| Basic Information | |
|---|---|
| Family ID | F006694 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 366 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MEAFVIAGTLLGSFAGAFALQKAALEGLFRMMNADRRVRQ |
| Number of Associated Samples | 234 |
| Number of Associated Scaffolds | 366 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 80.05 % |
| % of genes near scaffold ends (potentially truncated) | 21.86 % |
| % of genes from short scaffolds (< 2000 bps) | 86.07 % |
| Associated GOLD sequencing projects | 213 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (89.344 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (9.290 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.317 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.541 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 55.88% β-sheet: 0.00% Coil/Unstructured: 44.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 366 Family Scaffolds |
|---|---|---|
| PF05977 | MFS_3 | 16.94 |
| PF02746 | MR_MLE_N | 4.92 |
| PF00753 | Lactamase_B | 4.64 |
| PF13378 | MR_MLE_C | 4.64 |
| PF06114 | Peptidase_M78 | 2.73 |
| PF00578 | AhpC-TSA | 1.09 |
| PF02401 | LYTB | 0.55 |
| PF03098 | An_peroxidase | 0.55 |
| PF00005 | ABC_tran | 0.55 |
| PF01035 | DNA_binding_1 | 0.55 |
| PF12681 | Glyoxalase_2 | 0.27 |
| PF00119 | ATP-synt_A | 0.27 |
| PF10816 | DUF2760 | 0.27 |
| PF02113 | Peptidase_S13 | 0.27 |
| PF10282 | Lactonase | 0.27 |
| PF12704 | MacB_PCD | 0.27 |
| PF02687 | FtsX | 0.27 |
| PF04519 | Bactofilin | 0.27 |
| PF07477 | Glyco_hydro_67C | 0.27 |
| PF01139 | RtcB | 0.27 |
| PF01432 | Peptidase_M3 | 0.27 |
| PF02577 | BFN_dom | 0.27 |
| PF02769 | AIRS_C | 0.27 |
| PF00326 | Peptidase_S9 | 0.27 |
| PF01474 | DAHP_synth_2 | 0.27 |
| PF05853 | BKACE | 0.27 |
| PF03279 | Lip_A_acyltrans | 0.27 |
| PF10543 | ORF6N | 0.27 |
| PF05635 | 23S_rRNA_IVP | 0.27 |
| PF01081 | Aldolase | 0.27 |
| PF04055 | Radical_SAM | 0.27 |
| PF00275 | EPSP_synthase | 0.27 |
| PF13485 | Peptidase_MA_2 | 0.27 |
| PF09527 | ATPase_gene1 | 0.27 |
| PF00899 | ThiF | 0.27 |
| PF08757 | CotH | 0.27 |
| PF00117 | GATase | 0.27 |
| PF13280 | WYL | 0.27 |
| PF04389 | Peptidase_M28 | 0.27 |
| PF16499 | Melibiase_2 | 0.27 |
| PF07973 | tRNA_SAD | 0.27 |
| PF03899 | ATP-synt_I | 0.27 |
| PF09723 | Zn-ribbon_8 | 0.27 |
| COG ID | Name | Functional Category | % Frequency in 366 Family Scaffolds |
|---|---|---|---|
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 16.94 |
| COG4948 | L-alanine-DL-glutamate epimerase or related enzyme of enolase superfamily | Cell wall/membrane/envelope biogenesis [M] | 9.84 |
| COG0761 | 4-Hydroxy-3-methylbut-2-enyl diphosphate reductase IspH | Lipid transport and metabolism [I] | 1.09 |
| COG0350 | DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase) | Replication, recombination and repair [L] | 0.55 |
| COG3695 | Alkylated DNA nucleotide flippase Atl1, participates in nucleotide excision repair, Ada-like DNA-binding domain | Transcription [K] | 0.55 |
| COG5337 | Spore coat protein CotH | Cell wall/membrane/envelope biogenesis [M] | 0.27 |
| COG0339 | Zn-dependent oligopeptidase, M3 family | Posttranslational modification, protein turnover, chaperones [O] | 0.27 |
| COG4261 | Predicted acyltransferase, LPLAT superfamily | General function prediction only [R] | 0.27 |
| COG3661 | Alpha-glucuronidase | Carbohydrate transport and metabolism [G] | 0.27 |
| COG3312 | FoF1-type ATP synthase accessory protein AtpI | Energy production and conversion [C] | 0.27 |
| COG3246 | Uncharacterized conserved protein, DUF849 family | Function unknown [S] | 0.27 |
| COG3200 | 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthase, class II | Amino acid transport and metabolism [E] | 0.27 |
| COG2027 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.27 |
| COG1690 | RNA-splicing ligase RtcB, repairs tRNA damage | Translation, ribosomal structure and biogenesis [J] | 0.27 |
| COG1664 | Cytoskeletal protein CcmA, bactofilin family | Cytoskeleton [Z] | 0.27 |
| COG1560 | Palmitoleoyl-ACP: Kdo2-lipid-IV acyltransferase (lipid A biosynthesis) | Lipid transport and metabolism [I] | 0.27 |
| COG1259 | Bifunctional DNase/RNase | General function prediction only [R] | 0.27 |
| COG1164 | Oligoendopeptidase F | Amino acid transport and metabolism [E] | 0.27 |
| COG0800 | 2-keto-3-deoxy-6-phosphogluconate aldolase | Carbohydrate transport and metabolism [G] | 0.27 |
| COG0356 | FoF1-type ATP synthase, membrane subunit a | Energy production and conversion [C] | 0.27 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 89.34 % |
| Unclassified | root | N/A | 10.66 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_104509568 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 649 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_104846495 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 580 | Open in IMG/M |
| 3300000567|JGI12270J11330_10269358 | Not Available | 541 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_100683435 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3142 | Open in IMG/M |
| 3300001356|JGI12269J14319_10081632 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1707 | Open in IMG/M |
| 3300001686|C688J18823_10401772 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 887 | Open in IMG/M |
| 3300003324|soilH2_10048236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1000 | Open in IMG/M |
| 3300004082|Ga0062384_100206301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1163 | Open in IMG/M |
| 3300004103|Ga0058903_1457697 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 517 | Open in IMG/M |
| 3300004104|Ga0058891_1532957 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 860 | Open in IMG/M |
| 3300004114|Ga0062593_100349682 | All Organisms → cellular organisms → Bacteria | 1291 | Open in IMG/M |
| 3300004140|Ga0058894_1466290 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 558 | Open in IMG/M |
| 3300004152|Ga0062386_100041174 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3463 | Open in IMG/M |
| 3300004152|Ga0062386_101147040 | Not Available | 645 | Open in IMG/M |
| 3300004631|Ga0058899_10694540 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300004631|Ga0058899_12022101 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 773 | Open in IMG/M |
| 3300004631|Ga0058899_12151466 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300005177|Ga0066690_10614853 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 725 | Open in IMG/M |
| 3300005177|Ga0066690_10772688 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 627 | Open in IMG/M |
| 3300005181|Ga0066678_10605259 | Not Available | 729 | Open in IMG/M |
| 3300005329|Ga0070683_100000019 | All Organisms → cellular organisms → Bacteria | 192076 | Open in IMG/M |
| 3300005329|Ga0070683_100828222 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300005329|Ga0070683_101837566 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300005332|Ga0066388_102247285 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 986 | Open in IMG/M |
| 3300005335|Ga0070666_10551787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 838 | Open in IMG/M |
| 3300005338|Ga0068868_102109753 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 536 | Open in IMG/M |
| 3300005344|Ga0070661_101085939 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300005367|Ga0070667_100470212 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
| 3300005434|Ga0070709_11010640 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 662 | Open in IMG/M |
| 3300005435|Ga0070714_101835691 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
| 3300005436|Ga0070713_101891236 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300005458|Ga0070681_12010374 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300005459|Ga0068867_100696117 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300005524|Ga0070737_10002111 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 25047 | Open in IMG/M |
| 3300005529|Ga0070741_10497306 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
| 3300005529|Ga0070741_10545958 | Not Available | 1042 | Open in IMG/M |
| 3300005529|Ga0070741_10953771 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300005530|Ga0070679_100833079 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 866 | Open in IMG/M |
| 3300005531|Ga0070738_10015211 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6294 | Open in IMG/M |
| 3300005531|Ga0070738_10050744 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2597 | Open in IMG/M |
| 3300005531|Ga0070738_10089262 | All Organisms → cellular organisms → Bacteria | 1689 | Open in IMG/M |
| 3300005533|Ga0070734_10000153 | All Organisms → cellular organisms → Bacteria | 190557 | Open in IMG/M |
| 3300005533|Ga0070734_10522561 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300005534|Ga0070735_10251825 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
| 3300005535|Ga0070684_100118346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2381 | Open in IMG/M |
| 3300005537|Ga0070730_10202516 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1324 | Open in IMG/M |
| 3300005538|Ga0070731_10628908 | Not Available | 714 | Open in IMG/M |
| 3300005541|Ga0070733_10167870 | All Organisms → cellular organisms → Bacteria | 1428 | Open in IMG/M |
| 3300005542|Ga0070732_10074928 | All Organisms → cellular organisms → Bacteria | 1976 | Open in IMG/M |
| 3300005542|Ga0070732_10701149 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 616 | Open in IMG/M |
| 3300005544|Ga0070686_101745044 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300005548|Ga0070665_100653880 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
| 3300005563|Ga0068855_102086561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300005563|Ga0068855_102091002 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300005591|Ga0070761_10658676 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 654 | Open in IMG/M |
| 3300005602|Ga0070762_10160975 | All Organisms → cellular organisms → Bacteria | 1350 | Open in IMG/M |
| 3300005607|Ga0070740_10028375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3197 | Open in IMG/M |
| 3300005640|Ga0075035_1451102 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 576 | Open in IMG/M |
| 3300005764|Ga0066903_101779724 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
| 3300005764|Ga0066903_102535984 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 993 | Open in IMG/M |
| 3300005764|Ga0066903_102969292 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 919 | Open in IMG/M |
| 3300005764|Ga0066903_105497739 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 668 | Open in IMG/M |
| 3300005899|Ga0075271_10070610 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
| 3300005921|Ga0070766_10489610 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300005921|Ga0070766_10613523 | Not Available | 731 | Open in IMG/M |
| 3300005944|Ga0066788_10016554 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1606 | Open in IMG/M |
| 3300006028|Ga0070717_11802295 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300006032|Ga0066696_11094155 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300006052|Ga0075029_100003374 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 8974 | Open in IMG/M |
| 3300006052|Ga0075029_100547228 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300006102|Ga0075015_100310826 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300006800|Ga0066660_10365998 | All Organisms → cellular organisms → Bacteria | 1177 | Open in IMG/M |
| 3300006804|Ga0079221_10345764 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 895 | Open in IMG/M |
| 3300006893|Ga0073928_10193703 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1598 | Open in IMG/M |
| 3300006954|Ga0079219_10145142 | All Organisms → cellular organisms → Bacteria | 1256 | Open in IMG/M |
| 3300009088|Ga0099830_10470604 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300009093|Ga0105240_10005595 | All Organisms → cellular organisms → Bacteria | 18668 | Open in IMG/M |
| 3300009093|Ga0105240_12776060 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 504 | Open in IMG/M |
| 3300009101|Ga0105247_11134058 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 619 | Open in IMG/M |
| 3300009137|Ga0066709_103646869 | Not Available | 559 | Open in IMG/M |
| 3300009156|Ga0111538_13748489 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300009162|Ga0075423_11297090 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300009174|Ga0105241_11579124 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300009177|Ga0105248_13198979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300009523|Ga0116221_1009310 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5790 | Open in IMG/M |
| 3300009525|Ga0116220_10311110 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
| 3300009551|Ga0105238_12321244 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300009633|Ga0116129_1000068 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 76112 | Open in IMG/M |
| 3300009637|Ga0116118_1140935 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 784 | Open in IMG/M |
| 3300009662|Ga0105856_1105759 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 825 | Open in IMG/M |
| 3300009665|Ga0116135_1052297 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1421 | Open in IMG/M |
| 3300009683|Ga0116224_10451243 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 612 | Open in IMG/M |
| 3300009698|Ga0116216_10734152 | Not Available | 593 | Open in IMG/M |
| 3300009700|Ga0116217_10260559 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1123 | Open in IMG/M |
| 3300009700|Ga0116217_10572814 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300009824|Ga0116219_10104724 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1650 | Open in IMG/M |
| 3300009824|Ga0116219_10421901 | Not Available | 743 | Open in IMG/M |
| 3300010037|Ga0126304_10686247 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
| 3300010046|Ga0126384_12114008 | Not Available | 540 | Open in IMG/M |
| 3300010048|Ga0126373_10598383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1155 | Open in IMG/M |
| 3300010048|Ga0126373_10916177 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 941 | Open in IMG/M |
| 3300010048|Ga0126373_11421609 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 759 | Open in IMG/M |
| 3300010048|Ga0126373_11671424 | Not Available | 701 | Open in IMG/M |
| 3300010152|Ga0126318_10429947 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 622 | Open in IMG/M |
| 3300010152|Ga0126318_10978203 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 637 | Open in IMG/M |
| 3300010359|Ga0126376_12405742 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
| 3300010359|Ga0126376_13135828 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 511 | Open in IMG/M |
| 3300010361|Ga0126378_11053639 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 916 | Open in IMG/M |
| 3300010361|Ga0126378_12064538 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 650 | Open in IMG/M |
| 3300010362|Ga0126377_10369583 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1436 | Open in IMG/M |
| 3300010362|Ga0126377_10703874 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
| 3300010362|Ga0126377_10999394 | Not Available | 903 | Open in IMG/M |
| 3300010366|Ga0126379_13819232 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300010373|Ga0134128_10000085 | All Organisms → cellular organisms → Bacteria | 125765 | Open in IMG/M |
| 3300010376|Ga0126381_100868943 | All Organisms → cellular organisms → Bacteria | 1297 | Open in IMG/M |
| 3300010376|Ga0126381_103844111 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 586 | Open in IMG/M |
| 3300010379|Ga0136449_103641103 | Not Available | 583 | Open in IMG/M |
| 3300010397|Ga0134124_10981132 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 856 | Open in IMG/M |
| 3300010398|Ga0126383_13559735 | Not Available | 509 | Open in IMG/M |
| 3300010399|Ga0134127_11570857 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300010399|Ga0134127_13587304 | Not Available | 509 | Open in IMG/M |
| 3300010400|Ga0134122_12209216 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
| 3300011077|Ga0138572_1094937 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
| 3300011119|Ga0105246_10833328 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae | 821 | Open in IMG/M |
| 3300011120|Ga0150983_10315278 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 768 | Open in IMG/M |
| 3300011120|Ga0150983_10929717 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 537 | Open in IMG/M |
| 3300011120|Ga0150983_11834056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 689 | Open in IMG/M |
| 3300011120|Ga0150983_11928993 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1000 | Open in IMG/M |
| 3300011120|Ga0150983_12817570 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 539 | Open in IMG/M |
| 3300011120|Ga0150983_13544088 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 699 | Open in IMG/M |
| 3300011120|Ga0150983_13824225 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 822 | Open in IMG/M |
| 3300011120|Ga0150983_13859166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 590 | Open in IMG/M |
| 3300011120|Ga0150983_15074256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 583 | Open in IMG/M |
| 3300011120|Ga0150983_15872433 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 560 | Open in IMG/M |
| 3300011120|Ga0150983_15949172 | Not Available | 617 | Open in IMG/M |
| 3300011120|Ga0150983_16145162 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
| 3300011332|Ga0126317_10535537 | Not Available | 556 | Open in IMG/M |
| 3300012096|Ga0137389_11623251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 543 | Open in IMG/M |
| 3300012210|Ga0137378_10127750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2349 | Open in IMG/M |
| 3300012212|Ga0150985_100508560 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 537 | Open in IMG/M |
| 3300012212|Ga0150985_103284386 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 569 | Open in IMG/M |
| 3300012212|Ga0150985_103646887 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae | 658 | Open in IMG/M |
| 3300012212|Ga0150985_104776279 | Not Available | 590 | Open in IMG/M |
| 3300012212|Ga0150985_106097882 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 803 | Open in IMG/M |
| 3300012212|Ga0150985_108711515 | Not Available | 558 | Open in IMG/M |
| 3300012212|Ga0150985_110382401 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 680 | Open in IMG/M |
| 3300012212|Ga0150985_110696335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 543 | Open in IMG/M |
| 3300012212|Ga0150985_110886853 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 565 | Open in IMG/M |
| 3300012212|Ga0150985_112407493 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 705 | Open in IMG/M |
| 3300012212|Ga0150985_112959667 | Not Available | 874 | Open in IMG/M |
| 3300012212|Ga0150985_115185796 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1038 | Open in IMG/M |
| 3300012212|Ga0150985_115686333 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 570 | Open in IMG/M |
| 3300012212|Ga0150985_117637494 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 514 | Open in IMG/M |
| 3300012212|Ga0150985_118148546 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 568 | Open in IMG/M |
| 3300012212|Ga0150985_118667791 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 755 | Open in IMG/M |
| 3300012212|Ga0150985_120397576 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae | 747 | Open in IMG/M |
| 3300012212|Ga0150985_120474578 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae | 918 | Open in IMG/M |
| 3300012212|Ga0150985_121059731 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
| 3300012212|Ga0150985_121110226 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 873 | Open in IMG/M |
| 3300012212|Ga0150985_121268304 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 713 | Open in IMG/M |
| 3300012350|Ga0137372_10790905 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300012469|Ga0150984_109072784 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 544 | Open in IMG/M |
| 3300012469|Ga0150984_111808327 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300012469|Ga0150984_114109831 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1315 | Open in IMG/M |
| 3300012469|Ga0150984_114280634 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 611 | Open in IMG/M |
| 3300012469|Ga0150984_115284723 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300012469|Ga0150984_116597903 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 541 | Open in IMG/M |
| 3300012469|Ga0150984_123084060 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300012929|Ga0137404_11038608 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 750 | Open in IMG/M |
| 3300012930|Ga0137407_12372845 | Not Available | 507 | Open in IMG/M |
| 3300012958|Ga0164299_11308640 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300013100|Ga0157373_11323660 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 546 | Open in IMG/M |
| 3300013104|Ga0157370_11366004 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 638 | Open in IMG/M |
| 3300013105|Ga0157369_12358422 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae | 539 | Open in IMG/M |
| 3300013297|Ga0157378_12211270 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 601 | Open in IMG/M |
| 3300013297|Ga0157378_12428471 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 576 | Open in IMG/M |
| 3300013297|Ga0157378_12505955 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 568 | Open in IMG/M |
| 3300013306|Ga0163162_11903008 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300013307|Ga0157372_10578707 | All Organisms → cellular organisms → Bacteria | 1309 | Open in IMG/M |
| 3300013307|Ga0157372_11161951 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 892 | Open in IMG/M |
| 3300014152|Ga0181533_1045120 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2339 | Open in IMG/M |
| 3300014326|Ga0157380_12128184 | Not Available | 624 | Open in IMG/M |
| 3300014326|Ga0157380_13097489 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 530 | Open in IMG/M |
| 3300014326|Ga0157380_13445322 | Not Available | 506 | Open in IMG/M |
| 3300014501|Ga0182024_10090429 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 4507 | Open in IMG/M |
| 3300014501|Ga0182024_10496226 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1554 | Open in IMG/M |
| 3300014501|Ga0182024_10621621 | All Organisms → cellular organisms → Bacteria | 1348 | Open in IMG/M |
| 3300014501|Ga0182024_11419283 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300014745|Ga0157377_11741012 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 504 | Open in IMG/M |
| 3300014969|Ga0157376_11077723 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300015197|Ga0167638_1002771 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 3994 | Open in IMG/M |
| 3300015242|Ga0137412_10484668 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 948 | Open in IMG/M |
| 3300015371|Ga0132258_13904657 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1013 | Open in IMG/M |
| 3300015373|Ga0132257_101441625 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 877 | Open in IMG/M |
| 3300016422|Ga0182039_11713998 | Not Available | 575 | Open in IMG/M |
| 3300016445|Ga0182038_11889454 | Not Available | 540 | Open in IMG/M |
| 3300017823|Ga0187818_10387534 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300017955|Ga0187817_10174451 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1369 | Open in IMG/M |
| 3300017970|Ga0187783_10530093 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 853 | Open in IMG/M |
| 3300017970|Ga0187783_11014886 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 598 | Open in IMG/M |
| 3300017973|Ga0187780_10187075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1442 | Open in IMG/M |
| 3300018047|Ga0187859_10507515 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 672 | Open in IMG/M |
| 3300018062|Ga0187784_11691615 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 501 | Open in IMG/M |
| 3300018431|Ga0066655_10890363 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 608 | Open in IMG/M |
| 3300018468|Ga0066662_12018126 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 604 | Open in IMG/M |
| 3300018482|Ga0066669_10388733 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1176 | Open in IMG/M |
| 3300019263|Ga0184647_1307713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 641 | Open in IMG/M |
| 3300019789|Ga0137408_1310504 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1457 | Open in IMG/M |
| 3300020069|Ga0197907_10246361 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 507 | Open in IMG/M |
| 3300020069|Ga0197907_11275668 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 604 | Open in IMG/M |
| 3300020070|Ga0206356_11330249 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 730 | Open in IMG/M |
| 3300020215|Ga0196963_10019833 | All Organisms → cellular organisms → Bacteria | 2902 | Open in IMG/M |
| 3300020581|Ga0210399_10487056 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1026 | Open in IMG/M |
| 3300020583|Ga0210401_10113239 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 2546 | Open in IMG/M |
| 3300021171|Ga0210405_10776163 | Not Available | 736 | Open in IMG/M |
| 3300021180|Ga0210396_10924145 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 743 | Open in IMG/M |
| 3300021384|Ga0213876_10038763 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2516 | Open in IMG/M |
| 3300021384|Ga0213876_10124621 | All Organisms → cellular organisms → Bacteria | 1368 | Open in IMG/M |
| 3300021406|Ga0210386_11510594 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 560 | Open in IMG/M |
| 3300021407|Ga0210383_11521096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 553 | Open in IMG/M |
| 3300021432|Ga0210384_11082925 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 704 | Open in IMG/M |
| 3300021432|Ga0210384_11662954 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 544 | Open in IMG/M |
| 3300021478|Ga0210402_10323253 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1430 | Open in IMG/M |
| 3300021559|Ga0210409_11299821 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300021560|Ga0126371_10248480 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1892 | Open in IMG/M |
| 3300021560|Ga0126371_10777737 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1104 | Open in IMG/M |
| 3300021560|Ga0126371_11035544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 962 | Open in IMG/M |
| 3300021560|Ga0126371_11380796 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 836 | Open in IMG/M |
| 3300021560|Ga0126371_11981999 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 700 | Open in IMG/M |
| 3300021560|Ga0126371_12650104 | Not Available | 607 | Open in IMG/M |
| 3300021560|Ga0126371_13368242 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300021861|Ga0213853_11120441 | Not Available | 700 | Open in IMG/M |
| 3300022467|Ga0224712_10294392 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 758 | Open in IMG/M |
| 3300022467|Ga0224712_10465582 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 608 | Open in IMG/M |
| 3300022504|Ga0242642_1096510 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 513 | Open in IMG/M |
| 3300022508|Ga0222728_1047386 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 714 | Open in IMG/M |
| 3300022510|Ga0242652_1050682 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 525 | Open in IMG/M |
| 3300022523|Ga0242663_1117837 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300022530|Ga0242658_1125654 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 639 | Open in IMG/M |
| 3300022531|Ga0242660_1066942 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 819 | Open in IMG/M |
| 3300022531|Ga0242660_1175537 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300022532|Ga0242655_10335277 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300022533|Ga0242662_10093552 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 847 | Open in IMG/M |
| 3300022533|Ga0242662_10099140 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 828 | Open in IMG/M |
| 3300022557|Ga0212123_10272476 | Not Available | 1200 | Open in IMG/M |
| 3300022722|Ga0242657_1029825 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1094 | Open in IMG/M |
| 3300022722|Ga0242657_1204647 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
| 3300022724|Ga0242665_10041226 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1189 | Open in IMG/M |
| 3300022724|Ga0242665_10360232 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 523 | Open in IMG/M |
| 3300025463|Ga0208193_1000122 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 54754 | Open in IMG/M |
| 3300025900|Ga0207710_10476365 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300025905|Ga0207685_10438499 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 677 | Open in IMG/M |
| 3300025912|Ga0207707_10716912 | Not Available | 839 | Open in IMG/M |
| 3300025913|Ga0207695_10011171 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 10893 | Open in IMG/M |
| 3300025915|Ga0207693_10192100 | All Organisms → cellular organisms → Bacteria | 1606 | Open in IMG/M |
| 3300025944|Ga0207661_10000019 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 235900 | Open in IMG/M |
| 3300025944|Ga0207661_11648186 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300025949|Ga0207667_10420328 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1360 | Open in IMG/M |
| 3300025949|Ga0207667_10817197 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 928 | Open in IMG/M |
| 3300025949|Ga0207667_11754321 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 586 | Open in IMG/M |
| 3300026035|Ga0207703_10307564 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1448 | Open in IMG/M |
| 3300026118|Ga0207675_101279404 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 754 | Open in IMG/M |
| 3300026555|Ga0179593_1086765 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2471 | Open in IMG/M |
| 3300027570|Ga0208043_1065510 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1031 | Open in IMG/M |
| 3300027667|Ga0209009_1105259 | Not Available | 716 | Open in IMG/M |
| 3300027706|Ga0209581_1029046 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2559 | Open in IMG/M |
| 3300027825|Ga0209039_10019441 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 3502 | Open in IMG/M |
| 3300027826|Ga0209060_10000379 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 88329 | Open in IMG/M |
| 3300027842|Ga0209580_10048447 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1975 | Open in IMG/M |
| 3300027854|Ga0209517_10048826 | All Organisms → cellular organisms → Bacteria | 3224 | Open in IMG/M |
| 3300027862|Ga0209701_10608309 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
| 3300027867|Ga0209167_10232092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae | 988 | Open in IMG/M |
| 3300027889|Ga0209380_10298562 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 946 | Open in IMG/M |
| 3300027898|Ga0209067_10006480 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 6439 | Open in IMG/M |
| 3300027898|Ga0209067_10014541 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 4095 | Open in IMG/M |
| 3300027905|Ga0209415_10038236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 6591 | Open in IMG/M |
| 3300027908|Ga0209006_10639855 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300027911|Ga0209698_11040058 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
| 3300027965|Ga0209062_1081620 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1414 | Open in IMG/M |
| 3300027968|Ga0209061_1001639 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 34962 | Open in IMG/M |
| 3300028379|Ga0268266_11143524 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. | 753 | Open in IMG/M |
| 3300028792|Ga0307504_10221835 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 680 | Open in IMG/M |
| 3300029636|Ga0222749_10264724 | Not Available | 879 | Open in IMG/M |
| 3300029636|Ga0222749_10641543 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300029943|Ga0311340_10205798 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1976 | Open in IMG/M |
| 3300029999|Ga0311339_11197436 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 696 | Open in IMG/M |
| 3300030659|Ga0316363_10069378 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1623 | Open in IMG/M |
| 3300030659|Ga0316363_10297222 | Not Available | 646 | Open in IMG/M |
| 3300030730|Ga0307482_1267043 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 541 | Open in IMG/M |
| 3300030730|Ga0307482_1271340 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300030730|Ga0307482_1284467 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 528 | Open in IMG/M |
| 3300030991|Ga0073994_10117973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300031057|Ga0170834_100979641 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1145 | Open in IMG/M |
| 3300031058|Ga0308189_10522667 | Not Available | 514 | Open in IMG/M |
| 3300031231|Ga0170824_110434497 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
| 3300031231|Ga0170824_122913904 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae | 714 | Open in IMG/M |
| 3300031231|Ga0170824_128781264 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1095 | Open in IMG/M |
| 3300031234|Ga0302325_10267028 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2825 | Open in IMG/M |
| 3300031234|Ga0302325_10553382 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1715 | Open in IMG/M |
| 3300031234|Ga0302325_10896222 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1232 | Open in IMG/M |
| 3300031234|Ga0302325_11466632 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300031236|Ga0302324_102170005 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 690 | Open in IMG/M |
| 3300031236|Ga0302324_103512170 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300031546|Ga0318538_10637272 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| 3300031681|Ga0318572_10950663 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 510 | Open in IMG/M |
| 3300031708|Ga0310686_109534053 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2995 | Open in IMG/M |
| 3300031708|Ga0310686_114324719 | All Organisms → cellular organisms → Bacteria | 2181 | Open in IMG/M |
| 3300031716|Ga0310813_12078202 | Not Available | 536 | Open in IMG/M |
| 3300031718|Ga0307474_11558814 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae | 519 | Open in IMG/M |
| 3300031770|Ga0318521_10493907 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 735 | Open in IMG/M |
| 3300031819|Ga0318568_11028626 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 509 | Open in IMG/M |
| 3300031890|Ga0306925_12095017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300031910|Ga0306923_10373061 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1626 | Open in IMG/M |
| 3300031910|Ga0306923_12140984 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 563 | Open in IMG/M |
| 3300031938|Ga0308175_101193437 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 846 | Open in IMG/M |
| 3300031939|Ga0308174_10011518 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 5127 | Open in IMG/M |
| 3300031939|Ga0308174_10018062 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 4296 | Open in IMG/M |
| 3300031939|Ga0308174_10340642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1193 | Open in IMG/M |
| 3300031954|Ga0306926_12408406 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae | 580 | Open in IMG/M |
| 3300031962|Ga0307479_10826833 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 901 | Open in IMG/M |
| 3300031996|Ga0308176_11171936 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 814 | Open in IMG/M |
| 3300031996|Ga0308176_12062408 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 609 | Open in IMG/M |
| 3300032055|Ga0318575_10658821 | Not Available | 530 | Open in IMG/M |
| 3300032119|Ga0316051_1021289 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
| 3300032160|Ga0311301_11529125 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 819 | Open in IMG/M |
| 3300032515|Ga0348332_10211855 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
| 3300032515|Ga0348332_12428984 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 796 | Open in IMG/M |
| 3300032515|Ga0348332_13537243 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 594 | Open in IMG/M |
| 3300032770|Ga0335085_10006652 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 18154 | Open in IMG/M |
| 3300032770|Ga0335085_10050856 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 5604 | Open in IMG/M |
| 3300032770|Ga0335085_10086230 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 4103 | Open in IMG/M |
| 3300032770|Ga0335085_10134404 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 3133 | Open in IMG/M |
| 3300032770|Ga0335085_10193153 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2501 | Open in IMG/M |
| 3300032770|Ga0335085_10636564 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1195 | Open in IMG/M |
| 3300032782|Ga0335082_10335831 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1380 | Open in IMG/M |
| 3300032782|Ga0335082_11140237 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 646 | Open in IMG/M |
| 3300032783|Ga0335079_10056859 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4466 | Open in IMG/M |
| 3300032783|Ga0335079_10116657 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3016 | Open in IMG/M |
| 3300032783|Ga0335079_11829851 | Not Available | 590 | Open in IMG/M |
| 3300032805|Ga0335078_10287156 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 2221 | Open in IMG/M |
| 3300032805|Ga0335078_10396816 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1812 | Open in IMG/M |
| 3300032805|Ga0335078_10432249 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1716 | Open in IMG/M |
| 3300032805|Ga0335078_10444173 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1686 | Open in IMG/M |
| 3300032805|Ga0335078_11882447 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 646 | Open in IMG/M |
| 3300032805|Ga0335078_12368442 | Not Available | 553 | Open in IMG/M |
| 3300032828|Ga0335080_10822929 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 958 | Open in IMG/M |
| 3300032829|Ga0335070_10369761 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1377 | Open in IMG/M |
| 3300032829|Ga0335070_11218841 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 690 | Open in IMG/M |
| 3300032893|Ga0335069_11548144 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300032897|Ga0335071_10178912 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2074 | Open in IMG/M |
| 3300032897|Ga0335071_10588988 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1064 | Open in IMG/M |
| 3300032897|Ga0335071_11831741 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 551 | Open in IMG/M |
| 3300032898|Ga0335072_11218279 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
| 3300032955|Ga0335076_11474304 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 567 | Open in IMG/M |
| 3300033004|Ga0335084_10021411 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6575 | Open in IMG/M |
| 3300033134|Ga0335073_10207129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2428 | Open in IMG/M |
| 3300033134|Ga0335073_11681576 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 600 | Open in IMG/M |
| 3300033289|Ga0310914_10472690 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1135 | Open in IMG/M |
| 3300033402|Ga0326728_10000772 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 120930 | Open in IMG/M |
| 3300033402|Ga0326728_10016362 | All Organisms → cellular organisms → Bacteria | 15153 | Open in IMG/M |
| 3300033405|Ga0326727_10846718 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 695 | Open in IMG/M |
| 3300033513|Ga0316628_101592309 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae | 870 | Open in IMG/M |
| 3300033513|Ga0316628_103050521 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 612 | Open in IMG/M |
| 3300033755|Ga0371489_0473635 | Not Available | 560 | Open in IMG/M |
| 3300033977|Ga0314861_0430433 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 574 | Open in IMG/M |
| 3300034268|Ga0372943_0246683 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1120 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.29% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 8.47% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.28% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 6.01% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 5.74% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.46% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.92% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.73% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.19% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.46% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.91% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.91% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.64% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.37% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.37% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.37% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.37% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.37% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.37% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.37% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.37% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.37% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.37% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.09% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.09% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.09% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.09% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.09% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.09% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.09% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.09% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.82% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.82% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.55% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.55% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.55% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.55% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.55% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.55% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.55% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.55% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.55% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.27% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.27% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.27% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.27% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.27% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.27% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.27% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.27% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.27% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.27% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.27% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.27% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.27% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.27% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.27% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.27% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.27% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.27% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004103 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF242 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004104 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF218 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004140 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF224 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005524 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005531 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005607 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 | Environmental | Open in IMG/M |
| 3300005640 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_052 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005899 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_302 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009633 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 | Environmental | Open in IMG/M |
| 3300009637 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 | Environmental | Open in IMG/M |
| 3300009662 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011077 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 57 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011332 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014152 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaG | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015197 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6B, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019263 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020215 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_5 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022504 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022508 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022510 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022523 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025463 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027965 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027968 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032119 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSE5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033755 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fraction | Environmental | Open in IMG/M |
| 3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1045095682 | 3300000364 | Soil | MEALLIGATLIGSFWGAVMLQKVALEGLFRAMNADRRAREL* |
| INPhiseqgaiiFebDRAFT_1048464951 | 3300000364 | Soil | MEAVLITATLFGSFATAFYIQRAALEGLFRMMDSNRRDRH* |
| JGI12270J11330_102693581 | 3300000567 | Peatlands Soil | MDALVIAATLVGSCAGAFVLQKAALEGLFRIMRTERRARH* |
| JGIcombinedJ13530_1006834353 | 3300001213 | Wetland | MEAVVIAGAFIGSFLGALAIQKAALEGLFRIMDLERRGRR* |
| JGI12269J14319_100816322 | 3300001356 | Peatlands Soil | MDALVIAATLVGSCAGAFVLQKAALEGLFRIMLTERRDRH* |
| C688J18823_104017722 | 3300001686 | Soil | MEAVVITATLFGSFATAWAIQKTALEALFRAMAPSRRERQ* |
| soilH2_100482363 | 3300003324 | Sugarcane Root And Bulk Soil | MEAAVITVTLIGSFWGAFALQKAALEGLFRVMDVNRRARQ* |
| Ga0062384_1002063013 | 3300004082 | Bog Forest Soil | MEAIVIVGAVVGSFAGAFVLQKAALEGLFRMMNADRRTRQ* |
| Ga0058903_14576973 | 3300004103 | Forest Soil | TMDALLITATLAGSFLGAFALQKAALEGLFRIMSAERRERQ* |
| Ga0058891_15329572 | 3300004104 | Forest Soil | MDAVVIASTLVGTFVGAFVIQKAALEGLFRMMNAERRNHR* |
| Ga0062593_1003496822 | 3300004114 | Soil | MEAVVITATLFGSFATAWAIQKTALEALFRMMSPNRRARE* |
| Ga0058894_14662902 | 3300004140 | Forest Soil | MEAIVIAATLVGSFAGAFAIQKAALEGLFRIMGAPRRARQ* |
| Ga0062386_1000411744 | 3300004152 | Bog Forest Soil | MEDLLLIGATVFGSFVDAFVLQKAALKGFFRIMGTERRARR* |
| Ga0062386_1011470402 | 3300004152 | Bog Forest Soil | METVVVIGALVGSFAGAFALQKAALEGLFRIMNNDRRLRQ |
| Ga0058899_106945402 | 3300004631 | Forest Soil | METLVIAATLVGSFAGAFVLQKAALEGLFRIMGADRASSHRHRA* |
| Ga0058899_120221012 | 3300004631 | Forest Soil | MDAVLIASTLVGSFVGAFVIQKAALEGLIRMMNADRRNQR* |
| Ga0058899_121514662 | 3300004631 | Forest Soil | MEALVIAVTLIGSFLGALALQKAALEGLFRIMGAPRARQ* |
| Ga0066690_106148532 | 3300005177 | Soil | MEAFVIATTVLGSFLGAFALQKFALEGLFRVMSWERRERQ* |
| Ga0066690_107726881 | 3300005177 | Soil | MDALLIAATLLSSFLGAFALQKAALEGLFRAMQANRRVRE* |
| Ga0066678_106052592 | 3300005181 | Soil | MEAVVITATLLGSFVGALAIQKAALEGLIRAMDADRRSRE* |
| Ga0070683_100000019114 | 3300005329 | Corn Rhizosphere | MEAVVITATLAGSFATAFVIQKFALEGLFRMMSPNRRARE* |
| Ga0070683_1008282223 | 3300005329 | Corn Rhizosphere | MEAFVIGVTLFGSFLGAFILQKAALEGLFRMMQTDRRARQ* |
| Ga0070683_1018375662 | 3300005329 | Corn Rhizosphere | MDALVIAATLFGSLAGAYALLKAALAGLFRAIDPERRARQ* |
| Ga0066388_1022472853 | 3300005332 | Tropical Forest Soil | MEALLIGATLIGSFWGAMVLQKAALERLFRAMSAGRRARE* |
| Ga0070666_105517873 | 3300005335 | Switchgrass Rhizosphere | MEAVVIASTLVGSFFGAFLIQKAALEGLFRMMNAERRTHE* |
| Ga0068868_1021097532 | 3300005338 | Miscanthus Rhizosphere | MEAFVITATLFGSFATAFYIQRAALEGLFRMMDPNRRERP* |
| Ga0070661_1010859392 | 3300005344 | Corn Rhizosphere | MEAVLITAALAGSFATAFVIQKFALEGLFRMMSPNRRVRE* |
| Ga0070667_1004702123 | 3300005367 | Switchgrass Rhizosphere | MDAFIITAALFGSFAGAFILQKAALEGLFRIMQMERRARQ* |
| Ga0070709_110106402 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MEAFVIAGTLVGSFATAFVIQKVALEGLFRIMDPNRRAR* |
| Ga0070714_1018356911 | 3300005435 | Agricultural Soil | EPMEAVVITATLFGSFATAFVIQKAALEGLFRMMATNRRERE* |
| Ga0070713_1018912362 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MEALLISATLVGSFFGAFVLQKAALEGLFRVMNAERRRE* |
| Ga0070681_120103741 | 3300005458 | Corn Rhizosphere | PMDALLIGATLLSSFVGAFALQKAALEGLFRAMDADRRARQ* |
| Ga0068867_1006961172 | 3300005459 | Miscanthus Rhizosphere | LLYTRLERLDPMEVVVITATLVGSFATAWAIQKTALEALFRVMAPNRRARE* |
| Ga0070737_1000211127 | 3300005524 | Surface Soil | MNALLIGATLAGSLVGAFAIQKAALQGLLHVMNAGRRTRR* |
| Ga0070741_104973062 | 3300005529 | Surface Soil | METLVLGATLAGSFIGAFVLQKAALEGLFRILSGERRVRD* |
| Ga0070741_105459582 | 3300005529 | Surface Soil | MDAFLIGATVFGSFLGAWALQKAALEGLFRMMDPGRRARH* |
| Ga0070741_109537712 | 3300005529 | Surface Soil | MEAVVITATLAGSFATAFVIQKFALEGLFRIMSPNRRARQ* |
| Ga0070679_1008330791 | 3300005530 | Corn Rhizosphere | MEAVLITAALAGSFATAFVIQKFALEGLFRMMSPNRRIRE* |
| Ga0070738_100152111 | 3300005531 | Surface Soil | MEAFVIAGALIGSFATAFFIQKAALEGLFRVIGPERADANSP |
| Ga0070738_100507446 | 3300005531 | Surface Soil | FVIAGALIGSFATAFFIQKAALEGLFRVIGPERRGRQ* |
| Ga0070738_100892622 | 3300005531 | Surface Soil | MEAFVIAGTLIGSLATAFFIQKAALEGLFRIMSDPDRRARQ* |
| Ga0070734_1000015370 | 3300005533 | Surface Soil | MDAFLIASTLVGSFVGAFVLQKAALEGLFRMMNAERRNQR* |
| Ga0070734_105225612 | 3300005533 | Surface Soil | MEALVITGTLLGSLAAAFALQKAALEGLFRFMKAERRSRH* |
| Ga0070735_102518252 | 3300005534 | Surface Soil | MDALLISATVVGSFLGAFALQKAALEGLFRMMDTDRRDRRQSS* |
| Ga0070684_1001183464 | 3300005535 | Corn Rhizosphere | MEAFVIGVTLFGSFLGAFVLQKAALEGLFRMMQTDRRARQ* |
| Ga0070730_102025162 | 3300005537 | Surface Soil | MDALVIAATLVGTCAGAFVLQKAALEGLFRMMQAERRERR* |
| Ga0070731_106289082 | 3300005538 | Surface Soil | MDAFVIAATLFGSFAGAFALQKVALEGLLRILNADAAQAIN |
| Ga0070733_101678702 | 3300005541 | Surface Soil | MDALLISATLFGSFLGAFALQKAALEGLFRIMDNERRDRH* |
| Ga0070732_100749283 | 3300005542 | Surface Soil | MDGFVIGATVLGSFVGAFVIQKAALEGLFRIMITGRRPRH* |
| Ga0070732_107011492 | 3300005542 | Surface Soil | MDAVLIASTLVGSFVGAFVIQKAALEGLFRMMDADRRHHR* |
| Ga0070686_1017450443 | 3300005544 | Switchgrass Rhizosphere | PMEAVVITATLFGSFATAWAIQKTALEALFRMMSPNRRARE* |
| Ga0070665_1006538802 | 3300005548 | Switchgrass Rhizosphere | MEAFVIGATLFGSFFGAFAIQKAALEGLFRMMTPERRTRE* |
| Ga0068855_1020865611 | 3300005563 | Corn Rhizosphere | ITAALFGSFASAFVIQKAALEGLFRMMSPNRRARG* |
| Ga0068855_1020910022 | 3300005563 | Corn Rhizosphere | MAAVLITAAVAGSFATAFVIQKAALEGLFRMMTPNRRARQ* |
| Ga0070761_106586762 | 3300005591 | Soil | MEAIVIVGAVVGSFAGAFVLQKAALEGLFRMMNADRRTRR* |
| Ga0070762_101609752 | 3300005602 | Soil | MEAIVIVGAVVGSFAGAFVLQKAALEGLFRMMNADRRARH* |
| Ga0070740_100283756 | 3300005607 | Surface Soil | MEAFVIAGALIGSFATAFFIQKAALEGLFRVIGPERRGRQ* |
| Ga0075035_14511022 | 3300005640 | Permafrost Soil | MEAFVIAGTLLGSFVGAFALQKAALEGLFRVMNSGARRVRQ* |
| Ga0066903_1017797241 | 3300005764 | Tropical Forest Soil | MEAVVVTATLVGSFATAWAIQRTALEALLRVMATNRRDHE* |
| Ga0066903_1025359842 | 3300005764 | Tropical Forest Soil | MEALLIGATLIGSFWGAMVLQKAALERLFRAMNAGRRTRE* |
| Ga0066903_1029692922 | 3300005764 | Tropical Forest Soil | MEAFVIAWALIASFATAFVIQKAALQGLFRIINPDRRARQ* |
| Ga0066903_1054977392 | 3300005764 | Tropical Forest Soil | MEAFVITATLFGSFLGAFYIQKAALEGLFRVMDPQRRVRD* |
| Ga0075271_100706103 | 3300005899 | Rice Paddy Soil | LPVDSFVIAAILVGSVAGAFLLQKVALQGLFRIMGAGRRARQ* |
| Ga0070766_104896102 | 3300005921 | Soil | MEAIVIVGTVVGSFAGAFVLQKAALEGLFRMMNADRR |
| Ga0070766_106135232 | 3300005921 | Soil | MDAFVIASTLVGSFVGAFVIQKAALEGLFRMMNSDRRHHK* |
| Ga0066788_100165543 | 3300005944 | Soil | MEAIVIAATLVGSFVGALALQKAALEGLFRIMGAPRSDRQ* |
| Ga0070717_118022952 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MEAVVITATLFGSFATAFVIQKAALEGLFRMMATNRRERE* |
| Ga0066696_110941553 | 3300006032 | Soil | MEAFVITATLVGSFATAFVIQKAALEGLFRMIDPNRRERQ* |
| Ga0075029_10000337411 | 3300006052 | Watersheds | MDAFVISATLVGSFLAAFVLQKAALEGLFRMMGRTRH* |
| Ga0075029_1005472283 | 3300006052 | Watersheds | MEAFVVAATLVGSFAGAFALQKVALEGLIRLMSSPRRARQ* |
| Ga0075015_1003108262 | 3300006102 | Watersheds | METVVVTVTLLGSFAGAFALQKVALEGLIRLMSSPRRARQ* |
| Ga0066660_103659983 | 3300006800 | Soil | PVIARMGTMDALLIAATLLSSFLGAFALQKAALEGLFRAMQANRRVRE* |
| Ga0079221_103457642 | 3300006804 | Agricultural Soil | MDAFVVGTAVIGSFLGAFAIQKAALEGLLRLMDGGRRRTSQS* |
| Ga0073928_101937032 | 3300006893 | Iron-Sulfur Acid Spring | MEAFVIGATLLGSFVGAFALQKAALEGLFRIMDTGRRARD* |
| Ga0079219_101451423 | 3300006954 | Agricultural Soil | MEAFVIGATLFGSFLGAFAIQKAALEGLFRMMTPERRPHE* |
| Ga0099830_104706042 | 3300009088 | Vadose Zone Soil | MDAVVIAATLLSSFLGAFALQKAALEGLFRAMQANRRVRD* |
| Ga0105240_1000559512 | 3300009093 | Corn Rhizosphere | MEAFVIGATLFGSFLGAFILQKAALEGLFRMMQTDRRARQ* |
| Ga0105240_127760602 | 3300009093 | Corn Rhizosphere | MEAVVITATLFTSFAAAFAIQKAALEGLFRMMDPNRRTRN* |
| Ga0105247_111340581 | 3300009101 | Switchgrass Rhizosphere | KGFSTMEAVVIASTLVGSFFGAFLIQKAALEGLFRMMNAERRTHE* |
| Ga0066709_1036468692 | 3300009137 | Grasslands Soil | MEAVVITATLLGSFVGALAIQKAALEGLIRAMDADR |
| Ga0111538_137484892 | 3300009156 | Populus Rhizosphere | MEAVVITATLVGSFATAWAIQKTALEALFRAMSPNRRARQ* |
| Ga0075423_112970901 | 3300009162 | Populus Rhizosphere | MEAVVITATLVGSFATAWAIQKTALEALFRVMSPNRRARE* |
| Ga0105241_115791242 | 3300009174 | Corn Rhizosphere | MEAFVIGATLFGSFFGAFAIQKAALEGLFRMMTVERRPRE* |
| Ga0105248_131989793 | 3300009177 | Switchgrass Rhizosphere | METFVIAATLAGSFLGAFAIQKVALESLFRMMTSDRRIRQ* |
| Ga0116221_10093106 | 3300009523 | Peatlands Soil | MDALVIAATLVGSCAGAFVLQKAALEGLFRIMQTERRDRH* |
| Ga0116220_103111102 | 3300009525 | Peatlands Soil | MDAVLIASTLVGSFVGAFVIQKAALEGLFRIMNADRRNHR* |
| Ga0105238_123212442 | 3300009551 | Corn Rhizosphere | MPGDSSTMEAFVIGATLFGSFLGAFAIQKAALEGLFRIMTPERRPRE* |
| Ga0116129_100006827 | 3300009633 | Peatland | MAMEAIVIVGTMVGSFAGAFVLQKAALEGLFRMMNADRRTRH* |
| Ga0116118_11409352 | 3300009637 | Peatland | MEAVIIGATLLSSFVGAFAIQKVALEGLFRIMETERRA |
| Ga0105856_11057592 | 3300009662 | Permafrost Soil | MEAFVIAGTLLGSFVGAFALQKAALDGLFRMMNSGARRVRQ* |
| Ga0116135_10522971 | 3300009665 | Peatland | EGMAMEAIVIVGTMVGSFAGAFVLLKAALEGLFRMMNADRRTRH* |
| Ga0116224_104512433 | 3300009683 | Peatlands Soil | VIGATLVGCFAGAFAIQKAALEGLFRIMDRDLRASRH* |
| Ga0116216_107341522 | 3300009698 | Peatlands Soil | MDVIVIGATLVGCFAGAFAIQKAALEGLFRIMDRDLRASRH* |
| Ga0116217_102605592 | 3300009700 | Peatlands Soil | MDAFLIGATLVGSFLGAFALQKAALEGLFRIMDTGRRARH* |
| Ga0116217_105728141 | 3300009700 | Peatlands Soil | MDALVIAATLVGSCAGDFVLQKAALEGLFRIMLTERRDRH* |
| Ga0116219_101047242 | 3300009824 | Peatlands Soil | MDAFLIGATLVGSFQGAFALQKAALEGLFRIMDTGRRARH* |
| Ga0116219_104219011 | 3300009824 | Peatlands Soil | MTMDALVIAATLVGTCAGAFLLQKAALEGLLRIMVTEERRSRH* |
| Ga0126304_106862471 | 3300010037 | Serpentine Soil | MEAVVITATLIGSFATAWAIQKTALEALFRMMAPNRRARE* |
| Ga0126384_121140081 | 3300010046 | Tropical Forest Soil | MMDALVVGTTVVGSFLGAFLLQKAALQKLFRMMNAERRARH* |
| Ga0126373_105983831 | 3300010048 | Tropical Forest Soil | MEAVIIMGAVVASFAGAFALQKAALEGLFRMMNHDRRVRQ* |
| Ga0126373_109161773 | 3300010048 | Tropical Forest Soil | MEAFVIAGALIASFATAFVIQKAALQGLFRIINPDRRARQ* |
| Ga0126373_114216091 | 3300010048 | Tropical Forest Soil | MDALLIGGTLLGSLVGAFVIQKAALEGLFRVMNLDRRLRN* |
| Ga0126373_116714241 | 3300010048 | Tropical Forest Soil | MEAVIIIGAVVGSFAGAFALQKAALEGLFRMMNHDRRVRQ* |
| Ga0126318_104299471 | 3300010152 | Soil | IGATLVGSFAGAFMLQKVALEGLFRLMDTGRRARQ* |
| Ga0126318_109782032 | 3300010152 | Soil | VIGATLVGSFAGAFVLQKAALEGLFRLMDTGRRARH* |
| Ga0126376_124057422 | 3300010359 | Tropical Forest Soil | MEAIVITATLVGSFVGALALQKAALEGLFRAMDAGRRSTRE* |
| Ga0126376_131358281 | 3300010359 | Tropical Forest Soil | SATLFGSFVGAFVLQKAALEGLFRVMSAERRPRE* |
| Ga0126378_110536393 | 3300010361 | Tropical Forest Soil | MEALLIGATVIGSFWGAMVLQKAALERLFRAMNAGRRTRE* |
| Ga0126378_120645381 | 3300010361 | Tropical Forest Soil | VGAVVASFAGAFALQKAALEGLFRMMNHDRRVRQ* |
| Ga0126377_103695833 | 3300010362 | Tropical Forest Soil | METLVIAATLIGSFAGAFAIQKAALEGFFRYMDSGRRARHQ* |
| Ga0126377_107038742 | 3300010362 | Tropical Forest Soil | METLLIAVTLFGSFLGAVAIQKMALEGLFRAMNMDRRTRE* |
| Ga0126377_109993943 | 3300010362 | Tropical Forest Soil | METLVIAVTLIGSVAGAFALQKAALEGIFRFMDADRRARQ* |
| Ga0126379_138192322 | 3300010366 | Tropical Forest Soil | MEAFVIAGTLIGSFATAFWIQKAALEGLFRIMDPNRRTR* |
| Ga0134128_1000008595 | 3300010373 | Terrestrial Soil | MDAFVIGATLVGSFAGAFVLQKVALEGLFRLMDSGRRARQ* |
| Ga0126381_1008689433 | 3300010376 | Tropical Forest Soil | MEALLIGATLIGSFWGAMVLQKAALERLFRAMSAGRRAR* |
| Ga0126381_1038441111 | 3300010376 | Tropical Forest Soil | REVRAMEAVIVVGTVIGSFAAAFWLQKAAREGLFRIITTERRVRD* |
| Ga0136449_1036411032 | 3300010379 | Peatlands Soil | MDALVIAATLVGSCAGAFVLQKAALEGLFHIMRTER |
| Ga0134124_109811322 | 3300010397 | Terrestrial Soil | MDAVVIASTLVGSFLGAFVIQKAALEGLIRMMNIERRTQK* |
| Ga0126383_135597352 | 3300010398 | Tropical Forest Soil | MEAVMIVGAVVVSFAGAFALQKAALEGLFRMMNHDRRVRQ* |
| Ga0134127_115708572 | 3300010399 | Terrestrial Soil | MEVVVITATLVGSFATAWAIQKTALEALFRVMAPTRRARE* |
| Ga0134127_135873041 | 3300010399 | Terrestrial Soil | MDALVVATTLIASFLGAFVLQKAALQKFFRMMDSGRRRE* |
| Ga0134122_122092163 | 3300010400 | Terrestrial Soil | DALVIAATVVGSFAGAFALQRVALEGLLRMMQVDRRARQ* |
| Ga0138572_10949372 | 3300011077 | Peatlands Soil | MDALVIAATLVGSCAGAFVLQKATLEGLFRIMQTERRDRH* |
| Ga0105246_108333282 | 3300011119 | Miscanthus Rhizosphere | MEVVVITATLVGSFATAWAIQKTALEALFRVMAPNRRARE* |
| Ga0150983_103152781 | 3300011120 | Forest Soil | VKAEGMAMEAIVIVGTVVGSFAGAFVLQKAALEGLFRMMNADRRTRH* |
| Ga0150983_109297172 | 3300011120 | Forest Soil | MDAVLIASTLVGSFVGAFVIQKAALEGLFRMMNAERRNHR* |
| Ga0150983_118340563 | 3300011120 | Forest Soil | MDALLITATLAGSFLGAFALQKAALEGLFRIMGAERRERQ* |
| Ga0150983_119289932 | 3300011120 | Forest Soil | MDAVVIASTLVGSFVGAFVIQKAALEGLFRIMNTERRTRR* |
| Ga0150983_128175701 | 3300011120 | Forest Soil | MDAVLIASTLVGSFYGAFVIQKAALEGLFRIMDADRRTRH* |
| Ga0150983_135440881 | 3300011120 | Forest Soil | MDALLISATLFGSFVGAFALQKMALEGLFRMMGSERRERH* |
| Ga0150983_138242251 | 3300011120 | Forest Soil | MDALLITATLAGSFLGAFALQKAALEGLFRIMSAERRERQ* |
| Ga0150983_138591662 | 3300011120 | Forest Soil | VMETVVVIGALVGSFAGAFALQKAALEGLFRIMNSDRRLRQ* |
| Ga0150983_150742561 | 3300011120 | Forest Soil | RMDALVIAATLVGSCAGAFVLQKAALEGLFRMMQVERRERR* |
| Ga0150983_158724333 | 3300011120 | Forest Soil | MDALVIAATLVGSCAGAFVLQKAALEGLFRIMQTERRPRR* |
| Ga0150983_159491721 | 3300011120 | Forest Soil | MDAVLIASTLVGSFVGAFVIQKAALEGLFRMMNSERRNHR* |
| Ga0150983_161451622 | 3300011120 | Forest Soil | MDAVLIASTLVGSFVGAFVIQKAALEGLFRMMNADRRNHR* |
| Ga0126317_105355371 | 3300011332 | Soil | EMEAVLIVATLFASFAGAFAIQKAALEGLFRMMDTDRHIRH* |
| Ga0137389_116232511 | 3300012096 | Vadose Zone Soil | GTMDAVVIAATLLSSFLGAFALQKAALEGLFRAMQANRRVRD* |
| Ga0137378_101277502 | 3300012210 | Vadose Zone Soil | MDALLIAATLVGSCAGAFVLQKAALEGLFRMMQTERRARR* |
| Ga0150985_1005085601 | 3300012212 | Avena Fatua Rhizosphere | MEAFVITATLVGSFATAFYIQRAALEGLFRMMDPNRRERQ* |
| Ga0150985_1032843862 | 3300012212 | Avena Fatua Rhizosphere | MEAVVITATLFGSFATAWAIQKTALEALFRMMSPDRRARQ* |
| Ga0150985_1036468871 | 3300012212 | Avena Fatua Rhizosphere | MEAVVITATLAGSLATAFVIQKFALEGLFRMMSPNRRARQ* |
| Ga0150985_1047762791 | 3300012212 | Avena Fatua Rhizosphere | MEAFVITATLVGSFATAFFIQRAALEGLFRMMDPNRRERQ* |
| Ga0150985_1060978821 | 3300012212 | Avena Fatua Rhizosphere | MEAFVITATLFGSFATAFVIQRAALEGLFRMMDPNRRERQ* |
| Ga0150985_1087115153 | 3300012212 | Avena Fatua Rhizosphere | VVIASTLVGSFLGAFVIQKAALEGLMRMMNAERRTEK* |
| Ga0150985_1103824012 | 3300012212 | Avena Fatua Rhizosphere | MDTLLIAATLFSSFLGACALQKAALEGLFRAMNADRRARE* |
| Ga0150985_1106963352 | 3300012212 | Avena Fatua Rhizosphere | MEAFVITATLFGSFATAFFIQRAALEGLFRMMDPNRRERQ* |
| Ga0150985_1108868532 | 3300012212 | Avena Fatua Rhizosphere | METLVIAGTLLGSLAAAFALQKAALESLFRIMDADRRARD* |
| Ga0150985_1124074933 | 3300012212 | Avena Fatua Rhizosphere | MEAFVITAALFGSFATAFYIQRAALEGLFRMMDPNRRERS* |
| Ga0150985_1129596672 | 3300012212 | Avena Fatua Rhizosphere | MEAAVITVTLIGSFWAAFALQKAALEGLFRVMDVNRRARD* |
| Ga0150985_1151857963 | 3300012212 | Avena Fatua Rhizosphere | MEALLISATLVGSFFGAFVLQKAALEGLFRVMNAERRFRE* |
| Ga0150985_1156863332 | 3300012212 | Avena Fatua Rhizosphere | MEAVVITATLFGSFATAWAIQKTALEALFRAMSPERRARE* |
| Ga0150985_1176374942 | 3300012212 | Avena Fatua Rhizosphere | MEAVLITGALFGSFATAFVIQKAALEGLFRMMSPSRRARQ* |
| Ga0150985_1181485463 | 3300012212 | Avena Fatua Rhizosphere | MEAIVIGATLLSSFVGAFALQKAALEGLFRAMNADRRARQ* |
| Ga0150985_1186677911 | 3300012212 | Avena Fatua Rhizosphere | MDTLVIAGTLLGSLAAAFGLQKMALESLFRIMDAERRSRQ* |
| Ga0150985_1203975762 | 3300012212 | Avena Fatua Rhizosphere | METVVITAALFGSFATAWAIQKTALEALFRMMSPDRRARQ* |
| Ga0150985_1204745782 | 3300012212 | Avena Fatua Rhizosphere | MDAFLITATLFGSFATAFYIQRAALEGLFRMMDPNRRERQ* |
| Ga0150985_1210597312 | 3300012212 | Avena Fatua Rhizosphere | ALPICLNREAFVIGATLFGSFFGAFAIQKAALEGLFRMMTPERRPRE* |
| Ga0150985_1211102261 | 3300012212 | Avena Fatua Rhizosphere | TATLFGSFATAWAIQKTALEALFRMMNPDRRARQ* |
| Ga0150985_1212683042 | 3300012212 | Avena Fatua Rhizosphere | MEAIVIAGTLVGSAAAAFVLQKAALESIFRLMAAGQGRRDRA* |
| Ga0137372_107909051 | 3300012350 | Vadose Zone Soil | MEAIVITATLVGSFVGALAIQRAALEGLFRAMDADRRSGRE* |
| Ga0150984_1090727841 | 3300012469 | Avena Fatua Rhizosphere | QMDAVVIAGTLLGSVVAAFALQKAALEGLFRIMDAERRTRL* |
| Ga0150984_1118083272 | 3300012469 | Avena Fatua Rhizosphere | MEAAVITVTLIGSLWGAFALQKAALEGLFRVMDVNRRARE* |
| Ga0150984_1141098312 | 3300012469 | Avena Fatua Rhizosphere | MEALLISATLVGSFFGAFVLQKAALEGLFRVMNAERHLRE* |
| Ga0150984_1142806343 | 3300012469 | Avena Fatua Rhizosphere | FVITAALFGSFATAFYIQRAALEGLFRMMDPNRRERP* |
| Ga0150984_1152847232 | 3300012469 | Avena Fatua Rhizosphere | MEALVIGATLLSSFVGAFALQKAALEGLFRAMNADRRARQ* |
| Ga0150984_1165979032 | 3300012469 | Avena Fatua Rhizosphere | MDALLIAATLFSSFLGAFALQKAALEGLFRAMNADRRTRE* |
| Ga0150984_1230840602 | 3300012469 | Avena Fatua Rhizosphere | MEAFVIGATVFGSFLGAFAIQKAALEGLFRMMTPERRLRE* |
| Ga0137404_110386082 | 3300012929 | Vadose Zone Soil | MDALLIAVTLFSSFLGAFVLQKAALEGLFRAMNADRRERE* |
| Ga0137407_123728451 | 3300012930 | Vadose Zone Soil | MDAVLIASTLVGSFVGAFVIQKAALEGLFRMMNAERRNQR* |
| Ga0164299_113086402 | 3300012958 | Soil | MEAVVITATLVGSFATAWAIQKTALEALFRVMSPDRRARQ* |
| Ga0157373_113236602 | 3300013100 | Corn Rhizosphere | TMEAFVIGATLFGSFLGAFAIQKAALEGLFRMMTPERRPHE* |
| Ga0157370_113660041 | 3300013104 | Corn Rhizosphere | MEAVVITAALFGSFASAFVIQKAALEGLLRMMSPNRRARG* |
| Ga0157369_123584221 | 3300013105 | Corn Rhizosphere | MAGEVKPMEAVVITAALFGSFASAFVIQKAALEGLLRMMSPNRRARG* |
| Ga0157378_122112702 | 3300013297 | Miscanthus Rhizosphere | MEVVVITATLVGSFATAWAIQKTALEALFRVLAPNRRARE* |
| Ga0157378_124284712 | 3300013297 | Miscanthus Rhizosphere | MEAFVITATLFGSFATAFFIQRAALEGLFRMMDPNRRERP* |
| Ga0157378_125059552 | 3300013297 | Miscanthus Rhizosphere | MGEEGNPMETLVIAGTLFGSLAAAFALQKAALEGLFRFMEADRRSRD* |
| Ga0163162_119030082 | 3300013306 | Switchgrass Rhizosphere | MGEEGNPMETLVIAGTLFGSLAAAFALQKAALEGLF |
| Ga0157372_105787072 | 3300013307 | Corn Rhizosphere | MPGDSSTMEAFVIGATLFGSFLGAFAIQKAALEGLFRMMTPERRPHE* |
| Ga0157372_111619513 | 3300013307 | Corn Rhizosphere | VIGATLLGRFVGAFALQKAALEGLFRMMETDRRARH* |
| Ga0181533_10451202 | 3300014152 | Bog | MEAFVIGATLLGSFVGAFLLQKVALEGLFRWMDASRRARQ* |
| Ga0157380_121281842 | 3300014326 | Switchgrass Rhizosphere | MEAIIITTTVFGSFFGAFLLQKAALQGFFRMMETERRARQ* |
| Ga0157380_130974892 | 3300014326 | Switchgrass Rhizosphere | MEAVVITAALAGSFATAWAIQKTALEALFRVLSPNRRARQ* |
| Ga0157380_134453221 | 3300014326 | Switchgrass Rhizosphere | WKMEAIVIATTVFGSAFGAFLLQKAALEGLFRMLNADRRARY* |
| Ga0182024_100904296 | 3300014501 | Permafrost | MDAIVIVGAVVGSFAGAFVLQKAALEGLFRMMNADRRARH* |
| Ga0182024_104962263 | 3300014501 | Permafrost | MAMAAIVIVGAVVGSFAGAFVLQKAALEGLFRMMNADRRTRRE* |
| Ga0182024_106216213 | 3300014501 | Permafrost | MEAIVIVGAVVGSFAGAFVLQKAALEGLFRMMNADRRARR* |
| Ga0182024_114192833 | 3300014501 | Permafrost | MEAIVVVGAVVGSFAGAFVLQKAALEGLFRMMNADRRTRH* |
| Ga0157377_117410122 | 3300014745 | Miscanthus Rhizosphere | MEAVVITATLVGSFATAWAIQKTALEALFRMMSPDRRARQ* |
| Ga0157376_110777231 | 3300014969 | Miscanthus Rhizosphere | MDAFVITAALFGSFAGAFILQKAALEGLFRIMQMERRARQ* |
| Ga0167638_10027711 | 3300015197 | Glacier Forefield Soil | MEAFVIAGTLLGSFAGAFALQKVALEGLFRLMNVDRRIRQ* |
| Ga0137412_104846684 | 3300015242 | Vadose Zone Soil | MDAVLIASTLVGSFFGAFLIQKAALEGLFRMMNAERRTHE* |
| Ga0132258_139046573 | 3300015371 | Arabidopsis Rhizosphere | MEAFVIGATLFGSFLGAFAIQKAALEGLFRIMNAERRPRE* |
| Ga0132257_1014416252 | 3300015373 | Arabidopsis Rhizosphere | MEAVVITATLFGSIAAAWAIQKTALEALFRVMSPDRRARQ* |
| Ga0182039_117139981 | 3300016422 | Soil | METFVVATTLFGSFVGAFALQKVALEGFLRLIEDRRTRE |
| Ga0182038_118894542 | 3300016445 | Soil | MEALVITGTLLGSLAAAFALQKVALEGLFRFMKTERRSRQ |
| Ga0187818_103875342 | 3300017823 | Freshwater Sediment | MDALVIAATLVGSCAGAFVLQKAALEGLFRIMQTERRDRH |
| Ga0187817_101744513 | 3300017955 | Freshwater Sediment | METFVIAATLVGSFVGAFVVQKAALGGLMRLLNGRRTRE |
| Ga0187783_105300932 | 3300017970 | Tropical Peatland | MEAFVIGATAIGSFAAAFVIQKAALEGLFRILSGERRIRQ |
| Ga0187783_110148861 | 3300017970 | Tropical Peatland | MEAVIVIGTVIGSFAGAFWLQKAALEGLFRIMHTDRRVRH |
| Ga0187780_101870754 | 3300017973 | Tropical Peatland | MEAFVIAGVLIGSFATAFFIQKAALEGLFRIIDPERRARQ |
| Ga0187859_105075152 | 3300018047 | Peatland | VQEDEDMDAVVVVGAVIGSFAGAFVLQKAALEGLFRMMNADRRLKQ |
| Ga0187784_116916151 | 3300018062 | Tropical Peatland | MDALLIGGTLVGSVIGAFVIQKAALEGLLRIMHGDRRLRS |
| Ga0066655_108903632 | 3300018431 | Grasslands Soil | MEAFVITATLFGSFATAFFIQRAALEGLFRMMDPNRRERQ |
| Ga0066662_120181262 | 3300018468 | Grasslands Soil | MEAFVIATTVLGSFLGAFALQKFALEGLFRVMSWERRERQ |
| Ga0066669_103887333 | 3300018482 | Grasslands Soil | MEAVLITATLFGSFATAFYIQRAALEGLFRMMDSNRRDRH |
| Ga0184647_13077132 | 3300019263 | Groundwater Sediment | MEAVVITAALVGSFATAWAIQKTALEALFRVMSPDRRARQ |
| Ga0137408_13105042 | 3300019789 | Vadose Zone Soil | MDALLIAVTLFSSFLGAFVLQKAALEGLFRAMNADRRERE |
| Ga0197907_102463612 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | MEAVLITAALAGSFATAFVIQKFALEGLFRMMSPNRRVRE |
| Ga0197907_112756681 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | PMEAVVITAALFGSFASAFVIQKAALEGLFRMMSPNRRARG |
| Ga0206356_113302492 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MAGEVKPMEAVVITAALFGSFASAFVIQKAALEGLLRMMSPNRRARG |
| Ga0196963_100198334 | 3300020215 | Soil | MEAVVVTATLVGSFATAWAIQKSALEALFRAMSPNRRRRE |
| Ga0210399_104870563 | 3300020581 | Soil | METIVIAATLVGSFAGAFALQKAALEGLFRIMAAPRPSEAQAFRRR |
| Ga0210401_101132392 | 3300020583 | Soil | MEALIISATVFGSFLGAFALQKAALEGLFRMMGTDRRSRQ |
| Ga0210405_107761632 | 3300021171 | Soil | MDAVLIASTLVGSFVGAFVIQKAALEGLFRMMNADRRNHR |
| Ga0210396_109241453 | 3300021180 | Soil | MDALVISATLFGSFLGAFALQKAALEGLFRMMGSERRHRQ |
| Ga0213876_100387632 | 3300021384 | Plant Roots | MDAFVIGATLVGSLAGAFAIQKVALEGLFRLMTVERRARH |
| Ga0213876_101246212 | 3300021384 | Plant Roots | MDAFVIGATLVGSLAGAFAIQKVALEGLFRLMTVERRARD |
| Ga0210386_115105943 | 3300021406 | Soil | MDAFVIGATLFGSFVGAFALQKAALEGLFRIMDTGRRTRH |
| Ga0210383_115210961 | 3300021407 | Soil | MDAVLIASTLVGSFVGAFVIQKAALEGLFRMMNAERRNHR |
| Ga0210384_110829252 | 3300021432 | Soil | MEALVITGTLLGSLAAAFALQKAALEGLFRFMKAERRSRQ |
| Ga0210384_116629542 | 3300021432 | Soil | MEAVIVIGTVIGSFAGAFWLQKAALEGLFRIMHAERRVRD |
| Ga0210402_103232532 | 3300021478 | Soil | MEALVIAGTLLGSVAAAFALQKVTLASLLRMMDADRRSRE |
| Ga0210409_112998212 | 3300021559 | Soil | MEAFVIAGTLLGSFAGAFALQKAALEGLFRMMNADRRVRQ |
| Ga0126371_102484803 | 3300021560 | Tropical Forest Soil | REVRAMEAVIIIGAVVGSFAGAFALQKAALEGLFRMMNHDRRVRQ |
| Ga0126371_107777372 | 3300021560 | Tropical Forest Soil | MDALVIAGTLVASFAAAVALQRAALEGLFRAMNAERRTRE |
| Ga0126371_110355441 | 3300021560 | Tropical Forest Soil | MDTLVIGGTLLGSFVGAFVIQKAALEGLFRMLKAERRARR |
| Ga0126371_113807963 | 3300021560 | Tropical Forest Soil | REGKMETVVIAAALVGSFAGAFVIQKAALEGLFRIMDPNRRAR |
| Ga0126371_119819991 | 3300021560 | Tropical Forest Soil | MEAVIIIGAVVGSFAGAFALQKAALEGLFRMMNHDRRVRQ |
| Ga0126371_126501041 | 3300021560 | Tropical Forest Soil | MEAFVIAGTLIGSFATAFWIQKAALEGLFRIMNPN |
| Ga0126371_133682422 | 3300021560 | Tropical Forest Soil | METVVIAATLLGSFAGAFLLQKVALEGLFRMMDPGRRVRQ |
| Ga0213853_111204411 | 3300021861 | Watersheds | MEAFVIAATLVGSFVGALALQKAALEGLFRIMGAPRRARQ |
| Ga0224712_102943921 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | TMEAFVIGVTLFGSFLGAFVLQKAALEGLFRMMQTDRRARQ |
| Ga0224712_104655821 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | EMEAVLITAALAGSFATAFVIQKFALEGLFRMMSPNRRVRE |
| Ga0242642_10965101 | 3300022504 | Soil | ALVISATLFGSFLGAFALQKAALEGLFRMMGSERRQRQ |
| Ga0222728_10473863 | 3300022508 | Soil | DALVISATLFGSFLGAFALQKAALEGLFRMMGSERRQRQ |
| Ga0242652_10506823 | 3300022510 | Soil | LVISATLFGSFLGAFALQKAALEGLFRMMGSERRQRQ |
| Ga0242663_11178371 | 3300022523 | Soil | IASTLVGSFVGAFVLQKAALEGLFRVMNAERRNQR |
| Ga0242658_11256543 | 3300022530 | Soil | DALLISATLFGSFLGAFALQKAALEGLFRMMGSERRQRQ |
| Ga0242660_10669421 | 3300022531 | Soil | KMDALLISATLFGSFLGAFALQKAALEGLFRMMGSERRQRQ |
| Ga0242660_11755371 | 3300022531 | Soil | AVLIVATLIASFAGAFAIQKAALEGLFRMMDTDRHIRH |
| Ga0242655_103352772 | 3300022532 | Soil | MDAFVIASTLVGTFVGAFVIQKAALEGLFRMMNADRRHQR |
| Ga0242662_100935523 | 3300022533 | Soil | ISATLFGSFLGAFALQKAALEGLFRMMGSERRQRQ |
| Ga0242662_100991402 | 3300022533 | Soil | MDAFLIAATLVGSFAGAFVLQKAALEGLLRMMDLDRRSRH |
| Ga0212123_102724763 | 3300022557 | Iron-Sulfur Acid Spring | MEAFVIGATLLGSFVGAFALQKAALEGLFRIMDTGRRARD |
| Ga0242657_10298251 | 3300022722 | Soil | KMDALVISATLFGSFLGAFALQKAALEGLFRMMGSERRQRQ |
| Ga0242657_12046471 | 3300022722 | Soil | MEAIVIVGAVVGSFAGAFVLQKAALEGLFRMMNADRRTRH |
| Ga0242665_100412261 | 3300022724 | Soil | MDALLIIARLFGSFLGAFALQKAALEGLFRMMGSERRHRQ |
| Ga0242665_103602322 | 3300022724 | Soil | TMEAFVIASTLVGSFYGAFVIQKAALEGLFRIMDADRRTRH |
| Ga0208193_100012228 | 3300025463 | Peatland | MEAIVIVGTMVGSFAGAFVLQKAALEGLFRMMNADRRTRH |
| Ga0207710_104763651 | 3300025900 | Switchgrass Rhizosphere | KGFSTMEAVVIASTLVGSFFGAFLIQKAALEGLFRMMNAERRTHE |
| Ga0207685_104384992 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | METFVITATLFGSFATAFFIQRAALEGLFRMMDSNRRERQ |
| Ga0207707_107169121 | 3300025912 | Corn Rhizosphere | MEALLIGVTLFGSFLGAFAIQKAALEGLFRVMDAERRARH |
| Ga0207695_100111716 | 3300025913 | Corn Rhizosphere | MEAFVIGATLFGSFLGAFILQKAALEGLFRMMQTDRRARQ |
| Ga0207693_101921001 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MEAVLITAALAGSFATAFVIQKAALEGLFRMMTPNRRARQS |
| Ga0207661_10000019168 | 3300025944 | Corn Rhizosphere | MEAVVITATLAGSFATAFVIQKFALEGLFRMMSPNRRARE |
| Ga0207661_116481862 | 3300025944 | Corn Rhizosphere | MEAFVIGVTLFGSFLGAFVLQKAALEGLFRMMQTDRRARQ |
| Ga0207667_104203282 | 3300025949 | Corn Rhizosphere | MEAVVITATLAGSFATAFVIQKFALEGLFRIMSPNRRARQ |
| Ga0207667_108171971 | 3300025949 | Corn Rhizosphere | ITAALFGSFASAFVIQKAALEGLFRMMSPNRRARG |
| Ga0207667_117543212 | 3300025949 | Corn Rhizosphere | MAAVLITAAVAGSFATAFVIQKAALEGLFRMMTPNRRARQ |
| Ga0207703_103075643 | 3300026035 | Switchgrass Rhizosphere | MEVVVITATLVGSFATAWAIQKTALEALFRVMAPNRRARE |
| Ga0207675_1012794043 | 3300026118 | Switchgrass Rhizosphere | MDAVVIASTLVGSFLGAFVIQKAALEGLMRMMNTERRTEK |
| Ga0179593_10867652 | 3300026555 | Vadose Zone Soil | MEAFVIASTLVGSFLGAFLVQKAALEGLFRIMNAERRTHR |
| Ga0208043_10655102 | 3300027570 | Peatlands Soil | MDALVIAATLVGSCAGAFVLQKAALEGLFRIMLTERRDRH |
| Ga0209009_11052591 | 3300027667 | Forest Soil | MEAIVIVGTVVGSFAGAFVLQKAALEGLFRMMNADRRTRQ |
| Ga0209581_10290462 | 3300027706 | Surface Soil | MEAFVIAGALIGSFATAFFIQKAALEGLFRVIGPERRGRQ |
| Ga0209039_100194414 | 3300027825 | Bog Forest Soil | MEDLLLIGATVFGSFVDAFVLQKAALKGFFRIMGTERRARR |
| Ga0209060_100003796 | 3300027826 | Surface Soil | MDAFLIASTLVGSFVGAFVLQKAALEGLFRMMNAERRNQR |
| Ga0209580_100484472 | 3300027842 | Surface Soil | MDGFVIGATVLGSFVGAFVIQKAALEGLFRIMITGRRPRH |
| Ga0209517_100488263 | 3300027854 | Peatlands Soil | MDALVIAATLVGTCAGAFLLQKAALEGLLRIMVTEERRSRH |
| Ga0209701_106083091 | 3300027862 | Vadose Zone Soil | FPRIGTMDAVVIAATLLSSFLGAFALQKAALEGLFRAMQANRRVRD |
| Ga0209167_102320923 | 3300027867 | Surface Soil | MDALLISATLFGSFLGAFALQKAALEGLFRIMDNERRDRH |
| Ga0209380_102985622 | 3300027889 | Soil | MEAIVIVGTVVGSFAGAFVLQKAALEGLFRMMNADRRARR |
| Ga0209067_100064803 | 3300027898 | Watersheds | MEAFVVAATLVGSFAGAFALQKVALEGLIRLMSSPRRARQ |
| Ga0209067_100145412 | 3300027898 | Watersheds | MDAFVISATLVGSFLAAFVLQKAALEGLFRMMGRTRH |
| Ga0209415_100382363 | 3300027905 | Peatlands Soil | MDVIVIGATLVGCFAGAFAIQKAALEGLFRIMDRDLRASRH |
| Ga0209006_106398552 | 3300027908 | Forest Soil | MEAIVIVGTIVGSFAGAFVLQKAALEGLFRMMNADRRT |
| Ga0209698_110400582 | 3300027911 | Watersheds | METVVVTVTLLGSFAGAFALQKAALEGLIRLMGSPRRARQ |
| Ga0209062_10816202 | 3300027965 | Surface Soil | MEAFVIAGTLIGSLATAFFIQKAALEGLFRIMSDPDRRARQ |
| Ga0209061_100163910 | 3300027968 | Surface Soil | MNALLIGATLAGSLVGAFAIQKAALQGLLHVMNAGRRTRR |
| Ga0268266_111435243 | 3300028379 | Switchgrass Rhizosphere | MEAFVIGATLFGSFFGAFAIQKAALEGLFRMMTPERRTRE |
| Ga0307504_102218352 | 3300028792 | Soil | MEAFVITTTLLGSFVGAFALQKAALEGLFRMMDPERRAAGSTPR |
| Ga0222749_102647242 | 3300029636 | Soil | MEAFVIGATLVGSFLGAFALQKAALEGLFRLMGPPRRQ |
| Ga0222749_106415431 | 3300029636 | Soil | MDAFVIASTLVGSFVGAFIIQKAALEGLFRMMNAERRTHR |
| Ga0311340_102057982 | 3300029943 | Palsa | MEAIVIVGTVVGSFAGAFVLQKAALEGLFRMMNADRRARH |
| Ga0311339_111974363 | 3300029999 | Palsa | MDAVVIVGAVVGSFAGAFILQKAALEGLFRIMNADRRMRH |
| Ga0316363_100693782 | 3300030659 | Peatlands Soil | MDALVIAATLVGSCAGAFVLQKAALEGLFRIMRTERRARH |
| Ga0316363_102972221 | 3300030659 | Peatlands Soil | MDAFLIGATLVGSFLGAFALQKAALEGLFRIMDTGRRARH |
| Ga0307482_12670431 | 3300030730 | Hardwood Forest Soil | SGEVKTMEAFVIGATLVGSFVGAFALQKAALEGLFRIMDTGRRARH |
| Ga0307482_12713403 | 3300030730 | Hardwood Forest Soil | MEAIVIVGTIVGSFAGAFVLQKAALEGLFRMMNADRRTRQ |
| Ga0307482_12844672 | 3300030730 | Hardwood Forest Soil | MDALLITATLAGSFLGAFALQKAALEGLFRIMGAERRERQ |
| Ga0073994_101179731 | 3300030991 | Soil | MDGVVIGATVIGSFVGALMIQKAALEGLFRIMQTGRRARQ |
| Ga0170834_1009796413 | 3300031057 | Forest Soil | GTKMDALLISATLFGSFLGAFALQKAALEGLFRMMGSERRQRQ |
| Ga0308189_105226671 | 3300031058 | Soil | TIVIAATLVGSFAGALALQKAALEGLFRMMGATRRTRD |
| Ga0170824_1104344972 | 3300031231 | Forest Soil | MDAFVIASTVVGSFLGAFLVQKAALEGLFRIMNAERRTHR |
| Ga0170824_1229139042 | 3300031231 | Forest Soil | MDALVIAGTLLGSAAAAFALQKAALESLFRIMDAGRRARE |
| Ga0170824_1287812643 | 3300031231 | Forest Soil | GTKMDALLISATLFGSFLGAFALQKAALDGLFRMMGSERRQRQ |
| Ga0302325_102670282 | 3300031234 | Palsa | MEAIVVVGAVVGSFAGAFVLQKAALEGLFRMMNADRRTRG |
| Ga0302325_105533823 | 3300031234 | Palsa | MEAIVIVGAVVGSFAGAFVLQKAALEGLFRMMNADRRTRQ |
| Ga0302325_108962223 | 3300031234 | Palsa | MEAIVIVGTVVGSFAGAFVLQKAALEGLFRMMNADRRTRR |
| Ga0302325_114666322 | 3300031234 | Palsa | MEAVLIAGAFVGSFAGAFVIQKAALEGLFRMMNADRRSRL |
| Ga0302324_1021700051 | 3300031236 | Palsa | EAIVIVGAVVGSFAGAFVLQKAALEGLFRMMDADRRARH |
| Ga0302324_1035121703 | 3300031236 | Palsa | MDAVVVIGAVVGSFAGAFLLQKAALEGLFRMMNADRRLRQ |
| Ga0318538_106372722 | 3300031546 | Soil | MEAFVIAGALIASFATAFVIQKAALQGLFRIINPDRRARQ |
| Ga0318572_109506633 | 3300031681 | Soil | ITGTLLGSLAAAFALQKAALEGLFRFMKTERRSRQ |
| Ga0310686_1095340535 | 3300031708 | Soil | MEAIVIVGAVVGSFAGAFVLQKAALEGLFRMMNADRRSRN |
| Ga0310686_1143247192 | 3300031708 | Soil | MEAIVIVGAVVGSFAGAFVLQKAALEGLFRMMNADRR |
| Ga0310813_120782022 | 3300031716 | Soil | MEAVVITATLFGSFATAWAIQKTALEALFRMMSPNRRARE |
| Ga0307474_115588142 | 3300031718 | Hardwood Forest Soil | MDALLISATLFGSFLGAFALQKAALEGLFRMMGSERRHRQ |
| Ga0318521_104939071 | 3300031770 | Soil | VITGTLLGSLAAAFALQKAALEGLFRFMKTERRSRQ |
| Ga0318568_110286262 | 3300031819 | Soil | MEALVITGTLLGSLAAAFALQKAALEGLFRFMKTERRSRQ |
| Ga0306925_120950171 | 3300031890 | Soil | MDTVVIGAALVGSFAGAFVIQKLALESLLRMMTTERRNRQ |
| Ga0306923_103730612 | 3300031910 | Soil | MEAFVIAGALIASFFAAFVIQKAALEGLFRIINPDRRARQ |
| Ga0306923_121409843 | 3300031910 | Soil | NTMDALVITGTLLGSLAAAFALQKAALEGLFRFMKTERRSRQ |
| Ga0308175_1011934372 | 3300031938 | Soil | MEAVVITATLFGSFATAWAIQKTALEALFRMMAPNRRVRE |
| Ga0308174_100115182 | 3300031939 | Soil | MEAFVIGATLLGSFVGAFALQKAALEGLFRMMETDRRARH |
| Ga0308174_100180622 | 3300031939 | Soil | MDAFVIGATLVGSFAGAFVLQKVALEGLFRLMDSGRRARQ |
| Ga0308174_103406423 | 3300031939 | Soil | GKGPTMEAFVITATLFGSFATAFFIQRAALEGLFRMMDPNRRERQ |
| Ga0306926_124084062 | 3300031954 | Soil | MDALVIAGTLLGSAAAAFALQKAALESLFRIMDAGRRTRQ |
| Ga0307479_108268332 | 3300031962 | Hardwood Forest Soil | MEAFVIAGTLIGSFATAFVIQKVALEGIFRIMDSERRPRQ |
| Ga0308176_111719363 | 3300031996 | Soil | MEAFVITATLFGSFATAFFIQRAALEGLFRMMAPNRRERQ |
| Ga0308176_120624083 | 3300031996 | Soil | KMEAFVIGATLLGSFVGAFALQKAALEGLFRMMETDRRARH |
| Ga0318575_106588212 | 3300032055 | Soil | MDALVITGTLLGSLAAAFALQKAALEGLFRFMKTE |
| Ga0316051_10212891 | 3300032119 | Soil | MAMEAIVIVGTVVGSFAGAFVLQKAALEGLFRMMNADRRARR |
| Ga0311301_115291253 | 3300032160 | Peatlands Soil | MDAVLIASTLVGSFVGAFVIQKAALEGLFRIMNADRRNHR |
| Ga0348332_102118552 | 3300032515 | Plant Litter | MDAIMIVGAVVGSFAGAFILQKAALEGMFRMMNADRRLRH |
| Ga0348332_124289843 | 3300032515 | Plant Litter | MEAIVIVGAVVGSFAGAFVLQKAALEGLFRMMNADRRARR |
| Ga0348332_135372432 | 3300032515 | Plant Litter | MEMDAVVIVGAVVGSFAGAFVLQRAALEGLFRIMNADRRTRH |
| Ga0335085_1000665212 | 3300032770 | Soil | MAAFVIGATLVGSFAGAFVLQKAALEGLFRWMDTGRRARQ |
| Ga0335085_100508564 | 3300032770 | Soil | MDAVVIAGALAASFATAFAIQKAALEGLFRIIGLGRRARQ |
| Ga0335085_100862303 | 3300032770 | Soil | MEAIVIAGALVCSFVTGFLIQKAALKGLFRIIDPDRRARQ |
| Ga0335085_101344045 | 3300032770 | Soil | MEEAFVILGALVGSFATAFFIQKVALEGLFRIINPDRRARQ |
| Ga0335085_101931533 | 3300032770 | Soil | METLVIAATLFGSFLGALALQKAALEGLFRLMGAERRVRQ |
| Ga0335085_106365643 | 3300032770 | Soil | MEAVVIAGAFIGSFLGALAIQKAALEGLFRIMDLERRGRR |
| Ga0335082_103358312 | 3300032782 | Soil | MEAIVITATLVGSFVGALALQKAALEGLFRVMDVGRRSTRE |
| Ga0335082_111402372 | 3300032782 | Soil | MDAIVIAATLVGSFAGAFALQKAALEGLLRILDTGRRARH |
| Ga0335079_100568594 | 3300032783 | Soil | MDAFVIASTLVGSFVGAFVIQKAALEGLFRIMNADRRNHQR |
| Ga0335079_101166573 | 3300032783 | Soil | METLLIVATVFGSFLGAFALQKAALEGLFRLMDAERRVRQ |
| Ga0335079_118298512 | 3300032783 | Soil | METVVIAATLVGSFWGAFVIQKAALEGLFRVMDAGRRTRQ |
| Ga0335078_102871564 | 3300032805 | Soil | SISVWREETAMAAFVIGATLVGSFAGAFVLQKAALEGLFRWMDTGRRARQ |
| Ga0335078_103968164 | 3300032805 | Soil | MDALVIAATLVGTCAGAFVLQKAALEGLLRIIETGERRVRQ |
| Ga0335078_104322492 | 3300032805 | Soil | MATFIIGATLAGSLAGAFALQKAVLEAFFRLMDPQARR |
| Ga0335078_104441731 | 3300032805 | Soil | MAAFVIGATLVGSFAGAFVLQKAALEGLFRWMDTGR |
| Ga0335078_118824473 | 3300032805 | Soil | MDALLISATVFGSFLGAFALQKAALEGLFRILGADRRPRR |
| Ga0335078_123684422 | 3300032805 | Soil | MDTVIIGATLFGSFVGAMVIQKAALEGLFRIMETGR |
| Ga0335080_108229292 | 3300032828 | Soil | MEAFVIAGTLIGSFATAFFIQKAALEGLFRILNDPDRRARQ |
| Ga0335070_103697612 | 3300032829 | Soil | MDAVVLGTTLAGCFVGAFVIQKAALEGLLRIMNAGRRVRR |
| Ga0335070_112188411 | 3300032829 | Soil | MEAIVIAGTLVGSLAAAFVLQKAALESIFRLMAAGRRDRV |
| Ga0335069_115481442 | 3300032893 | Soil | MEAVLIAATVLGSFLGALAIQKAALEGLLRMMEADRRARQ |
| Ga0335071_101789121 | 3300032897 | Soil | VDTVLIAATLLGSFAGAVVLQKAALEGLFRVMEAGRRAPR |
| Ga0335071_105889882 | 3300032897 | Soil | MDAVIIGATVISSFFGAFVIQKAALEGLFRIMGTGRRARQ |
| Ga0335071_118317412 | 3300032897 | Soil | MGAILISAALAGSFLGAFALQKAALEGLFRIMGADRRPRH |
| Ga0335072_112182792 | 3300032898 | Soil | MDAFVIGATVLGSFLGAFALQKVALEGLFRIMDTGRRGRH |
| Ga0335076_114743042 | 3300032955 | Soil | MTEMDAIVITATLVGSFVGAWALQKAALEGLFRVMDAGRRSTRE |
| Ga0335084_100214112 | 3300033004 | Soil | MEAIVITATLVGSFVGALALQKAALEGLFRAMDAGRRSTRE |
| Ga0335073_102071293 | 3300033134 | Soil | MDAVIIGATLISSFVGAFVIQKAALEGLFRIMETGRRSRQ |
| Ga0335073_116815761 | 3300033134 | Soil | MGAFVIGATLLGSFAGAFLLQKAALEGLFRWMGAGRRARQ |
| Ga0310914_104726902 | 3300033289 | Soil | MDALVITGTLLGSLAAAFALQKAALEGLFRFMKTERRSRQ |
| Ga0326728_1000077268 | 3300033402 | Peat Soil | MEAVVIGTALLGSFVGAFVIQKAALEGLLRWMDSGRRARR |
| Ga0326728_100163625 | 3300033402 | Peat Soil | MDALVIAATLVGTCAGAFVLQKAALEGLFRIIATGERRTRH |
| Ga0326727_108467183 | 3300033405 | Peat Soil | MEAFVIGATLFGSFLGAFALEKAAMEGLFRIMDTGRRARH |
| Ga0316628_1015923091 | 3300033513 | Soil | METFLIGTTLLGSFIGAFMLQKAALEGLFRLMNAERCARE |
| Ga0316628_1030505213 | 3300033513 | Soil | EAVVITAALLGSFATAWAIQKTALEALFRMMSPDRRARD |
| Ga0371489_0473635_1_111 | 3300033755 | Peat Soil | MDALVIAATLVGTCAGAFVLQKAALEGLFRIIATGER |
| Ga0314861_0430433_123_242 | 3300033977 | Peatland | METFVIAATLVGSFVGAWVVQKAALEGLMRFLNGRRTRE |
| Ga0372943_0246683_897_1019 | 3300034268 | Soil | MEAFVITATLVGSFATAFIIQKAALEGLFRMMDPSRRARD |
| ⦗Top⦘ |