553A-3 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009233 | Microbial communities of water from Amazon river, Brazil - RCM9 | Environmental | Open in IMG/M |
| 3300010156 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel2S_0400h metaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010312 | Estuarine microbial communities from the Columbia River estuary - metaG 1549B-02 | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010388 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015 | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012352 | Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37 | Environmental | Open in IMG/M |
| 3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300012779 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130206_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012968 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013137 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1m | Environmental | Open in IMG/M |
| 3300013286 | Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014050 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007B | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020483 | Freshwater microbial communities from Lake Mendota, WI - 05AUG2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020526 | Freshwater microbial communities from Lake Mendota, WI - 21JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020572 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021070 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L442-13m | Environmental | Open in IMG/M |
| 3300021131 | Freshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 epilimnion | Environmental | Open in IMG/M |
| 3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022748 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MG | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300024306 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8h | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300024483 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024484 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026435 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026455 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8h | Environmental | Open in IMG/M |
| 3300027084 | Estuarine microbial communities from the Columbia River estuary - metaG 1554A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027138 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_0h | Environmental | Open in IMG/M |
| 3300027193 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes) | Environmental | Open in IMG/M |
| 3300027222 | Estuarine microbial communities from the Columbia River estuary - metaG 1546B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027242 | Estuarine microbial communities from the Columbia River estuary - metaG 1554B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027244 | Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027314 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027468 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027503 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepA_8d | Environmental | Open in IMG/M |
| 3300027531 | Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027571 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 (SPAdes) | Environmental | Open in IMG/M |
| 3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027627 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027656 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027689 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
| 3300027720 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027760 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| 3300034166 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079 | Environmental | Open in IMG/M |
| 3300034280 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048 | Environmental | Open in IMG/M |
| 3300034523 | Fracking water microbial communities from deep shales in Oklahoma, United States - K-4-A | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| stn_00419750 | 2166559019 | Stentor Amethystinus | MNLDEFRAHVEATRQASKAEALSVLSATITKSTTKEGN |
| JGI12421J11937_1000248321 | 3300000756 | Freshwater And Sediment | MNLDEFKAHVLATRQASKAEALSVLSATITIQPNERENLK* |
| JGI12421J11937_100949804 | 3300000756 | Freshwater And Sediment | MNLDEFKKHVTATRQASKXEALSVLSATITTQSNERENLNG* |
| JGI12421J11937_101259013 | 3300000756 | Freshwater And Sediment | MNLDEFKAHVQATRQASKAEALSVLSATITIQPNERENLK* |
| FwDRAFT_100059556 | 3300000882 | Freshwater And Marine | LDEFKKHVLATRQASKAEALSVLSATITTQPNERENLK* |
| NpDRAFT_100536119 | 3300000929 | Freshwater And Marine | IRIIRGRCVRMNLDEFKKHVLATRQASKAEALSVLSATITTSTNERENLNG* |
| RCM35_10131441 | 3300001844 | Marine Plankton | MNLDEFKAHVIAQREASKAEALSVLTATITKTEKENK* |
| RCM26_10374213 | 3300001849 | Marine Plankton | MNLDEFKAYVIATRQASKAEALSALTATINEIEKENN* |
| RCM37_12683201 | 3300001850 | Marine Plankton | MNLDEFKNHIEATRKASALEAMSVLSAIITTPNKEKDNK* |
| JGI24766J26685_1000230512 | 3300002161 | Freshwater And Sediment | MNLEEFKKHVIAQREASKAEALSVLSATITKTNERENL* |
| metazooDRAFT_13070522 | 3300002203 | Lake | MKLDEYKAFIIATREASKAEALSVLTATISNNTERKEN* |
| JGI24890J29729_100148114 | 3300002307 | Lentic | MNLDEFKAHVEATRQSSKAEAMSVLSATISQSTKKEGGK* |
| B570J40625_10001347714 | 3300002835 | Freshwater | MNLDEFKKHVIAQREASKAEALSVLSATITKSTNERENL* |
| B570J40625_10003344017 | 3300002835 | Freshwater | MNLDEFRAHVEATRQASKAEALSVLSATMSVSTTTKEGR* |
| JGI25908J49247_100163873 | 3300003277 | Freshwater Lake | MNLDEFKKHVLATREASRAEALSVLSATITTQPNERENLK* |
| JGI25908J49247_101692653 | 3300003277 | Freshwater Lake | MNLDEFKAHVLATRQASKAEALSVLSATITIQTNERENLNG* |
| JGI25910J50241_100406644 | 3300003388 | Freshwater Lake | MNLDEFKKHVLATREASRXEALSVLSATITTQPNERENLK* |
| JGI25909J50240_10213154 | 3300003393 | Freshwater Lake | MNLDEFKKHVLATREASRVEALSVLSATITTQPNERENLK* |
| JGI25922J50271_1000056612 | 3300003413 | Freshwater Lake | MNLEEFKAHVIAQREATKAEALSVLSATISTTKERENLNG* |
| JGI25922J50271_100629383 | 3300003413 | Freshwater Lake | MNLDEFKKHVIAQREASKAEALSVLSATITKTNERENLNG* |
| JGI25914J50564_100590853 | 3300003429 | Freshwater Lake | MNLDEFKAHVLATRQASKAEAMSVLSATMSVSTTTKEGATNGN* |
| JGI25914J50564_101239011 | 3300003429 | Freshwater Lake | MNLDEFRAYVEATRQASKAEALSVLSATMSITTTTKGDN* |
| JGI25921J50272_100055543 | 3300003430 | Freshwater Lake | MNLDEFKKHVIAQREASKAEALSVLSATIAKSTNEGENLNG* |
| JGI25921J50272_100100027 | 3300003430 | Freshwater Lake | MNLEEFKAHVLAQREATKAEALSVLSATIPTTTRKENSNG* |
| JGI25921J50272_100538742 | 3300003430 | Freshwater Lake | MNLDEFKKHVIRTREASKAEALSVLSATITKTNERENLNG* |
| JGI25926J51410_10261355 | 3300003490 | Freshwater Lake | MNLDEFKKHVLATRQASKAEALSVLSATITIQPNERENLNG* |
| JGI25926J51410_10699953 | 3300003490 | Freshwater Lake | MNLDEFKKHVIAQREESKAQALSVLSATITKQTNEGKNLNG* |
| JGI25923J51411_10279832 | 3300003493 | Freshwater Lake | MNLDEFKKHVLATRQASKAEALSVLSATITTQPNERENLK* |
| Ga0007856_10037463 | 3300003815 | Freshwater | MNLDEFKAYVQATREASRLEAMSVLSDTINPINPTKEWKISNEC* |
| Ga0066178_101955353 | 3300004124 | Freshwater Lake | MKLDEFKKQVIAQREASKAQALSVLSATITETNERENLNG* |
| Ga0066222_12587652 | 3300004460 | Marine | MNLDEFKKHVLATRQASKAQALSVLSATITTQPNERENLK* |
| Ga0066222_14585562 | 3300004460 | Marine | MNLDEFKKHVLATRQASKAQALSVLSATMSVSTTTKGDN* |
| Ga0007761_111766184 | 3300004792 | Freshwater Lake | MNLDEYRAYVEATRKASKSEALSVLSATITKSTTTKGDN* |
| Ga0007761_112437911 | 3300004792 | Freshwater Lake | MNLDEFKKHVLATRQASKAEALSVLSATITTSTNERENLK*VKSKR* |
| Ga0007760_114490638 | 3300004793 | Freshwater Lake | RRSEMNLDEYRAYVEATRKASKSEALSVLSATITKSTTTKGDN* |
| Ga0071350_10452854 | 3300005069 | Freshwater | MNLDEFKKHVLATREASRAEALSVLSATITTSTNERENLNG* |
| Ga0070374_100468741 | 3300005517 | Freshwater Lake | MNLDEFKAHIVATREASKAEALSVLSATITKSTTKEGN* |
| Ga0070374_101261652 | 3300005517 | Freshwater Lake | MNLEQFRAHVEATRQASKAEALSVLSATITKSTTKEGN* |
| Ga0070374_102765532 | 3300005517 | Freshwater Lake | MNLDEFKKHVIAQREASKAEALSVLSATITQTNERENLNG* |
| Ga0070374_103761933 | 3300005517 | Freshwater Lake | MNLDEFKKHVLETRQASKAEALSVLSATITKSTNERENLNG* |
| Ga0070374_103949812 | 3300005517 | Freshwater Lake | MNLDEFRAHVEATRQASKAEALSVLSATMSVSTTKEGN* |
| Ga0068876_100889489 | 3300005527 | Freshwater Lake | MNLDEFKAHVIATREASKAEALSVLSATITKSTTKEGK* |
| Ga0068876_102494463 | 3300005527 | Freshwater Lake | MNLEQFKAHVIATREASKAEALSVLSATITENQTRKEN* |
| Ga0068876_104421722 | 3300005527 | Freshwater Lake | MNLDEFKAHVLATRQASKAEALSVLSATITTQPNERENLNG* |
| Ga0068872_101287125 | 3300005528 | Freshwater Lake | MKLDEFKAYVIATREASKAEALSVLTATITETQRKEN* |
| Ga0049083_102555831 | 3300005580 | Freshwater Lentic | MNLDEFKKHVLATREASKAEALSVLSATITIQPNERENLNG* |
| Ga0049081_102168613 | 3300005581 | Freshwater Lentic | MNLDEFKKHVLATREASKAEALSVLSATITTQTNERENLNG* |
| Ga0049081_103280073 | 3300005581 | Freshwater Lentic | MNLDEFKAHVQATRQASKAEALSVLSATITIQPNERENLNG* |
| Ga0049080_101178543 | 3300005582 | Freshwater Lentic | MNLDEFKAHVQATRQASKAEALSVLSATITTQPNERENLNG* |
| Ga0049080_102255043 | 3300005582 | Freshwater Lentic | MNLDEFKAHVQATRQASKAEALSVLSATITTQPNERENL |
| Ga0049085_101015503 | 3300005583 | Freshwater Lentic | MNLDEFKKHVLATREASRAEALSVLSATITTQTNERENLNG* |
| Ga0049085_101177901 | 3300005583 | Freshwater Lentic | MNLDEFKKHVIAQREESKAKALSVLSATITIQPNERENLK* |
| Ga0049082_1000009233 | 3300005584 | Freshwater Lentic | MNLDEFKAHITATRQASKAEALSVLTATMSITTTTKEGATNGN* |
| Ga0078894_100919405 | 3300005662 | Freshwater Lake | MNLDEFRAAVLAQREASKAEALSVLSATISATTRKEN* |
| Ga0078894_103049004 | 3300005662 | Freshwater Lake | MNLDEFKKHVIAQREASKAQALSVLSATITTQTNERENLNG* |
| Ga0078894_103184214 | 3300005662 | Freshwater Lake | MNLEEFKKHVMAQREASKAEALSVLTGTISTTTKEGK* |
| Ga0078894_107364403 | 3300005662 | Freshwater Lake | MNLDEFKKHVIAQREASKAEALSVLSATITKTNEGENLNG* |
| Ga0078894_109098874 | 3300005662 | Freshwater Lake | MNLDEFKAHVIATREASKAEALSVLSATMSVSTTTKEGN* |
| Ga0078894_109134933 | 3300005662 | Freshwater Lake | MNLDEFKAHIIATREASKAEALSVLSATITIPQTKGDN* |
| Ga0078894_109181643 | 3300005662 | Freshwater Lake | MNLEEFKKHVIAQREASKAEALSVLSATITKTNEGENLNG* |
| Ga0078894_113499783 | 3300005662 | Freshwater Lake | MNLEEFKKHVIAQREASKAEALSVLSATITTQTNERENLNG* |
| Ga0078894_114677993 | 3300005662 | Freshwater Lake | MNLDEFKKHVIAQREASKAQALSVLSATITKTNERENLNG* |
| Ga0078894_115100251 | 3300005662 | Freshwater Lake | RSVRMNLEEFKKHVIAQREASKAEALSVLSATITKSTNEGQ* |
| Ga0078894_116857941 | 3300005662 | Freshwater Lake | MNLEEFKKHVIAQREASKAEALSVLSATITKTNERENLNG* |
| Ga0078894_116866052 | 3300005662 | Freshwater Lake | MNLEEFKAHVQATRQASKAEALSVLSATIPTTTGKEN* |
| Ga0078894_117348403 | 3300005662 | Freshwater Lake | MNLDEFKKHVLATRQASKAEALSVLSATITTSTNERENLNG* |
| Ga0078894_117853273 | 3300005662 | Freshwater Lake | MNLDEFKKHVLATREASKAEALSVLSATITTSTNERENLNG* |
| Ga0079957_10191063 | 3300005805 | Lake | MKLDEFKALIEAQRKASREEALSVLTAKMSNDNQRKEN* |
| Ga0070743_100037108 | 3300005941 | Estuarine | MNLEEFKAHVIAQREASKAEALSVLSATIPTTTRKEN* |
| Ga0070743_1001258410 | 3300005941 | Estuarine | MNLEEFKAHVLATRQASKSEALSVLSATISTTERKEN* |
| Ga0070743_100372136 | 3300005941 | Estuarine | MNLDEFKKHVLATREASKAEALSVLSATITKSTNERENLNG* |
| Ga0070743_101009812 | 3300005941 | Estuarine | MNLEQFKAHVIAQREASKAEALSVLSATIQATERKEN* |
| Ga0070744_100195613 | 3300006484 | Estuarine | MNLDEFKAHVLATRQASKAEALSVLSATITETTKEGM* |
| Ga0070744_101414074 | 3300006484 | Estuarine | MNLDEFKKHVLATREASKAEALSVLSATITTQPNERENLK* |
| Ga0070744_102429703 | 3300006484 | Estuarine | MNLEEFKKHVIEQREASKAQALSVLSATITETNERENLNG* |
| Ga0079301_10058433 | 3300006639 | Deep Subsurface | MNLDEFKQHVIAQREASKAQALSVLSATITKSTNERENLNG* |
| Ga0075471_102077875 | 3300006641 | Aqueous | MNLDEFRAYVEAQRNASKAEALSVLTATITNERKEN* |
| Ga0075473_100856253 | 3300006875 | Aqueous | MNLDEFKQHVLATREASKAEALSVLSATITKSTNERENLNG* |
| Ga0103961_10933835 | 3300007216 | Freshwater Lake | MKLDEYKALVLAQREASKAEALSVLSATISTNNERKEN* |
| Ga0102873_11120863 | 3300007545 | Estuarine | MNLDEFKKHVIAQREASKAEALSVLSATIPTTTRKEN* |
| Ga0102874_10410571 | 3300007546 | Estuarine | MNLEEFKAHVIAQREATKAEALSVLSATIPTTTRKEN* |
| Ga0102874_11801492 | 3300007546 | Estuarine | MNLDEFKAHIIATRQASKAEALSVLSATITKSTTTKGDN* |
| Ga0102875_10831965 | 3300007547 | Estuarine | MNLDEFKKHVLETRQASKAEALSVLSATITKSTNEREN |
| Ga0102877_11246492 | 3300007548 | Estuarine | MNLDEFKKHVLETRQASKAEALSVLSATITTSTNERENLNG* |
| Ga0102880_11469182 | 3300007550 | Estuarine | MNLEQFKAHVIAQREASKAEALSVLSATIPTTTRKEN* |
| Ga0102817_10607732 | 3300007555 | Estuarine | MNLEEFKKHVIAQREASKAEALSVLSATITTQPNERENLK* |
| Ga0102914_11856262 | 3300007561 | Estuarine | MNLDEFKQHVLETRQASKAEALSVLSATITKQTNERENLNG* |
| Ga0102917_11416164 | 3300007590 | Estuarine | MNLDEFKKHVLATRQASKAEALSVLSATITTSTNE |
| Ga0102921_11796223 | 3300007603 | Estuarine | MNLEEFKKHVIAEREASKAQALSVLSATISTTNERENLNV* |
| Ga0102923_11541951 | 3300007606 | Estuarine | RSVRMNLDEFKAHVLATRQASKAEALSVLSATITETTKEGM* |
| Ga0102871_10857523 | 3300007620 | Estuarine | MNLEEFKKHVIAEREASKAQALSVLSATITKTNEGENLNG |
| Ga0102863_11922422 | 3300007622 | Estuarine | MNLDEFKAHVLATRQASRAEALSVLSATITTKPNERENLK* |
| Ga0102865_12161933 | 3300007639 | Estuarine | MNLDEFKAHVQATRQASKAEALSVLSATITTQPNERENLK* |
| Ga0102876_11110084 | 3300007642 | Estuarine | MNLEEFKKHVIAQREASKAEALSVLSATIQPTERKEN* |
| Ga0102902_11011811 | 3300007644 | Estuarine | MNLDEFKKHVFATRQASKAEALSVLSATITTSTNERENLNG* |
| Ga0102902_12466241 | 3300007644 | Estuarine | MNLDEFKKHVLATRQASKAEALSVLSATITIQPNERENLK* |
| Ga0102908_10040191 | 3300007665 | Estuarine | MNLDEFKKHVLATRQASKAEALSVLSATITKTNEGENLNG* |
| Ga0102823_10237207 | 3300007692 | Estuarine | MNLEEFKKHVIAQREASKAQALSVLTGTISTTTKEGK* |
| Ga0102899_10720101 | 3300007706 | Estuarine | QMNLEEFKAHVLATRQQSKSEALSVLSATITNTTTKEGR* |
| Ga0102899_10720104 | 3300007706 | Estuarine | MNLDEFKAHVLATRQASKAEALSILSATITTSTNERENLNG* |
| Ga0102859_12249723 | 3300007708 | Estuarine | MNLDEFKKHVTATRQASKAEALSVLSATITKTNEGENLNG* |
| Ga0102867_10548221 | 3300007716 | Estuarine | RGRCVRMNLDEFKKHVLATRQASKAEALSVLSATITTSTNERENLNG* |
| Ga0105736_10792961 | 3300007861 | Estuary Water | MNLDEFKAHITATREASKGEALSVLSATMSVSTTTKGDN* |
| Ga0105739_10907823 | 3300007954 | Estuary Water | MNLDEFKAHITATREASKAEALSVLSATMSVSTTTKGDN* |
| Ga0105746_12980913 | 3300007973 | Estuary Water | IIRGRCVRMNLDEFKKHVLATRQASKAEALSVLSATITTQTNERENLK* |
| Ga0102922_11814663 | 3300008021 | Estuarine | MNLDEFKAHIIATRQASKAEALSVLSATITKSTTTK |
| Ga0108970_101433096 | 3300008055 | Estuary | MNLEEFKKHVIAQREASKAEALSVLTGTISTTTKEGK* |
| Ga0108970_107445383 | 3300008055 | Estuary | MNLEEFKKHVIEQREASKAEALSVLSATITKTNEGENQNG* |
| Ga0114340_100005726 | 3300008107 | Freshwater, Plankton | MNIDEFKAHVIAQREASKAQALAALTNNLPTKESK* |
| Ga0114340_10012573 | 3300008107 | Freshwater, Plankton | MNLDEFKAHITATRQASKAEALSVLSATITKTNEGENLNG* |
| Ga0114340_100907114 | 3300008107 | Freshwater, Plankton | MNLDEFKKHVIAQREASKAQALSVLSATITTQPNERENLNG* |
| Ga0114340_10125404 | 3300008107 | Freshwater, Plankton | MNLEEFKKHVIEQREASKAEALSVLSATITKTNERENLNG* |
| Ga0114340_101311510 | 3300008107 | Freshwater, Plankton | MNLEEFKKHVIDQREASKAQALSVLSATITKTNEGENLNG* |
| Ga0114340_10148665 | 3300008107 | Freshwater, Plankton | MNLDEFKAHIIATREASKAEALSVLSATITTPQTKGDN* |
| Ga0114340_10168058 | 3300008107 | Freshwater, Plankton | MNLEEFKKHVIAQREASKAQALSVLSATIPTTTNERENLNG* |
| Ga0114340_102057116 | 3300008107 | Freshwater, Plankton | MNLEEFKKHVIAQREASKAEALSVLSATITKTNEGENL* |
| Ga0114340_10639271 | 3300008107 | Freshwater, Plankton | MNLDEFKKHVIAQREASKAQALSVLSATITTQTNERENLN |
| Ga0114340_10839023 | 3300008107 | Freshwater, Plankton | MNLDEFKAYVLATRQASKAEALSVLSATIQETKGKEN* |
| Ga0114340_11029553 | 3300008107 | Freshwater, Plankton | MNLEEFKAHVLATRQASKSEALSVLSATITPTNERKEN* |
| Ga0114340_11233774 | 3300008107 | Freshwater, Plankton | MNLEEFKKHVIAQREASKAQALSVLSATITTQTNEGENLNG* |
| Ga0114340_11301885 | 3300008107 | Freshwater, Plankton | MNLEEFKKHVIAQREASKAEALSVLSATITKNERKEN* |
| Ga0114340_11635763 | 3300008107 | Freshwater, Plankton | MNLDEFKKHVIAQREASKAEALSVLSATITTQTNERENLNG* |
| Ga0114340_11684532 | 3300008107 | Freshwater, Plankton | MNLEEFKKHVTAQREASKAEALSVLSATITETNKGQ* |
| Ga0114340_12004191 | 3300008107 | Freshwater, Plankton | RSVRMNLEEFKKHVIAQREASKAEALSVLSATITKTNEGENLNG* |
| Ga0114341_101915313 | 3300008108 | Freshwater, Plankton | MNLDEFKAHVLATRQASKAEALSVLSATITTQTNERENLNG* |
| Ga0114343_104011613 | 3300008110 | Freshwater, Plankton | MNLDEFKKHVLATRQASKAEALSVLSATITNQTNERENLNG* |
| Ga0114343_11147283 | 3300008110 | Freshwater, Plankton | MNLDEFKKHVIAQREASKAEALSVLSATITTQSNERENLNG* |
| Ga0114344_10003719 | 3300008111 | Freshwater, Plankton | MNLEEFKAHVIAQREASKAEALSVLSATISTTTGKEN* |
| Ga0114344_11315704 | 3300008111 | Freshwater, Plankton | MNLEEFKKAVIAQREASKAEALSVLSATITKTNEGENLNG* |
| Ga0114344_11345454 | 3300008111 | Freshwater, Plankton | MNLEEFKKHVIAQREASKAEALSVLSATIPTTTRKEN* |
| Ga0114346_10273246 | 3300008113 | Freshwater, Plankton | MNLEEFKKHVIAQREASKAQALSVLSATITETNERENLNG* |
| Ga0114346_10640603 | 3300008113 | Freshwater, Plankton | MNLEEFKAHVLATRQASKSEALSVLSATITPTERKEN* |
| Ga0114346_11811444 | 3300008113 | Freshwater, Plankton | MNLEEFKKHVIAQREASKAQALSVLSATITKTNERENLNG* |
| Ga0114346_12357122 | 3300008113 | Freshwater, Plankton | MNLEEFKAHVIAQREATKAEALSVLSATISTNNERENLNG* |
| Ga0114346_13309682 | 3300008113 | Freshwater, Plankton | MNLDEFKKHVLETRQASKAEALSVLSATITNQTNERENLNG* |
| Ga0114347_10838971 | 3300008114 | Freshwater, Plankton | EFKKHVIAQREASKAEALSVLSATITKTNERENLNG* |
| Ga0114336_100571513 | 3300008261 | Freshwater, Plankton | MNLDEFRAYVEATRQASKAEALSVLSATMSVSTTTKGDN* |
| Ga0114336_10551466 | 3300008261 | Freshwater, Plankton | MNLDEFKAHVQATRQASKAEALSVLSATITQTNERENLNG* |
| Ga0114336_10665999 | 3300008261 | Freshwater, Plankton | MNLDEFKAHVIAQREASKAEALSVLSATITETKGKEN* |
| Ga0114336_11421184 | 3300008261 | Freshwater, Plankton | MNLDEFKQHVIAQREASKAQALSVLSATITKTNERENLNG* |
| Ga0114336_12084721 | 3300008261 | Freshwater, Plankton | NLDEFKAHVIAQREASKAEALSVLSATITETKGKEN* |
| Ga0114336_12511603 | 3300008261 | Freshwater, Plankton | MNLEEFKAHVLATRQQSKSEALSVLSATITNTTTKEGR* |
| Ga0114876_10815543 | 3300008448 | Freshwater Lake | MNLEEFKKHVIAQREASKAQALSVLSATITTQTNERENLNG* |
| Ga0102891_11858581 | 3300008950 | Estuarine | MNLDEFKKHVLATREASKAEALSVLSATITIQPNERENLK* |
| Ga0104241_10010387 | 3300008953 | Freshwater | MNLEEFKKHVLDQREASKAQALSVLSATIAKSNERKEN* |
| Ga0102887_10373934 | 3300008961 | Estuarine | MNLDEFKKHVLATREASKAEALSVLSATITKTNEGENLNG* |
| Ga0102887_10963905 | 3300008961 | Estuarine | VLATRQASKAEAMSVLSATMSVSTTTKEGATNGN* |
| Ga0104242_10029547 | 3300008962 | Freshwater | MKFNSLEDFKSYVISQREASKAEALSVLTATIPTTERKEN* |
| Ga0104242_10233531 | 3300008962 | Freshwater | MNLEEFKKHVIAQREASKAEALSVLTATITPTTERKEN* |
| Ga0102831_12959091 | 3300008996 | Estuarine | AHVLATRQASKAEALSVLSATITKQTNERENLNG* |
| Ga0102816_11040834 | 3300008999 | Estuarine | EFKAHVLATRQASKAEALSVLSATITIQPNERENLNG* |
| Ga0102811_10608366 | 3300009024 | Estuarine | GGCSLMNLEEFKAHVLATRQASKSEALSVLSATISTTERKEN* |
| Ga0102829_10162621 | 3300009026 | Estuarine | MNLDEFRAHVTATREVSKAQALSVLSATITKSTTTKEGATNGN* |
| Ga0102829_10648626 | 3300009026 | Estuarine | EFKKHVLATREASKAEALSVLSATITIQPNERENLK* |
| Ga0102911_12157833 | 3300009049 | Estuarine | MNLDEFKKHVIAQREASKAQALSVLSATITKSTNERENLNG* |
| Ga0102892_10856221 | 3300009057 | Estuarine | MNLDEFKKHVIAQREASKAEALSVLSATITKTNEGENLN |
| Ga0114973_1003645610 | 3300009068 | Freshwater Lake | MNLDEFKKHVLETRQASKAQALSVLSATITKSTNERENLNG* |
| Ga0114973_102976993 | 3300009068 | Freshwater Lake | MNLDEFKAHVIATREASKAEALSVLSATMSVSTTTKEGK* |
| Ga0114962_1000790210 | 3300009151 | Freshwater Lake | MNLDEFKKHVEETRKQSTVEAMSVLSATITTPNKKEAN* |
| Ga0114980_100019333 | 3300009152 | Freshwater Lake | MNLDEFKKAVIAQRELSKAEALSVLSATITTQTNERENLK* |
| Ga0114980_100521525 | 3300009152 | Freshwater Lake | MNLDEFRAHVEATRQASKAQALSVLSATMSITTTTKEGATNGN* |
| Ga0114968_104200262 | 3300009155 | Freshwater Lake | NLDEFKKHVLETRQASKAQALSVLSATITKSTNERENLNG* |
| Ga0114968_105658583 | 3300009155 | Freshwater Lake | MNLDEFKKHVLATREASKAEALSVLSATITKSTNERENLK* |
| Ga0114978_102880384 | 3300009159 | Freshwater Lake | MNLDEFKAHVQATRQASKAEALSVLSATITIKPNERENLK* |
| Ga0114978_108550722 | 3300009159 | Freshwater Lake | MNLDEFKKHVLATREASKAEALSVLSATITTQPNERGNLK* |
| Ga0114966_101904954 | 3300009161 | Freshwater Lake | MNLDEFKAHITATRQASKAEALSVLSATITKSTNERENLNG* |
| Ga0114975_106657101 | 3300009164 | Freshwater Lake | LDEYRAYVEATRKASKSEALSVLSATITKSTTTKGDN* |
| Ga0114979_101471865 | 3300009180 | Freshwater Lake | MNLDEFRAHVEATRQASKVEALSVLSATMSVSTTTKGDN* |
| Ga0114969_101323811 | 3300009181 | Freshwater Lake | MNLDEFKKHVIAQREESKAQALSVLSATITKQTNERENLNG* |
| Ga0114969_102136074 | 3300009181 | Freshwater Lake | MNLDEFKKHVLETRQASKAEALSVLSATITTQPNERENLK* |
| Ga0114959_103853283 | 3300009182 | Freshwater Lake | MNLDEYKAFVIAQRKASLAEAVSVLSATITTKKEGSK* |
| Ga0114974_105895771 | 3300009183 | Freshwater Lake | MNLEEFKAHVLATRQASKAEALSVLSATITTQPNERENLK* |
| Ga0103856_100663131 | 3300009233 | River Water | MDLQEYKEYILAQREASKAQALSVLTATITKTEKENN* |
| Ga0068873_10361842 | 3300010156 | Freshwater Lake | MNLDEFKKHVIAQREASKAEALSVLSATITENQTRKEN* |
| Ga0114967_101436782 | 3300010160 | Freshwater Lake | MNLDEFKAHVLATRQASKAEALSVLSATITTQSNERENLK* |
| Ga0102883_10338394 | 3300010312 | Estuarine | MNLEEFKKHVIAEREASKAQALSVLSATISTTNERENLNG* |
| Ga0102883_11105571 | 3300010312 | Estuarine | EGHFMNLDEFKAHIIATRQASKAEALSVLSATITKSTTTKGDN* |
| Ga0102883_11439961 | 3300010312 | Estuarine | MNLEEFKAHVIAQREATKAEALSVLSATIPTTTRKENSNG* |
| Ga0129333_1008607911 | 3300010354 | Freshwater To Marine Saline Gradient | MNLEEFKAHVLSTRQASKSEALSVLSATIQPITERKEN* |
| Ga0129333_102084103 | 3300010354 | Freshwater To Marine Saline Gradient | MKLDEYKAFIIATREASKAEALSVLTATISNNKERKEN* |
| Ga0136551_100111312 | 3300010388 | Pond Fresh Water | MNLEEFKKHVISQREATKAEALSVLSATIPTTNERENLNG* |
| Ga0136551_10128707 | 3300010388 | Pond Fresh Water | MNLDEFKAHIVATRQASKAEALSVLSATITKSTTKEGN* |
| Ga0151620_10399872 | 3300011268 | Freshwater | MNLDEFRAHVEATRQASKAEALSVLSATITKSTTKEGN* |
| Ga0153801_10426863 | 3300012017 | Freshwater | MNLDEFKAHITATREASKAEALSVLSATITKSTNERENLNG* |
| Ga0153801_10543352 | 3300012017 | Freshwater | MNLDEFKAHVLATRQASKSEALSVLSATITTTTNEKENN* |
| Ga0157138_10051969 | 3300012352 | Freshwater | MNLDEFRAHVEATRKATKVQALSVLSATITNTQTKGDN* |
| Ga0157203_100100616 | 3300012663 | Freshwater | MNLDEYKAYVIATRQASKAEALSVLSATITKSTTKEGN* |
| Ga0157203_100115312 | 3300012663 | Freshwater | MNLDEFRAYVEATRQASKAEALSVLSAKMSITTTTKGDN* |
| Ga0157203_10269844 | 3300012663 | Freshwater | MNLDEFKAHITATRQASKAEALSVLSATITTQTNERENLNG* |
| Ga0157210_10087351 | 3300012665 | Freshwater | LDEFRAHVEATRQASKAEALSVLSATITKSTTKEGN* |
| Ga0157210_10392204 | 3300012665 | Freshwater | MNLEEFKKHVIAQREASKAQALSVLSATIQPTTRKEN* |
| Ga0138284_12112793 | 3300012779 | Freshwater Lake | EMNLDEFKAHIIATRQASKAEALSVLSAKMSITTTTKEGATNGN* |
| Ga0129337_10288015 | 3300012968 | Aqueous | MKLDEFKAFIIAQREASKAEALSVLTATITNNNNERETKNG* |
| Ga0164293_100051798 | 3300013004 | Freshwater | MNLEEFKAHVLATRQQSKSEALSVLSATISTTTGKEN* |
| Ga0164294_100344348 | 3300013006 | Freshwater | MNLDEFKKHVLATREASKAEALSVLSATITKTNEGENQNG* |
| Ga0164294_101733015 | 3300013006 | Freshwater | MNLDEFKAYVQATRQASKAEALSVLSATITTQPNERENLK* |
| (restricted) Ga0172367_105884191 | 3300013126 | Freshwater | NLDEFKAYVIATREASKAEALSVLTATMSNNERKEN* |
| (restricted) Ga0172375_108986351 | 3300013137 | Freshwater | MNLDEFKAYVIATREASKAEALSVLTATMSNNERKEN* |
| Ga0136641_10169911 | 3300013286 | Freshwater | MNLDEFKKHVEETRKQSKAEAMSVLSATITTPNKTKDNK* |
| Ga0136641_10617885 | 3300013286 | Freshwater | MNLDEFKAHVLATRKASQQEAMSVLSAIITTPNNTKDNK* |
| Ga0170791_102305735 | 3300013295 | Freshwater | KLMNLDEFKKHVEETRKQSTVEAMSVLSATITTPNKKEAN* |
| Ga0170791_108974411 | 3300013295 | Freshwater | RIIRGRCVRMNLDEFKKHVLETRQASKAEALSVLSAKMSITTTTKEGATNGN* |
| Ga0170791_137332821 | 3300013295 | Freshwater | EMNLDEYRAYVEATRKASKSEALSVLSATITKSTTTKGDN* |
| Ga0177922_104071247 | 3300013372 | Freshwater | MNLDEFKAHIIATRQASKAEALSVLTATMSITTTTKEGATNGN* |
| Ga0177922_109768952 | 3300013372 | Freshwater | MNLDEFKAHVLATRQASRAEALSVLSATITTQPNERENLK* |
| Ga0119952_10209127 | 3300014050 | Freshwater | MNLEEFKKHVIAQREASKAQALSVLSATITPTTERKEN* |
| Ga0119952_10642871 | 3300014050 | Freshwater | HVIAQREASKAEAMSVLSATITNSTTKKEGATNGN* |
| Ga0119952_11471192 | 3300014050 | Freshwater | MNLDEFRAYVEATRKQSKNEAMSVLSATITKSTTKEGK* |
| Ga0181355_12082992 | 3300017785 | Freshwater Lake | MNLDEFKKHVTAQREVSKAEALSVLSATITTQPNERENLK |
| Ga0169931_108132841 | 3300017788 | Freshwater | NLDEFKAYVIATREASKAEALSVLTATMSNNERKEN |
| Ga0181359_10270996 | 3300019784 | Freshwater Lake | MNLDEFKKHVLATREASRVEALSVLSATITTQPNERENLK |
| Ga0181359_10368693 | 3300019784 | Freshwater Lake | MNLDEFKKHVTAQREVSKAEALSVLSATITTQSNERENLNG |
| Ga0181359_10812693 | 3300019784 | Freshwater Lake | MNLDEFKKHVIAQREESKAQALSVLSATITKQTNEGKNLNG |
| Ga0181359_11568041 | 3300019784 | Freshwater Lake | MNLDEFKKHVLATRQASKAEALSVLSATITIQPNERENLNG |
| Ga0211736_102273623 | 3300020151 | Freshwater | MNIDEFKKHVLETREASKAQALSVLSATITIQPNERENLK |
| Ga0211736_105544093 | 3300020151 | Freshwater | MNLDEFKAHITATRQASKAEALSVLSATITTQPNERENLNG |
| Ga0211734_1032647010 | 3300020159 | Freshwater | MNIDEFKAHVQATRQASKAEALSVLSATITTQPNERENLNG |
| Ga0211733_111227691 | 3300020160 | Freshwater | NERRSVMNLDEFKAYVTATRQASKAEAMSALSGKMSISTTTKEGQ |
| Ga0207418_1003268 | 3300020483 | Freshwater | MNLDEFKKHVIAQREASKAEALSVLSATITKSTNERENL |
| Ga0208050_10188612 | 3300020498 | Freshwater | MNLDEFKQHVIAQREASKAQALSVLSATITKSTNERENLNG |
| Ga0208085_10222664 | 3300020526 | Freshwater | MNLDEFKKHVLETRQASKAEALSVLSATITKSTNERENLNV |
| Ga0207909_10471342 | 3300020572 | Freshwater | MNLDEFKKHVLETRQASKAEALSVLSATITKSTTKEGN |
| Ga0194056_101174752 | 3300021070 | Anoxic Zone Freshwater | MNLDEFKKHILATRQASKAEALSVLSATITTQPNERENLNG |
| Ga0214206_10020404 | 3300021131 | Freshwater | MNLDEFKAYVQATREASRLEAMSVLSDTINPINPTKEWKISNEC |
| Ga0214206_10403262 | 3300021131 | Freshwater | MNLDEFKAHIEATRQASKAEAMSVLSATISTTKKEG |
| Ga0213920_100112322 | 3300021438 | Freshwater | MNLDEYKAHVIAQREASKAEAMSVLSATITTTKKEGSN |
| Ga0194048_1000266210 | 3300021519 | Anoxic Zone Freshwater | MNLDEFKAHVLATRQASKTEAMSVLSATISKSTTTEGDK |
| Ga0194048_100423013 | 3300021519 | Anoxic Zone Freshwater | MNLDEFKKHVLETRQASKAEALSVLSATITKSTNERENLK |
| Ga0213922_10366735 | 3300021956 | Freshwater | MNLEEFKAAVMAQREASKAQALSVLSATITPQTTRKEN |
| Ga0222714_1001185011 | 3300021961 | Estuarine Water | MNLDEFKAHIIATREASKAEALSVLSATITKSTTKEGK |
| Ga0222714_100184953 | 3300021961 | Estuarine Water | MNLEEFKAHVLATRQASKAEALSVLSATISNNNERKEN |
| Ga0222713_100320048 | 3300021962 | Estuarine Water | MNLDEFKAHVIATRQASKAEALSVLSATINKSETTKEGK |
| Ga0222713_100455434 | 3300021962 | Estuarine Water | MNLDEFKAYVIATREASKAEALSVLSATITENQTRKEN |
| Ga0222713_100740568 | 3300021962 | Estuarine Water | MNLEEFKAHVLATRQASKSEALSVLSATIQNNNERKEN |
| Ga0222713_101125505 | 3300021962 | Estuarine Water | MNLEEFKAHVLAQREATKAEALSVLSATIPTTTRKEN |
| Ga0222713_102892535 | 3300021962 | Estuarine Water | MNLDEFKKHVLATREASKAEALSVLSATITIQPNERENLK |
| Ga0222713_103903481 | 3300021962 | Estuarine Water | EFKKHVLATREASKAEALSVLSATITKSTNERENLNG |
| Ga0222712_102960121 | 3300021963 | Estuarine Water | DEFKKHVLATREASKAEALSVLSATITKSTNERENLNG |
| Ga0222712_104345512 | 3300021963 | Estuarine Water | MNLEEFKAHVIAQREATKAEALSVLSATIPTTTRKENSNG |
| Ga0181351_11307226 | 3300022407 | Freshwater Lake | DLDEFKAHVLATRQASKAEAMSVLSATMSVSTTTKEGATNGN |
| Ga0181351_12244762 | 3300022407 | Freshwater Lake | MNLDEFKQHVIAQREASKAQALSVLSATITTQPNERENLNG |
| Ga0228702_10849353 | 3300022748 | Freshwater | MNLEEFKAHVIATRQQSKAEALSVLSATIQPITERKEN |
| Ga0214917_1000604732 | 3300022752 | Freshwater | MNLDEFKKHVLATREASKAEALSVLSATITTQSNERENLNV |
| Ga0214921_1000113928 | 3300023174 | Freshwater | MNLDEFKAHVQATRQASKAEALSVLSATITIQPNERENLK |
| Ga0214921_1001140014 | 3300023174 | Freshwater | MNLEEFKKHVIAQREASKAEALSVLSATITPTTERKEN |
| Ga0214921_1001457922 | 3300023174 | Freshwater | MNLEEFKKHVLDQREASKAQALSVLSATITKTNEGENQNG |
| Ga0214921_1001859112 | 3300023174 | Freshwater | MNLDEFKAHVLATRQASKAEALSVLSATITEKKEGSN |
| Ga0214921_100330049 | 3300023174 | Freshwater | MNLDEFKAHVLATRQASKAEALSVLSATITTQPNERENLNG |
| Ga0214921_100732857 | 3300023174 | Freshwater | MNLDEFKKHVLATREASKAEALSVLSATITTQPNERENLNG |
| Ga0214921_101373385 | 3300023174 | Freshwater | MNLEEFKKHVLETRQASKAEALSVLSATITKSTNERENLNG |
| Ga0214921_101426914 | 3300023174 | Freshwater | MNLDEFKKHVIAQREESKAQALSVLSATITKQTNERENLNG |
| Ga0214921_102178472 | 3300023174 | Freshwater | MNLEEFKKHVLDQREASKAQALSVLSATIAKSNERKEN |
| Ga0214921_102680304 | 3300023174 | Freshwater | MNLDEFKKHVLETRQASKAEALSVLSATITKSTNERENLNG |
| Ga0214921_103200753 | 3300023174 | Freshwater | MNLDEFKKHVLETRQASKAEALSVLSATITTQPNERGNLK |
| Ga0214921_104698591 | 3300023174 | Freshwater | IRIIRGRCVRMNLDEFKKHVLATREASKAEALSVLSATITTQSNERENLNG |
| Ga0255147_1000020138 | 3300024289 | Freshwater | MDLIEFRNFINAQREASKAEALSVLTATIQERKEKENG |
| Ga0255147_10008105 | 3300024289 | Freshwater | MKLEEYKALVIAQREASKAEALSVLSATISKTQKKEVNK |
| Ga0255147_10254683 | 3300024289 | Freshwater | MKLDEFKAFIIAQREASKAEALSVLTATITNNNNERETKNG |
| Ga0255148_10466851 | 3300024306 | Freshwater | MKLDEFKAFIIAQREASKAEALSVLTATITNNNNERETKN |
| Ga0244777_1000091019 | 3300024343 | Estuarine | MNLDEFKKHVIAQREASKAEALSVLSATITKTNEGENLNG |
| Ga0244777_1000213835 | 3300024343 | Estuarine | MNLDEFKAHVTETRKQSKIEAMSVLSATITKSTTTKEGATNGN |
| Ga0244777_100199339 | 3300024343 | Estuarine | MNLDEFKAHVLATRQASKAEALSVLSATITETTKEGM |
| Ga0244777_102987392 | 3300024343 | Estuarine | MNLEEFKAHVLATRQQSKSEALSVLSATITNTTTKEGR |
| Ga0244777_103947483 | 3300024343 | Estuarine | MNLEQFKAHVIAQREASKAEALSVLSATIQATERKEN |
| Ga0244777_103984253 | 3300024343 | Estuarine | MNLDEFKKHVLATRQASKAEALSVLSATITTSTNERENLNG |
| Ga0244777_106901883 | 3300024343 | Estuarine | MNLDEFKKHVLATREASKAEALSVLSATITKSTNERENLNG |
| Ga0244775_100189031 | 3300024346 | Estuarine | MNLEQFKAHVIAQREASKAEALSVLSATIQATKRKEN |
| Ga0244775_100441528 | 3300024346 | Estuarine | MNLEEFKAHVLATRQASKSEALSVLSATISTTERKEN |
| Ga0244775_100480549 | 3300024346 | Estuarine | MNLEEFKAHVIAQREASKAEALSVLSATIPTTTRKEN |
| Ga0244775_102372074 | 3300024346 | Estuarine | MNLDEFRAYVEATRQASKAEALSVLSATMSITTTTKGDN |
| Ga0244775_103572102 | 3300024346 | Estuarine | MNLEQFKAHVIAQREASKAEALSVLSATIQATTRKEN |
| Ga0244775_106377172 | 3300024346 | Estuarine | MNLDEFKKHVLATREASKAEALSVLSATITIQPNERENLNG |
| Ga0244775_106877733 | 3300024346 | Estuarine | MNLDEFKAHVLATRQASKAEALSVLSATITIQPNERENLNG |
| Ga0244775_113482191 | 3300024346 | Estuarine | MNLDEFKAHITATREASKAEALSVLSATITKSTNERENLNG |
| Ga0244775_114320073 | 3300024346 | Estuarine | MNLDEFKKHVLATREASKAEALSVLSATITTQPNERENLK |
| Ga0244775_114455303 | 3300024346 | Estuarine | VRMNLDEFKKHVLATREASKAEALSVLSATITTQPNERENLK |
| Ga0244775_115361021 | 3300024346 | Estuarine | MNLEEFKKHVIEQREASKAQALSVLSATITETNERENLNG |
| Ga0244776_1002065013 | 3300024348 | Estuarine | MNLDEFKAHVLATRQASKAEAMSVLSATMSVSTTTKEGATNGN |
| Ga0244776_101506315 | 3300024348 | Estuarine | MNLDEFKAHVLATRQQSKSEAMSVLSATITKSTTKEGE |
| Ga0244776_101833343 | 3300024348 | Estuarine | MNLEEFKAHVISQREATKAEALSVLSATIPTTTRKEN |
| Ga0244776_102494344 | 3300024348 | Estuarine | MNLEEVKAHVQATRQASKAEALSVLSATITKTNEGENLNG |
| Ga0255224_10841253 | 3300024483 | Freshwater | MNLDEFKKHVLETRQASKAEALSVLSATITKTNERENLNG |
| Ga0256332_11085484 | 3300024484 | Freshwater | EYKALVIAQREASKAEALSVLSATISKTQKKEVNK |
| Ga0208147_10007056 | 3300025635 | Aqueous | MNLDEFKQHVLATREASKAEALSVLSATITKSTNERENLNG |
| Ga0208784_10610482 | 3300025732 | Aqueous | MKLDEYKAFIIATREASKAEALSVLTATISNNKERKEN |
| Ga0256297_10486291 | 3300026435 | Freshwater | GSQMNLDEFKAHVLATRQQSKSEALSVLSATITTSTNERENLNG |
| Ga0255155_10653362 | 3300026455 | Freshwater | MKFNSLEDFKSYVISQREASKAEALSVLTATIPATTERKEN |
| Ga0208443_10378243 | 3300027084 | Estuarine | MNLEEFKKHVIAEREASKAQALSVLSATISTTNERENLNG |
| Ga0255064_100622311 | 3300027138 | Freshwater | MNLDEFKAHVLATRQQSKSEALSVLSATITTSTTTKEGATNGN |
| Ga0208800_10471101 | 3300027193 | Estuarine | GSLMNLDEFKKHVLATREASKAEALSVLSATITIQPNERENLNG |
| Ga0208024_10019971 | 3300027222 | Estuarine | FKKHVIAQREASKAEALSVLSATITKTNEGENLNG |
| Ga0208024_10153351 | 3300027222 | Estuarine | KAHVLATRQASKAEAMSVLSATMSVSTTTKEGATNGN |
| Ga0208806_10188803 | 3300027242 | Estuarine | MNLDEFKAHIIATRQASKAEALSVLSATITKSTTTKGDN |
| Ga0208173_10392674 | 3300027244 | Estuarine | MNLDEFKAHITATREASKAEALSVLSATITTSTNERENLNG |
| Ga0208811_10762652 | 3300027314 | Estuarine | MNLDEFKAHITATREASKAEALSVLSATITTSTNERENLK |
| Ga0209247_10182443 | 3300027468 | Freshwater Lake | MNLDEFKAHVLATRQASKAEALSVLSATITIQTNERENLNG |
| Ga0209247_10268053 | 3300027468 | Freshwater Lake | MNLDEFKKHVLATREASRAEALSVLSATITTQPNERENLK |
| Ga0255182_10362286 | 3300027503 | Freshwater | TKMDLIEFRNFINAQREASKAEALSVLTATIQERKEKENG |
| Ga0208682_10535615 | 3300027531 | Estuarine | RIIRGRCVRMNLDEFKKHVLATREASKAEALSVLSATITKSTNERENLNG |
| Ga0209552_11806212 | 3300027563 | Freshwater Lake | MNLDEFKKHVLATRQASKAEALSVLSATITTQPNERENLK |
| Ga0208897_11825722 | 3300027571 | Estuarine | RKGSQMNLEEFKAHVLATRQQSKSEALSVLSATITNTTTKEGR |
| Ga0209651_11253574 | 3300027581 | Freshwater Lake | FKKHVLATREASRVEALSVLSATITTQPNERENLK |
| Ga0208974_10796323 | 3300027608 | Freshwater Lentic | MNLDEFKAHVQATRQASKAEALSVLSATITTQPNERENLNG |
| Ga0208974_11736063 | 3300027608 | Freshwater Lentic | MNLDEFKKHVLATRQASKAEALSVLSATITIQPNERENL |
| Ga0208942_11159591 | 3300027627 | Freshwater Lentic | MNLDEFKKHVLATREASRAEALSVLSATITTQTNERENLNG |
| Ga0208133_10519314 | 3300027631 | Estuarine | MNLDEFKKHVLETRQASKAEALSVLSATITTQTNERENLNG |
| Ga0209357_11004471 | 3300027656 | Freshwater Lake | MNLDEFKKHVLATREASRVEALSVLSATITTQPNERE |
| Ga0209551_12127623 | 3300027689 | Freshwater Lake | MKLDEFKKQVIAQREASKAQALSVLSATITETNERENLNG |
| Ga0209599_1000078026 | 3300027710 | Deep Subsurface | MNLDEFKAHITATREASKAEALSVLSATMSVSTTTKGDN |
| Ga0209599_1000544012 | 3300027710 | Deep Subsurface | MNLDEFKKHVIAQREASKAQALSVLSATITTQTNERENLNG |
| Ga0209599_102049002 | 3300027710 | Deep Subsurface | MNLEEFKAHVLATRQASKAEALSVLSATITTQPNERENLK |
| Ga0209617_100277235 | 3300027720 | Freshwater And Sediment | MNLDEFKKHVTATRQASKAEALSVLSATITTQSNERENLNG |
| Ga0209297_100056428 | 3300027733 | Freshwater Lake | MNLDEFKAHIIATRQASKAEALSVLSAKMSITTTTKEGATNGN |
| Ga0209297_10506937 | 3300027733 | Freshwater Lake | MNLDEFRAHVEATRQASKAQALSVLSATMSITTTTKEGATNGN |
| Ga0209190_100614717 | 3300027736 | Freshwater Lake | MNLDEFKKHVLETRQASKAQALSVLSATITKSTNERENLNG |
| Ga0209085_13472742 | 3300027741 | Freshwater Lake | MNLDEFKKHVLATRQASKVEALSVLSATITTQPNERENLK |
| Ga0209084_10135744 | 3300027749 | Freshwater Lake | MNLDEFKKHVEETRKQSTVEAMSVLSATITTPNKKEAN |
| Ga0209596_100121738 | 3300027754 | Freshwater Lake | MNLDEFKKHVIAQREESKAKALSVLSATITIQPNERENLK |
| Ga0209596_11362331 | 3300027754 | Freshwater Lake | MNLDEFKAHITATRQASKAEALSVLSATITKSTNERENLNG |
| Ga0209296_13734203 | 3300027759 | Freshwater Lake | MNLDEFKAHVQATRQASKAEALSVLSATITIKPNERENLK |
| Ga0209598_101716201 | 3300027760 | Freshwater Lake | MNLDEFKAHVIATRQASKAEALSVLSAKMSITTTTKEGATNG |
| Ga0209088_102753762 | 3300027763 | Freshwater Lake | MNLDEFRAHVEATRQASKVEALSVLSATMSVSTTTKGDN |
| Ga0209770_1000001696 | 3300027769 | Freshwater Lake | MNLEEFKAHVIAQREATKAEALSVLSATISTTKERENLNG |
| Ga0209770_1002540210 | 3300027769 | Freshwater Lake | MNLDEFKKHVIAQREASKAEALSVLSATIAKSTNEGENLNG |
| Ga0209500_1001649012 | 3300027782 | Freshwater Lake | MNLDEYRAYVEATRKASKSEALSVLSATITKSTTTKGDN |
| Ga0209500_104125873 | 3300027782 | Freshwater Lake | MNLDEFKKHVLATREASKAEALSVLSATITTQPNERGNLK |
| Ga0209107_102840323 | 3300027797 | Freshwater And Sediment | MNLDEFKKHVLATRQASKAEALSVLSATITTQPNERENLNG |
| Ga0209358_103383552 | 3300027804 | Freshwater Lake | MNLDEFKKHVIAQREASKAQALSVLSATITKSTNERENLNG |
| Ga0209358_104532571 | 3300027804 | Freshwater Lake | NLEEFKKHVIAQREASKAQALSVLSATITTQTNEGENLNG |
| Ga0209229_1000017648 | 3300027805 | Freshwater And Sediment | MNLDEFKAHVIAQREASKAEALSVLSATITETKGKEN |
| Ga0209229_1000642513 | 3300027805 | Freshwater And Sediment | MNLEEFKKHVIAQREASKAEALSVLSATITKTNERENL |
| Ga0209229_100131254 | 3300027805 | Freshwater And Sediment | MNLEEFKKHVTAQREASKAEALSVLSATITETNKGQ |
| Ga0209229_101114943 | 3300027805 | Freshwater And Sediment | MNLEEFKKHVIEQREASKAQALSVLSATITTQTNEGENLNG |
| Ga0209229_102840752 | 3300027805 | Freshwater And Sediment | MNLDEFKAHITATRQASKAEALSVLSATITKSTTKEGN |
| Ga0209229_103434953 | 3300027805 | Freshwater And Sediment | MNLEEFKKHVTEQREASKAEALSVLSATITKTNEGQ |
| Ga0209550_101260071 | 3300027892 | Freshwater Lake | MNLEEFKKHVIAQREASKAEALSVLSATITKTNEGENLNG |
| Ga0209550_105713443 | 3300027892 | Freshwater Lake | MNLDEFKKHVIAQREASKAQALSVLSATITETNERENLNG |
| Ga0209400_100532224 | 3300027963 | Freshwater Lake | MNLDEFKKHVLETREASKAEALSVLSATITIQPNERENLK |
| Ga0209400_13069582 | 3300027963 | Freshwater Lake | MNLDEFKAHITATRQASKAEALSVLSAKMSITTTTKEGATNGN |
| Ga0209400_13773343 | 3300027963 | Freshwater Lake | MNLDEFKKHVLATREASKAEALSVLSATITKSTNERE |
| Ga0209401_10722635 | 3300027971 | Freshwater Lake | MNLDEFKAHVIATRQASKAEALSVLSAKMSITTTTKEGATNGN |
| Ga0209298_100015573 | 3300027973 | Freshwater Lake | MNLDEFKKAVIAQRELSKAEALSVLSATITTQTNERENLK |
| Ga0247723_10000746 | 3300028025 | Deep Subsurface Sediment | MNLEEFKKSVIAQREASKAQALSVLSATITTQTNEGENLNG |
| Ga0119944_10010179 | 3300029930 | Aquatic | MKLDEFKALIEAQRKASREEALSVLTAKMSNDNQRKEN |
| Ga0315907_1000396216 | 3300031758 | Freshwater | MNLDEFKAYVLATRQASKAEALSVLSATIQETKGKEN |
| Ga0315907_102309804 | 3300031758 | Freshwater | MKLDEFKAYVIATREASKAEALSVLTATITETQRKEN |
| Ga0315899_101780882 | 3300031784 | Freshwater | MNLEEFKAHVLATRQASKSEALSVLSATITPTERKEN |
| Ga0315899_103697635 | 3300031784 | Freshwater | MNLEEFKKHVIAQREASKAEALSVLSATIPTTTRKEN |
| Ga0315899_103941737 | 3300031784 | Freshwater | MNLDEFKAHITATRQASKAEALSVLSATITKTNEGENLNG |
| Ga0315909_100178004 | 3300031857 | Freshwater | MNLDEFKAHVLATRQASKSEALSVLSATITTTTNEKENN |
| Ga0315909_105374883 | 3300031857 | Freshwater | MNLEEFKKHVIAQREASKAEALSVLSATITKTNERENLNG |
| Ga0315909_106131592 | 3300031857 | Freshwater | MNLEEFKKHVIDQREASKAEALSVLSATITKTNEGENL |
| Ga0315901_101602225 | 3300031963 | Freshwater | MNLDEFKKHVIAQRETSKAEALSVLSATITKSTNERENL |
| Ga0315905_1000350133 | 3300032092 | Freshwater | MNLDEFKAHIIATREASKAEALSVLSATMSVSTTTKGDN |
| Ga0316616_1005139162 | 3300033521 | Soil | MNLEEFKAHVLATRQASKNEALSVLTATISNNNERKEN |
| Ga0334992_0038822_831_971 | 3300033992 | Freshwater | MNLNDFKAHVIATRQASKAEALSVLSAKMLISTTTKGGQNDYINNK |
| Ga0335019_0607307_517_633 | 3300034066 | Freshwater | MNLDEYKAYVIATRQASKAEALSVLSATITKSTTKEGK |
| Ga0310130_0087073_812_928 | 3300034073 | Fracking Water | MKLDEFKAYVIAQREASKAEALSVLSATIQNNNERKEN |
| Ga0335012_0126875_1295_1408 | 3300034093 | Freshwater | KKHVLETRQASKAEALSVLSATITNSTTKKEGATNGN |
| Ga0335029_0126353_142_255 | 3300034102 | Freshwater | MNLEEFKKHVIAQREASKAEALSVLTGTISTTTKEGK |
| Ga0335029_0620513_73_189 | 3300034102 | Freshwater | MNLDEFRAHVEATRQASKAEALSVLSATMSVSTTKEGN |
| Ga0335060_0597180_294_416 | 3300034122 | Freshwater | MNLEEFKKHVIAQREASKAEALSVLSATISTNNERENLNG |
| Ga0335016_0395974_698_808 | 3300034166 | Freshwater | VMNLEDFKAHVTATRQASKAEAISALSAKMSGKCDQ |
| Ga0334997_0609836_539_670 | 3300034280 | Freshwater | EGQFMNLDEFRAHVEATRQASKAEALSVLSATMSVSTTTKEGR |
| Ga0310143_00917_8661_8777 | 3300034523 | Fracking Water | MNLEEFKAHVLATRQASKSEALSVLSATISNNNERKEN |
| ⦗Top⦘ |