| Basic Information | |
|---|---|
| Family ID | F006622 |
| Family Type | Metagenome |
| Number of Sequences | 368 |
| Average Sequence Length | 49 residues |
| Representative Sequence | VNEYQKQFDLFLKVFVRLCIAWWVLGLLRFLPDELAGKIVDKLLGMIGL |
| Number of Associated Samples | 173 |
| Number of Associated Scaffolds | 367 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 52.04 % |
| % of genes near scaffold ends (potentially truncated) | 32.88 % |
| % of genes from short scaffolds (< 2000 bps) | 74.18 % |
| Associated GOLD sequencing projects | 160 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (47.826 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (27.174 % of family members) |
| Environment Ontology (ENVO) | Unclassified (56.522 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (57.337 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.25% β-sheet: 0.00% Coil/Unstructured: 46.75% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 367 Family Scaffolds |
|---|---|---|
| PF00959 | Phage_lysozyme | 17.98 |
| PF11351 | GTA_holin_3TM | 3.27 |
| PF09374 | PG_binding_3 | 2.45 |
| PF13392 | HNH_3 | 1.36 |
| PF05838 | Glyco_hydro_108 | 1.09 |
| PF16778 | Phage_tail_APC | 0.82 |
| PF13884 | Peptidase_S74 | 0.82 |
| PF08291 | Peptidase_M15_3 | 0.82 |
| PF06378 | DUF1071 | 0.82 |
| PF05866 | RusA | 0.54 |
| PF09588 | YqaJ | 0.54 |
| PF03819 | MazG | 0.54 |
| PF03237 | Terminase_6N | 0.54 |
| PF01583 | APS_kinase | 0.27 |
| PF06739 | SBBP | 0.27 |
| PF00462 | Glutaredoxin | 0.27 |
| PF11650 | P22_Tail-4 | 0.27 |
| PF04404 | ERF | 0.27 |
| PF03118 | RNA_pol_A_CTD | 0.27 |
| PF12810 | Gly_rich | 0.27 |
| PF06048 | DUF927 | 0.27 |
| PF13385 | Laminin_G_3 | 0.27 |
| PF13759 | 2OG-FeII_Oxy_5 | 0.27 |
| PF07120 | DUF1376 | 0.27 |
| PF04851 | ResIII | 0.27 |
| PF07603 | DUF1566 | 0.27 |
| COG ID | Name | Functional Category | % Frequency in 367 Family Scaffolds |
|---|---|---|---|
| COG3926 | Lysozyme family protein | General function prediction only [R] | 1.09 |
| COG4570 | Holliday junction resolvase RusA (prophage-encoded endonuclease) | Replication, recombination and repair [L] | 0.54 |
| COG0202 | DNA-directed RNA polymerase, alpha subunit/40 kD subunit | Transcription [K] | 0.27 |
| COG0529 | Adenylylsulfate kinase or related kinase | Inorganic ion transport and metabolism [P] | 0.27 |
| COG3756 | Uncharacterized conserved protein YdaU, DUF1376 family | Function unknown [S] | 0.27 |
| COG5519 | Predicted ATPase domain of Cch-like helicases, DUF927 family | General function prediction only [R] | 0.27 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 60.60 % |
| Unclassified | root | N/A | 39.40 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002835|B570J40625_100008199 | Not Available | 19172 | Open in IMG/M |
| 3300002835|B570J40625_100166369 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2473 | Open in IMG/M |
| 3300003277|JGI25908J49247_10004313 | Not Available | 4551 | Open in IMG/M |
| 3300003277|JGI25908J49247_10037063 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1341 | Open in IMG/M |
| 3300003277|JGI25908J49247_10039943 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1274 | Open in IMG/M |
| 3300003277|JGI25908J49247_10050501 | Not Available | 1089 | Open in IMG/M |
| 3300003388|JGI25910J50241_10199199 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
| 3300003393|JGI25909J50240_1033989 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1108 | Open in IMG/M |
| 3300003393|JGI25909J50240_1120684 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
| 3300003394|JGI25907J50239_1004661 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3325 | Open in IMG/M |
| 3300003394|JGI25907J50239_1045094 | Not Available | 908 | Open in IMG/M |
| 3300003395|JGI25917J50250_1010719 | All Organisms → cellular organisms → Bacteria | 2277 | Open in IMG/M |
| 3300003860|Ga0031658_1025619 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 993 | Open in IMG/M |
| 3300004151|Ga0066602_10359389 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 650 | Open in IMG/M |
| 3300004240|Ga0007787_10202702 | Not Available | 967 | Open in IMG/M |
| 3300004240|Ga0007787_10393217 | Not Available | 690 | Open in IMG/M |
| 3300004240|Ga0007787_10613292 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 545 | Open in IMG/M |
| 3300004282|Ga0066599_100348702 | Not Available | 898 | Open in IMG/M |
| 3300004481|Ga0069718_10086053 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8809 | Open in IMG/M |
| 3300004481|Ga0069718_14283107 | Not Available | 583 | Open in IMG/M |
| 3300004481|Ga0069718_14778151 | Not Available | 530 | Open in IMG/M |
| 3300005525|Ga0068877_10481329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 689 | Open in IMG/M |
| 3300005527|Ga0068876_10026206 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3654 | Open in IMG/M |
| 3300005527|Ga0068876_10055533 | All Organisms → cellular organisms → Bacteria | 2408 | Open in IMG/M |
| 3300005527|Ga0068876_10083994 | Not Available | 1908 | Open in IMG/M |
| 3300005527|Ga0068876_10123450 | Not Available | 1535 | Open in IMG/M |
| 3300005527|Ga0068876_10155290 | Not Available | 1343 | Open in IMG/M |
| 3300005527|Ga0068876_10206988 | Not Available | 1136 | Open in IMG/M |
| 3300005528|Ga0068872_10092619 | All Organisms → cellular organisms → Bacteria | 1817 | Open in IMG/M |
| 3300005528|Ga0068872_10105004 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1685 | Open in IMG/M |
| 3300005528|Ga0068872_10297685 | Not Available | 896 | Open in IMG/M |
| 3300005581|Ga0049081_10053044 | All Organisms → cellular organisms → Bacteria | 1533 | Open in IMG/M |
| 3300005581|Ga0049081_10119965 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 973 | Open in IMG/M |
| 3300005581|Ga0049081_10215922 | Not Available | 683 | Open in IMG/M |
| 3300005581|Ga0049081_10255016 | Not Available | 614 | Open in IMG/M |
| 3300005581|Ga0049081_10340106 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 510 | Open in IMG/M |
| 3300005582|Ga0049080_10001970 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7047 | Open in IMG/M |
| 3300005662|Ga0078894_10610233 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300005805|Ga0079957_1004594 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 11427 | Open in IMG/M |
| 3300005805|Ga0079957_1174314 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1065 | Open in IMG/M |
| 3300005805|Ga0079957_1373069 | Not Available | 615 | Open in IMG/M |
| 3300005832|Ga0074469_10212771 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1188 | Open in IMG/M |
| 3300006484|Ga0070744_10001144 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7855 | Open in IMG/M |
| 3300006484|Ga0070744_10002186 | Not Available | 5919 | Open in IMG/M |
| 3300006484|Ga0070744_10072861 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 997 | Open in IMG/M |
| 3300006641|Ga0075471_10012021 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5284 | Open in IMG/M |
| 3300006802|Ga0070749_10123634 | All Organisms → cellular organisms → Bacteria | 1519 | Open in IMG/M |
| 3300007276|Ga0070747_1196600 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 712 | Open in IMG/M |
| 3300007276|Ga0070747_1344006 | Not Available | 510 | Open in IMG/M |
| 3300007544|Ga0102861_1061489 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 982 | Open in IMG/M |
| 3300007549|Ga0102879_1085771 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 986 | Open in IMG/M |
| 3300007559|Ga0102828_1101134 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 701 | Open in IMG/M |
| 3300007559|Ga0102828_1156187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alishewanella → unclassified Alishewanella → Alishewanella sp. 34-51-39 | 574 | Open in IMG/M |
| 3300007559|Ga0102828_1157791 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 571 | Open in IMG/M |
| 3300007603|Ga0102921_1316758 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 555 | Open in IMG/M |
| 3300007622|Ga0102863_1000106 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 26169 | Open in IMG/M |
| 3300007636|Ga0102856_1089737 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 511 | Open in IMG/M |
| 3300007642|Ga0102876_1073029 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 942 | Open in IMG/M |
| 3300007972|Ga0105745_1182511 | Not Available | 654 | Open in IMG/M |
| 3300007992|Ga0105748_10370569 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 615 | Open in IMG/M |
| 3300008055|Ga0108970_11389807 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1229 | Open in IMG/M |
| 3300008107|Ga0114340_1002718 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11458 | Open in IMG/M |
| 3300008107|Ga0114340_1003649 | All Organisms → cellular organisms → Bacteria | 10465 | Open in IMG/M |
| 3300008107|Ga0114340_1018079 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5046 | Open in IMG/M |
| 3300008107|Ga0114340_1036541 | All Organisms → Viruses → Predicted Viral | 2218 | Open in IMG/M |
| 3300008107|Ga0114340_1069354 | Not Available | 1488 | Open in IMG/M |
| 3300008107|Ga0114340_1079552 | Not Available | 1357 | Open in IMG/M |
| 3300008107|Ga0114340_1099903 | Not Available | 1162 | Open in IMG/M |
| 3300008107|Ga0114340_1152882 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 847 | Open in IMG/M |
| 3300008107|Ga0114340_1247001 | Not Available | 549 | Open in IMG/M |
| 3300008110|Ga0114343_1009515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4801 | Open in IMG/M |
| 3300008113|Ga0114346_1024034 | All Organisms → cellular organisms → Bacteria | 5561 | Open in IMG/M |
| 3300008113|Ga0114346_1105813 | Not Available | 1953 | Open in IMG/M |
| 3300008113|Ga0114346_1224647 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 725 | Open in IMG/M |
| 3300008114|Ga0114347_1003421 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9449 | Open in IMG/M |
| 3300008116|Ga0114350_1070283 | Not Available | 1197 | Open in IMG/M |
| 3300008122|Ga0114359_1142283 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 852 | Open in IMG/M |
| 3300008262|Ga0114337_1104635 | Not Available | 1313 | Open in IMG/M |
| 3300008265|Ga0114361_1135491 | Not Available | 1307 | Open in IMG/M |
| 3300008266|Ga0114363_1055422 | Not Available | 1561 | Open in IMG/M |
| 3300008266|Ga0114363_1074536 | Not Available | 1280 | Open in IMG/M |
| 3300008266|Ga0114363_1116972 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 932 | Open in IMG/M |
| 3300008266|Ga0114363_1117276 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1457 | Open in IMG/M |
| 3300008266|Ga0114363_1126166 | Not Available | 882 | Open in IMG/M |
| 3300008267|Ga0114364_1002870 | Not Available | 13847 | Open in IMG/M |
| 3300008267|Ga0114364_1031735 | All Organisms → Viruses → Predicted Viral | 2062 | Open in IMG/M |
| 3300008267|Ga0114364_1038446 | Not Available | 1807 | Open in IMG/M |
| 3300008267|Ga0114364_1057052 | Not Available | 1371 | Open in IMG/M |
| 3300008267|Ga0114364_1125749 | Not Available | 753 | Open in IMG/M |
| 3300008267|Ga0114364_1136318 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 702 | Open in IMG/M |
| 3300008267|Ga0114364_1141950 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 677 | Open in IMG/M |
| 3300008448|Ga0114876_1002267 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13731 | Open in IMG/M |
| 3300008448|Ga0114876_1004083 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9616 | Open in IMG/M |
| 3300008448|Ga0114876_1078005 | All Organisms → Viruses → Predicted Viral | 1385 | Open in IMG/M |
| 3300008448|Ga0114876_1129676 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 953 | Open in IMG/M |
| 3300008448|Ga0114876_1147473 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 863 | Open in IMG/M |
| 3300008448|Ga0114876_1161579 | Not Available | 804 | Open in IMG/M |
| 3300008448|Ga0114876_1166637 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 785 | Open in IMG/M |
| 3300008448|Ga0114876_1208189 | Not Available | 652 | Open in IMG/M |
| 3300008448|Ga0114876_1249721 | Not Available | 551 | Open in IMG/M |
| 3300008448|Ga0114876_1255922 | Not Available | 538 | Open in IMG/M |
| 3300008450|Ga0114880_1005142 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6930 | Open in IMG/M |
| 3300008450|Ga0114880_1113552 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1028 | Open in IMG/M |
| 3300008450|Ga0114880_1170446 | Not Available | 762 | Open in IMG/M |
| 3300008450|Ga0114880_1176186 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 743 | Open in IMG/M |
| 3300008996|Ga0102831_1146946 | Not Available | 782 | Open in IMG/M |
| 3300008996|Ga0102831_1215037 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 635 | Open in IMG/M |
| 3300008999|Ga0102816_1096518 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 901 | Open in IMG/M |
| 3300009026|Ga0102829_1104538 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 885 | Open in IMG/M |
| 3300009056|Ga0102860_1079946 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 898 | Open in IMG/M |
| 3300009059|Ga0102830_1232561 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 539 | Open in IMG/M |
| 3300009071|Ga0115566_10732639 | Not Available | 546 | Open in IMG/M |
| 3300009082|Ga0105099_10577558 | Not Available | 687 | Open in IMG/M |
| 3300009159|Ga0114978_10134358 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1604 | Open in IMG/M |
| 3300009159|Ga0114978_10401454 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 820 | Open in IMG/M |
| 3300009165|Ga0105102_10378605 | Not Available | 748 | Open in IMG/M |
| 3300009165|Ga0105102_10580156 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 618 | Open in IMG/M |
| 3300009165|Ga0105102_10605943 | Not Available | 606 | Open in IMG/M |
| 3300009169|Ga0105097_10929655 | Not Available | 500 | Open in IMG/M |
| 3300009180|Ga0114979_10047347 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2698 | Open in IMG/M |
| 3300009184|Ga0114976_10099548 | All Organisms → Viruses → Predicted Viral | 1660 | Open in IMG/M |
| 3300009419|Ga0114982_1085829 | Not Available | 977 | Open in IMG/M |
| 3300009684|Ga0114958_10198194 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1004 | Open in IMG/M |
| 3300010885|Ga0133913_10022153 | Not Available | 16973 | Open in IMG/M |
| 3300010966|Ga0137675_1000104 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7876 | Open in IMG/M |
| 3300010970|Ga0137575_10003179 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3141 | Open in IMG/M |
| 3300011010|Ga0139557_1042970 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 779 | Open in IMG/M |
| 3300011115|Ga0151514_10479 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 17281 | Open in IMG/M |
| 3300011115|Ga0151514_10481 | All Organisms → cellular organisms → Bacteria | 17212 | Open in IMG/M |
| 3300011116|Ga0151516_10045 | Not Available | 63039 | Open in IMG/M |
| 3300011183|Ga0136713_1046644 | Not Available | 572 | Open in IMG/M |
| 3300011335|Ga0153698_1024 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 60463 | Open in IMG/M |
| 3300011335|Ga0153698_1024 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 60463 | Open in IMG/M |
| 3300011339|Ga0153700_11087 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 12366 | Open in IMG/M |
| 3300012013|Ga0153805_1034935 | Not Available | 854 | Open in IMG/M |
| 3300012013|Ga0153805_1096841 | Not Available | 502 | Open in IMG/M |
| 3300012667|Ga0157208_10000309 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14867 | Open in IMG/M |
| 3300013004|Ga0164293_10501506 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 801 | Open in IMG/M |
| 3300013004|Ga0164293_10856363 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 574 | Open in IMG/M |
| 3300013005|Ga0164292_10731169 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 630 | Open in IMG/M |
| 3300013372|Ga0177922_10231279 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 593 | Open in IMG/M |
| 3300013372|Ga0177922_10269739 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 535 | Open in IMG/M |
| 3300013372|Ga0177922_11068400 | Not Available | 550 | Open in IMG/M |
| 3300013372|Ga0177922_11274056 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 853 | Open in IMG/M |
| 3300014711|Ga0134314_100004 | Not Available | 39058 | Open in IMG/M |
| 3300014811|Ga0119960_1017067 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 871 | Open in IMG/M |
| 3300014811|Ga0119960_1061863 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 643 | Open in IMG/M |
| 3300014811|Ga0119960_1076015 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 595 | Open in IMG/M |
| 3300015050|Ga0181338_1049684 | Not Available | 613 | Open in IMG/M |
| 3300017701|Ga0181364_1026847 | Not Available | 936 | Open in IMG/M |
| 3300017707|Ga0181363_1003970 | Not Available | 3278 | Open in IMG/M |
| 3300017707|Ga0181363_1051455 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 737 | Open in IMG/M |
| 3300017707|Ga0181363_1089436 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
| 3300017716|Ga0181350_1002274 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5608 | Open in IMG/M |
| 3300017716|Ga0181350_1028361 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1547 | Open in IMG/M |
| 3300017716|Ga0181350_1076433 | Not Available | 853 | Open in IMG/M |
| 3300017716|Ga0181350_1085949 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 790 | Open in IMG/M |
| 3300017716|Ga0181350_1112200 | Not Available | 661 | Open in IMG/M |
| 3300017722|Ga0181347_1087869 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 899 | Open in IMG/M |
| 3300017722|Ga0181347_1169062 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 589 | Open in IMG/M |
| 3300017736|Ga0181365_1094629 | Not Available | 726 | Open in IMG/M |
| 3300017736|Ga0181365_1101830 | Not Available | 695 | Open in IMG/M |
| 3300017747|Ga0181352_1067689 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1013 | Open in IMG/M |
| 3300017747|Ga0181352_1123478 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 696 | Open in IMG/M |
| 3300017754|Ga0181344_1028192 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1722 | Open in IMG/M |
| 3300017754|Ga0181344_1034493 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1541 | Open in IMG/M |
| 3300017754|Ga0181344_1034873 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1531 | Open in IMG/M |
| 3300017754|Ga0181344_1039095 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1433 | Open in IMG/M |
| 3300017754|Ga0181344_1124559 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 741 | Open in IMG/M |
| 3300017754|Ga0181344_1142259 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 686 | Open in IMG/M |
| 3300017754|Ga0181344_1167244 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 624 | Open in IMG/M |
| 3300017754|Ga0181344_1200000 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 561 | Open in IMG/M |
| 3300017761|Ga0181356_1059702 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1299 | Open in IMG/M |
| 3300017761|Ga0181356_1205300 | Not Available | 581 | Open in IMG/M |
| 3300017761|Ga0181356_1216188 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 560 | Open in IMG/M |
| 3300017766|Ga0181343_1148673 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 653 | Open in IMG/M |
| 3300017774|Ga0181358_1215845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 620 | Open in IMG/M |
| 3300017777|Ga0181357_1006226 | All Organisms → Viruses → Predicted Viral | 4783 | Open in IMG/M |
| 3300017777|Ga0181357_1134318 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 921 | Open in IMG/M |
| 3300017778|Ga0181349_1091174 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1150 | Open in IMG/M |
| 3300017778|Ga0181349_1105353 | Not Available | 1052 | Open in IMG/M |
| 3300017780|Ga0181346_1086366 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1231 | Open in IMG/M |
| 3300017780|Ga0181346_1162678 | Not Available | 828 | Open in IMG/M |
| 3300017784|Ga0181348_1090062 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1207 | Open in IMG/M |
| 3300017785|Ga0181355_1015004 | Not Available | 3396 | Open in IMG/M |
| 3300017785|Ga0181355_1203459 | Not Available | 777 | Open in IMG/M |
| 3300019781|Ga0181360_107635 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 913 | Open in IMG/M |
| 3300019781|Ga0181360_113546 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 673 | Open in IMG/M |
| 3300019784|Ga0181359_1002630 | Not Available | 5275 | Open in IMG/M |
| 3300019784|Ga0181359_1021779 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2432 | Open in IMG/M |
| 3300019784|Ga0181359_1025362 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2267 | Open in IMG/M |
| 3300019784|Ga0181359_1083364 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1195 | Open in IMG/M |
| 3300019784|Ga0181359_1092151 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1122 | Open in IMG/M |
| 3300019784|Ga0181359_1133267 | Not Available | 873 | Open in IMG/M |
| 3300019784|Ga0181359_1204319 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
| 3300019784|Ga0181359_1217241 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 604 | Open in IMG/M |
| 3300020160|Ga0211733_10134707 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5972 | Open in IMG/M |
| 3300020172|Ga0211729_10919842 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 700 | Open in IMG/M |
| 3300020205|Ga0211731_10759259 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 993 | Open in IMG/M |
| 3300020205|Ga0211731_11546872 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 631 | Open in IMG/M |
| 3300020498|Ga0208050_1015482 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 817 | Open in IMG/M |
| 3300020548|Ga0208856_1009935 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1597 | Open in IMG/M |
| 3300020571|Ga0208723_1057818 | Not Available | 525 | Open in IMG/M |
| 3300021956|Ga0213922_1025151 | Not Available | 1475 | Open in IMG/M |
| 3300021956|Ga0213922_1106404 | Not Available | 562 | Open in IMG/M |
| 3300021961|Ga0222714_10022092 | Not Available | 4938 | Open in IMG/M |
| 3300021961|Ga0222714_10037790 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3491 | Open in IMG/M |
| 3300021962|Ga0222713_10453897 | Not Available | 776 | Open in IMG/M |
| 3300021963|Ga0222712_10033336 | All Organisms → Viruses → Predicted Viral | 4042 | Open in IMG/M |
| 3300021963|Ga0222712_10684974 | Not Available | 580 | Open in IMG/M |
| 3300022179|Ga0181353_1001590 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4678 | Open in IMG/M |
| 3300022179|Ga0181353_1014093 | All Organisms → Viruses → Predicted Viral | 2058 | Open in IMG/M |
| 3300022179|Ga0181353_1027067 | All Organisms → Viruses → Predicted Viral | 1518 | Open in IMG/M |
| 3300022179|Ga0181353_1069386 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 902 | Open in IMG/M |
| 3300022179|Ga0181353_1100766 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 710 | Open in IMG/M |
| 3300022190|Ga0181354_1017930 | Not Available | 2209 | Open in IMG/M |
| 3300022190|Ga0181354_1102042 | Not Available | 934 | Open in IMG/M |
| 3300022407|Ga0181351_1047838 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1793 | Open in IMG/M |
| 3300022407|Ga0181351_1059291 | Not Available | 1578 | Open in IMG/M |
| 3300022407|Ga0181351_1072081 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1396 | Open in IMG/M |
| 3300022407|Ga0181351_1106146 | Not Available | 1078 | Open in IMG/M |
| 3300022407|Ga0181351_1124651 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 961 | Open in IMG/M |
| 3300022407|Ga0181351_1126984 | Not Available | 948 | Open in IMG/M |
| 3300022407|Ga0181351_1180625 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 727 | Open in IMG/M |
| 3300022407|Ga0181351_1219646 | Not Available | 618 | Open in IMG/M |
| 3300022407|Ga0181351_1223484 | Not Available | 609 | Open in IMG/M |
| 3300024346|Ga0244775_10001946 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 23065 | Open in IMG/M |
| 3300024346|Ga0244775_10070263 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3003 | Open in IMG/M |
| 3300024346|Ga0244775_10347989 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1224 | Open in IMG/M |
| 3300025075|Ga0209615_102320 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1214 | Open in IMG/M |
| 3300025075|Ga0209615_107331 | Not Available | 616 | Open in IMG/M |
| 3300025445|Ga0208424_1000441 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5003 | Open in IMG/M |
| 3300025635|Ga0208147_1007541 | All Organisms → Viruses → Predicted Viral | 3088 | Open in IMG/M |
| 3300027147|Ga0255113_1078252 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 600 | Open in IMG/M |
| 3300027196|Ga0208438_1021649 | Not Available | 1109 | Open in IMG/M |
| 3300027211|Ga0208307_1000453 | Not Available | 8975 | Open in IMG/M |
| 3300027589|Ga0255123_1026452 | All Organisms → Viruses → Predicted Viral | 1178 | Open in IMG/M |
| 3300027608|Ga0208974_1001524 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9094 | Open in IMG/M |
| 3300027608|Ga0208974_1070659 | Not Available | 969 | Open in IMG/M |
| 3300027659|Ga0208975_1014260 | Not Available | 2683 | Open in IMG/M |
| 3300027659|Ga0208975_1080497 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 964 | Open in IMG/M |
| 3300027659|Ga0208975_1134879 | Not Available | 697 | Open in IMG/M |
| 3300027693|Ga0209704_1038382 | Not Available | 1288 | Open in IMG/M |
| 3300027693|Ga0209704_1263555 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
| 3300027710|Ga0209599_10062684 | Not Available | 977 | Open in IMG/M |
| 3300027721|Ga0209492_1090510 | All Organisms → Viruses → Predicted Viral | 1079 | Open in IMG/M |
| 3300027721|Ga0209492_1145840 | Not Available | 827 | Open in IMG/M |
| 3300027736|Ga0209190_1097288 | Not Available | 1364 | Open in IMG/M |
| 3300027764|Ga0209134_10305994 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 539 | Open in IMG/M |
| 3300027782|Ga0209500_10136620 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1169 | Open in IMG/M |
| 3300027785|Ga0209246_10003462 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5910 | Open in IMG/M |
| 3300027793|Ga0209972_10307990 | Not Available | 696 | Open in IMG/M |
| 3300027793|Ga0209972_10367233 | Not Available | 618 | Open in IMG/M |
| 3300027798|Ga0209353_10112582 | Not Available | 1225 | Open in IMG/M |
| 3300027798|Ga0209353_10302175 | Not Available | 678 | Open in IMG/M |
| 3300027805|Ga0209229_10002586 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7475 | Open in IMG/M |
| 3300027805|Ga0209229_10050334 | Not Available | 1856 | Open in IMG/M |
| 3300027808|Ga0209354_10067945 | Not Available | 1443 | Open in IMG/M |
| 3300027808|Ga0209354_10314414 | Not Available | 621 | Open in IMG/M |
| 3300027808|Ga0209354_10325884 | Not Available | 608 | Open in IMG/M |
| 3300027816|Ga0209990_10144182 | Not Available | 1132 | Open in IMG/M |
| 3300027816|Ga0209990_10287152 | Not Available | 739 | Open in IMG/M |
| 3300027816|Ga0209990_10445095 | Not Available | 556 | Open in IMG/M |
| 3300027836|Ga0209230_10435640 | Not Available | 748 | Open in IMG/M |
| 3300027836|Ga0209230_10594578 | Not Available | 620 | Open in IMG/M |
| 3300028025|Ga0247723_1000089 | Not Available | 54418 | Open in IMG/M |
| 3300028025|Ga0247723_1000970 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 17580 | Open in IMG/M |
| 3300028025|Ga0247723_1001204 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15627 | Open in IMG/M |
| 3300028025|Ga0247723_1002444 | Not Available | 9905 | Open in IMG/M |
| 3300028025|Ga0247723_1004511 | Not Available | 6555 | Open in IMG/M |
| 3300028025|Ga0247723_1004923 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6134 | Open in IMG/M |
| 3300028025|Ga0247723_1006341 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5189 | Open in IMG/M |
| 3300028025|Ga0247723_1010253 | All Organisms → Viruses → Predicted Viral | 3678 | Open in IMG/M |
| 3300028025|Ga0247723_1018685 | All Organisms → Viruses → Predicted Viral | 2391 | Open in IMG/M |
| 3300028025|Ga0247723_1019721 | Not Available | 2301 | Open in IMG/M |
| 3300028025|Ga0247723_1027869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Spongiibacteraceae → unclassified Spongiibacteraceae → Spongiibacteraceae bacterium | 1815 | Open in IMG/M |
| 3300028025|Ga0247723_1037114 | All Organisms → Viruses → Predicted Viral | 1481 | Open in IMG/M |
| 3300028025|Ga0247723_1106490 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 700 | Open in IMG/M |
| 3300028027|Ga0247722_10113909 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 993 | Open in IMG/M |
| (restricted) 3300028569|Ga0247843_1036094 | Not Available | 3144 | Open in IMG/M |
| (restricted) 3300028569|Ga0247843_1046493 | Not Available | 2512 | Open in IMG/M |
| 3300031758|Ga0315907_10007664 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11218 | Open in IMG/M |
| 3300031758|Ga0315907_10014263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 7634 | Open in IMG/M |
| 3300031758|Ga0315907_10064567 | Not Available | 3185 | Open in IMG/M |
| 3300031758|Ga0315907_10067061 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3117 | Open in IMG/M |
| 3300031758|Ga0315907_10147798 | All Organisms → Viruses → Predicted Viral | 1992 | Open in IMG/M |
| 3300031758|Ga0315907_10161138 | Not Available | 1896 | Open in IMG/M |
| 3300031758|Ga0315907_10387413 | Not Available | 1129 | Open in IMG/M |
| 3300031758|Ga0315907_10394193 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1117 | Open in IMG/M |
| 3300031758|Ga0315907_10426163 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1064 | Open in IMG/M |
| 3300031758|Ga0315907_10522416 | Not Available | 935 | Open in IMG/M |
| 3300031758|Ga0315907_10628466 | Not Available | 828 | Open in IMG/M |
| 3300031784|Ga0315899_10483564 | Not Available | 1189 | Open in IMG/M |
| 3300031784|Ga0315899_11691409 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
| 3300031857|Ga0315909_10140321 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2009 | Open in IMG/M |
| 3300031857|Ga0315909_10165412 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1799 | Open in IMG/M |
| 3300031857|Ga0315909_10201634 | All Organisms → Viruses → Predicted Viral | 1576 | Open in IMG/M |
| 3300031857|Ga0315909_10323864 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1139 | Open in IMG/M |
| 3300031857|Ga0315909_10345774 | Not Available | 1089 | Open in IMG/M |
| 3300031951|Ga0315904_10235617 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1765 | Open in IMG/M |
| 3300031951|Ga0315904_10433928 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1180 | Open in IMG/M |
| 3300031951|Ga0315904_10797652 | Not Available | 778 | Open in IMG/M |
| 3300031951|Ga0315904_10870962 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 731 | Open in IMG/M |
| 3300031952|Ga0315294_10089297 | Not Available | 3209 | Open in IMG/M |
| 3300031952|Ga0315294_11548133 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 516 | Open in IMG/M |
| 3300031963|Ga0315901_10508385 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 937 | Open in IMG/M |
| 3300031963|Ga0315901_10556865 | Not Available | 880 | Open in IMG/M |
| 3300031999|Ga0315274_12023632 | Not Available | 516 | Open in IMG/M |
| 3300032050|Ga0315906_10280012 | Not Available | 1514 | Open in IMG/M |
| 3300032050|Ga0315906_10815318 | Not Available | 729 | Open in IMG/M |
| 3300032092|Ga0315905_10008937 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10148 | Open in IMG/M |
| 3300032092|Ga0315905_11388674 | Not Available | 559 | Open in IMG/M |
| 3300032093|Ga0315902_10006035 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 16926 | Open in IMG/M |
| 3300032093|Ga0315902_10135604 | All Organisms → Viruses → Predicted Viral | 2592 | Open in IMG/M |
| 3300032116|Ga0315903_10975419 | Not Available | 596 | Open in IMG/M |
| 3300032116|Ga0315903_11093419 | Not Available | 548 | Open in IMG/M |
| 3300032116|Ga0315903_11171153 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
| 3300033978|Ga0334977_0013720 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4617 | Open in IMG/M |
| 3300033979|Ga0334978_0003208 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9210 | Open in IMG/M |
| 3300033981|Ga0334982_0000109 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 46331 | Open in IMG/M |
| 3300033981|Ga0334982_0289944 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 774 | Open in IMG/M |
| 3300033981|Ga0334982_0528515 | Not Available | 518 | Open in IMG/M |
| 3300033993|Ga0334994_0000570 | Not Available | 26719 | Open in IMG/M |
| 3300033994|Ga0334996_0083964 | Not Available | 1890 | Open in IMG/M |
| 3300033996|Ga0334979_0142558 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1456 | Open in IMG/M |
| 3300033996|Ga0334979_0733703 | Not Available | 513 | Open in IMG/M |
| 3300034012|Ga0334986_0012508 | Not Available | 6026 | Open in IMG/M |
| 3300034012|Ga0334986_0211523 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1077 | Open in IMG/M |
| 3300034013|Ga0334991_0025283 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3389 | Open in IMG/M |
| 3300034021|Ga0335004_0620190 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 570 | Open in IMG/M |
| 3300034022|Ga0335005_0316242 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 923 | Open in IMG/M |
| 3300034022|Ga0335005_0546539 | Not Available | 637 | Open in IMG/M |
| 3300034061|Ga0334987_0164379 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1606 | Open in IMG/M |
| 3300034062|Ga0334995_0461001 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 776 | Open in IMG/M |
| 3300034062|Ga0334995_0475815 | Not Available | 758 | Open in IMG/M |
| 3300034066|Ga0335019_0003941 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9971 | Open in IMG/M |
| 3300034066|Ga0335019_0727582 | Not Available | 567 | Open in IMG/M |
| 3300034066|Ga0335019_0864732 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 505 | Open in IMG/M |
| 3300034068|Ga0334990_0221841 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1033 | Open in IMG/M |
| 3300034068|Ga0334990_0424471 | Not Available | 714 | Open in IMG/M |
| 3300034071|Ga0335028_0471316 | Not Available | 701 | Open in IMG/M |
| 3300034071|Ga0335028_0557498 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 624 | Open in IMG/M |
| 3300034092|Ga0335010_0045937 | Not Available | 3179 | Open in IMG/M |
| 3300034093|Ga0335012_0410871 | Not Available | 660 | Open in IMG/M |
| 3300034093|Ga0335012_0516830 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 564 | Open in IMG/M |
| 3300034093|Ga0335012_0569966 | Not Available | 527 | Open in IMG/M |
| 3300034103|Ga0335030_0843919 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
| 3300034104|Ga0335031_0196756 | All Organisms → Viruses → Predicted Viral | 1367 | Open in IMG/M |
| 3300034104|Ga0335031_0376829 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 899 | Open in IMG/M |
| 3300034104|Ga0335031_0385452 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 885 | Open in IMG/M |
| 3300034104|Ga0335031_0411812 | Not Available | 846 | Open in IMG/M |
| 3300034105|Ga0335035_0021172 | All Organisms → Viruses → Predicted Viral | 4339 | Open in IMG/M |
| 3300034105|Ga0335035_0308051 | Not Available | 932 | Open in IMG/M |
| 3300034106|Ga0335036_0044227 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3434 | Open in IMG/M |
| 3300034106|Ga0335036_0065577 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2735 | Open in IMG/M |
| 3300034106|Ga0335036_0342936 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 978 | Open in IMG/M |
| 3300034106|Ga0335036_0622279 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 652 | Open in IMG/M |
| 3300034112|Ga0335066_0685306 | Not Available | 519 | Open in IMG/M |
| 3300034117|Ga0335033_0334782 | Not Available | 765 | Open in IMG/M |
| 3300034119|Ga0335054_0119510 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1620 | Open in IMG/M |
| 3300034119|Ga0335054_0568495 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 625 | Open in IMG/M |
| 3300034122|Ga0335060_0376724 | Not Available | 756 | Open in IMG/M |
| 3300034167|Ga0335017_0124181 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1514 | Open in IMG/M |
| 3300034168|Ga0335061_0416170 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 692 | Open in IMG/M |
| 3300034200|Ga0335065_0015560 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5373 | Open in IMG/M |
| 3300034279|Ga0335052_0513068 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 618 | Open in IMG/M |
| 3300034283|Ga0335007_0789277 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 27.17% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 15.22% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 8.97% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 8.15% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 4.62% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.80% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 3.80% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.99% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.99% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.45% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.17% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.63% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.63% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.36% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.09% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.09% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.09% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.82% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.82% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.82% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.82% |
| Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 0.82% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.54% |
| Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.54% |
| Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 0.54% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.54% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.54% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.54% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.54% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.27% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.27% |
| Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 0.27% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.27% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.27% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.27% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.27% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003388 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003395 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003860 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL | Environmental | Open in IMG/M |
| 3300004151 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 5 | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300004282 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sediment | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300005832 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.41_BBB | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
| 3300007549 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-02 | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007603 | Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 | Environmental | Open in IMG/M |
| 3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
| 3300007636 | Estuarine microbial communities from the Columbia River estuary - metaG 1371A-3 | Environmental | Open in IMG/M |
| 3300007642 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-3 | Environmental | Open in IMG/M |
| 3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008122 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample HABS-E2014-0124-100-LTR | Environmental | Open in IMG/M |
| 3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
| 3300008265 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0126-100-LTR | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300008999 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009056 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 | Environmental | Open in IMG/M |
| 3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300010966 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1bis, april 2016 | Environmental | Open in IMG/M |
| 3300010970 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1, april 2016 | Environmental | Open in IMG/M |
| 3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
| 3300011115 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016May | Environmental | Open in IMG/M |
| 3300011116 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Nov | Environmental | Open in IMG/M |
| 3300011183 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - JTO22cm metaG | Environmental | Open in IMG/M |
| 3300011335 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Guman | Environmental | Open in IMG/M |
| 3300011339 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Hannam | Environmental | Open in IMG/M |
| 3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
| 3300012667 | Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15 | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014711 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0111 | Environmental | Open in IMG/M |
| 3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
| 3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019781 | Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM15.S.D | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020548 | Freshwater microbial communities from Lake Mendota, WI - 13JUL2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020571 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025075 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - 4B3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025445 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027147 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepC_8h | Environmental | Open in IMG/M |
| 3300027196 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 (SPAdes) | Environmental | Open in IMG/M |
| 3300027211 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027589 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_8d | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
| 3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027836 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028027 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 3H_FC | Environmental | Open in IMG/M |
| 3300028569 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033978 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002 | Environmental | Open in IMG/M |
| 3300033979 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034013 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034 | Environmental | Open in IMG/M |
| 3300034021 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057 | Environmental | Open in IMG/M |
| 3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034068 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031 | Environmental | Open in IMG/M |
| 3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
| 3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| 3300034167 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Apr2015-rr0082 | Environmental | Open in IMG/M |
| 3300034168 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183 | Environmental | Open in IMG/M |
| 3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
| 3300034279 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J40625_10000819922 | 3300002835 | Freshwater | VNEYQKQFDLFLKVFVRLCIAWWVLGLLRFLPDELASKIVNKLLGMIGL* |
| B570J40625_1001663697 | 3300002835 | Freshwater | WAVNEYQKQFDLFLKVFVRLCIAWWVLGFLQFLPDNLSDKIVNKLLGMIGLG* |
| JGI25908J49247_100043131 | 3300003277 | Freshwater Lake | FFKIFAKLYVAYLVIGLLPHLPDELAGKIVDKLLGMIGL* |
| JGI25908J49247_100370633 | 3300003277 | Freshwater Lake | VRSLNEYQKQFDLFLKIFVRLCIAWWVLGLLRFLPDDVANKLLRMIGLG* |
| JGI25908J49247_100399433 | 3300003277 | Freshwater Lake | MNEYQKQADKFFKIFAKLYVAYLVIGLLPHLPDELAGKIVDKLLGMIGL* |
| JGI25908J49247_100505012 | 3300003277 | Freshwater Lake | VNEYQKQADKFFKIFARLYVAYLVIGLLPHLPDELAGKIVDKLLGMIGL* |
| JGI25910J50241_101991991 | 3300003388 | Freshwater Lake | YQKQFDLFLKIFVRLCIAWWVLGLLRFLPDDVANKLLRMIGLG* |
| JGI25909J50240_10339891 | 3300003393 | Freshwater Lake | MNEYQKQADKFFKIFARLYVAYLVVGLLPHLPDELAGKIVDKLLGMIGL* |
| JGI25909J50240_11206842 | 3300003393 | Freshwater Lake | VNEYQKQADKFFKIFAKLYVAYLVVGLLPHLPDELAGKIVDKLLGMIGL |
| JGI25907J50239_10046615 | 3300003394 | Freshwater Lake | VNEYQKQFDLFLKVFVRLCIAWWVIGLLRFLPDELAGKIVDKLLGMIGLG* |
| JGI25907J50239_10450943 | 3300003394 | Freshwater Lake | FIQGWEMNEYQKQADKFFKIFAKLYVAYLVIGLLPHLPDELAGKIVDKLLGMIGL* |
| JGI25917J50250_10107195 | 3300003395 | Freshwater Lake | VNEYQKQFDQFLKIFVRLCIVIWVLGLLKFIPDALADKIVSKLLGMIGL* |
| Ga0031658_10256192 | 3300003860 | Freshwater Lake Sediment | VNEYQKQFDLFLKVFVRLCVAWYVVGFLRFLPDELADKVVNKLLGMIGL* |
| Ga0066602_103593892 | 3300004151 | Freshwater | NEYQKQFDQWLKIFVRLCIVWWVLGLLQRLPDDLASKIVNKILGMFGL* |
| Ga0007787_102027021 | 3300004240 | Freshwater Lake | VNEYQKQFDLFCKVFVRLCIAWWVFGLLRFLPDELAGKIVDKLLGMIGLA* |
| Ga0007787_103932171 | 3300004240 | Freshwater Lake | KQFDQFLKIFVRMCIAWYVVGFLRFLPDELSDKIVNKFLSYIGLG* |
| Ga0007787_106132922 | 3300004240 | Freshwater Lake | MWAVNEYQKQFDLFLKVFVRLCIAWWVLGLLRFLPDELAGKIVDKLLGMIGL* |
| Ga0066599_1003487022 | 3300004282 | Freshwater | VNEYQKQFDQWLKIFVRMCIAWYVLGLLQRLPDELASKIVDKLLGMIGLG* |
| Ga0069718_100860538 | 3300004481 | Sediment | VNEYQKQFDQFLKIFVRLCVVCWVLGLLRFLPDKLADKVVNKLLGMIGL* |
| Ga0069718_142831072 | 3300004481 | Sediment | VWAVNEYQKQFDQWLKIFVRLCIAYYVLGLLQRLPDELASKIVDKLLGMIGLG* |
| Ga0069718_147781512 | 3300004481 | Sediment | FDLFLKVFVRLCVAWWVLGLLQYLPDELAGKIVDKLLGMIGL* |
| Ga0068877_104813292 | 3300005525 | Freshwater Lake | VNEYQKQFDLFCKVFVRLCIAWWVLGLLRFLPDELAGKIVDKLLGMIGLG* |
| Ga0068876_100262066 | 3300005527 | Freshwater Lake | VNEYQKQFDLFLKVFVRLCIAWWVLGLLRFLPDELAGKIVDKLLGMIGLG* |
| Ga0068876_100555334 | 3300005527 | Freshwater Lake | VNEYQKQFDLFLKVFVRLCIAWWVLGFLQFLPDELAGKIVDKLLGMIGLG* |
| Ga0068876_100839942 | 3300005527 | Freshwater Lake | VNEYQKQADKFFKIFAKLYVAYLVVGLLPHLPDELAGKIVDKLLGMIGL* |
| Ga0068876_101234504 | 3300005527 | Freshwater Lake | VNEYQKQFDQFLKIFVRLCIVIWVLGLLKFIPDSLADKIVSKLLGMIGL* |
| Ga0068876_101552902 | 3300005527 | Freshwater Lake | MRYQQVWAVNEYQKQFDLFLKVFVRLCIAWWVLGLLRFLPDELAGKIVDKLLGMIGL* |
| Ga0068876_102069883 | 3300005527 | Freshwater Lake | VNDYQKQADKFFKIFAKLYVAYLVVGLLPHLPDELASKIVDKLLGMIGL* |
| Ga0068872_100926194 | 3300005528 | Freshwater Lake | YQKQADKFFKIFAKLYVAYLVVGLLPHLPDELASKIVDKLLGMIGL* |
| Ga0068872_101050042 | 3300005528 | Freshwater Lake | VNEYQKQADLFFKVFVRLCVAWWVLGLLRFLPDNVAKKLLGMFGL* |
| Ga0068872_102976851 | 3300005528 | Freshwater Lake | MRYQQVWAVNEYQKQFDLFLKVFVRLCIAWWVLGLLRFLPDELAGKIVDKLLGM |
| Ga0049081_100530441 | 3300005581 | Freshwater Lentic | QKQADKFFKIFAKLYVAYLVIGLLPHLPDELAGKIVDKLFGMIGL* |
| Ga0049081_101199653 | 3300005581 | Freshwater Lentic | YQKQFDLFLKVFVRLCIAWWVLGLLRFLPDELASKIVNKLLGMIGL* |
| Ga0049081_102159222 | 3300005581 | Freshwater Lentic | VNEYQKQADKFFKIFAKLYVAYLVVGLLPHLPDELASKIIDKLLGMIGL* |
| Ga0049081_102550161 | 3300005581 | Freshwater Lentic | ADKFFKIFAKLYVAYLVIGLLPHLPDELAGKIVDKLLGMIGL* |
| Ga0049081_103401061 | 3300005581 | Freshwater Lentic | VNEYQKQFDLFCKVFVRLCIAWWVFGLLRFLPDELAGKIVDKLLGMIGLG* |
| Ga0049080_100019706 | 3300005582 | Freshwater Lentic | VNEYQKQFDLFCKVFVRLCVAWWVLGLLRFLPDDVAKKVLGMFGL* |
| Ga0078894_106102332 | 3300005662 | Freshwater Lake | VNEYQKQFDLFLKVFVRLCVAWWVLGLLQYLPDELAGKVVNKLLGMIGL* |
| Ga0079957_100459418 | 3300005805 | Lake | VNEYQKQFDLFLKVFVRLCVAWWVLGLLQYLPDELAGKIVDKLLGMIGL* |
| Ga0079957_11743142 | 3300005805 | Lake | VNEYQKQFDQFLKVFVRLCIVIWVLGLLKYIPDELADKIVNKLLGMIGL* |
| Ga0079957_13730692 | 3300005805 | Lake | CQDKVWSVNEYQKQFDLFLKVFVRLCIAWWVLGLLQYLPDELAGKIVDKLLGMIGL* |
| Ga0074469_102127712 | 3300005832 | Sediment (Intertidal) | VNEYQKQFDLFLKVFVRLCVAWWVLGLLQHLPDELAGKIVDKLLGMIGL* |
| Ga0070744_100011442 | 3300006484 | Estuarine | VNEYQKQFDLFLKVFVRLCIAWWVLGLLRFLPDELAGKIVDKLLGMIGL* |
| Ga0070744_100021863 | 3300006484 | Estuarine | VNEYQKQFDLFLKVFVRLCIAWWVLGLLRFLPDELASKIVDKLLGMIGL* |
| Ga0070744_100728613 | 3300006484 | Estuarine | VWSVNEYQKQFDLFLKVFVRLCIAWWVLGLLRFLPDELASKIVNKLLGMIGL* |
| Ga0075471_100120214 | 3300006641 | Aqueous | VNEYQKQFDLFLKVFVRMCVAWWVLGFLRFLPDNLSDKIVNKLLGMLGL* |
| Ga0070749_101236342 | 3300006802 | Aqueous | VNEYQKQFDLFLKVFVRLCVAWWVLGLLQYLPDELAGKIVNKLLGMIGL* |
| Ga0070747_11966002 | 3300007276 | Aqueous | MCQDKVWSVNEYQKQFDLFLKVFVRLCVAWYVVGFLRFLPDELADKVVTKILGMFGL* |
| Ga0070747_13440062 | 3300007276 | Aqueous | VNEYQKQFDQFLKVFVRLCIAWWVLGLLRFLPDELAGKIVDKLLGMIGLG* |
| Ga0102861_10614892 | 3300007544 | Estuarine | VNEYQKQADLFFKVFVRLCVAWWVLGLLRFLPDELAGKIVDKLLGMIGL* |
| Ga0102879_10857712 | 3300007549 | Estuarine | VNEYQKQFDLFCKVFVRLCIAWWVLGFLRFLPDDVAKKVLGMFGI* |
| Ga0102828_11011343 | 3300007559 | Estuarine | ELFCKIAVRLCVAIWVLGLLQFIPDALADKIVNKLLGMIGL* |
| Ga0102828_11561872 | 3300007559 | Estuarine | VNDYQKQADKFFKIFAKLYVAYLVIGLLPHLPDELASKIVDKLLGMIGL* |
| Ga0102828_11577912 | 3300007559 | Estuarine | VNEYQKQFDLFCKVFVRLCIAWWVLGLLRFLPDEVAKKVLGMFGL* |
| Ga0102921_13167582 | 3300007603 | Estuarine | MWAVNEYQKQFDLFLKVFVRLCIAWWVLGLLRFLPDELAGKIVDKLLGMIGLG* |
| Ga0102863_10001068 | 3300007622 | Estuarine | VNEYQKQFDQFLKVFVRLYIAWWVLGLLRFLPDELAGKIVDKLLGMIGL* |
| Ga0102856_10897372 | 3300007636 | Estuarine | MWAVNEYQKQFDLFLKVFVRLCIAWWVLGFLQFLPDNLSDKVVNKLLGMIGLG* |
| Ga0102876_10730292 | 3300007642 | Estuarine | VWAVNEYQKQAELFFKVFVRLCIAWWVLGLLRYLPDELAGKIVDKLLGMIGL* |
| Ga0105745_11825112 | 3300007972 | Estuary Water | VWAVNEYQKQFDLFLKVFVRLCIAWWVLGLLRFLPDELAGKIVDKLLGMIGL* |
| Ga0105748_103705691 | 3300007992 | Estuary Water | QKQFDLFLKVFVRLYIAWWVFGLLQYLPDKLAGKTVDKLLRMIGL* |
| Ga0108970_113898072 | 3300008055 | Estuary | VNEYQKQFDLFLKVFVRLYIAWWVFGLLQYLPDKLAGKIVDKLLGMIGL* |
| Ga0114340_100271823 | 3300008107 | Freshwater, Plankton | VNEYQKQADKFFKIFARLYVAYLVIGLLPHLPDELAGKIVNKLLGMIGL* |
| Ga0114340_10036491 | 3300008107 | Freshwater, Plankton | VWAVNEYQKQFDLFLKVFVRLCIAWWVLGLLRFLPDELAGKIVNKLLGMIGLG* |
| Ga0114340_10180795 | 3300008107 | Freshwater, Plankton | VNEYQKQADLFFKVFVRLCVAWWVLGLLRFLPDDVAKKVLGMFGL* |
| Ga0114340_10365415 | 3300008107 | Freshwater, Plankton | VWAVNEYQKQFDLFLKVFVRLCIAWWVLGLLRFLPDELAGKIVDKLLGMIGLG* |
| Ga0114340_10693541 | 3300008107 | Freshwater, Plankton | KQADKFFKIFAKLYVAYLVIGLLPHLPDELAGKIVDKLLGMIGL* |
| Ga0114340_10795523 | 3300008107 | Freshwater, Plankton | VNEYQKQADKFFKIFARLYVAYLVIGLLPHLPNELAGKIVNKLLGMIGL* |
| Ga0114340_10999033 | 3300008107 | Freshwater, Plankton | VNEYQKQFDLFLKVFVRLCIAWWVFGLLRFLPDELAGKIVDKLLGMIGLG* |
| Ga0114340_11528822 | 3300008107 | Freshwater, Plankton | VNEYQKQFDLFCKVFVRLCIAWWVLGLLRFLPDELAGKIVDKLLGMIGL* |
| Ga0114340_12470011 | 3300008107 | Freshwater, Plankton | VWAVNEYQKQFDLFLKVFVRLCIAWWVLGFLQFLPDELAGKIVDKLLGMIGLG* |
| Ga0114343_10095152 | 3300008110 | Freshwater, Plankton | VNEYQKQFDLFLKVFVRLCIAWWVLGLLRFLPDELAGKIVNKLLGMIGLG* |
| Ga0114346_10240344 | 3300008113 | Freshwater, Plankton | VNEYQKQFDLFCKVFVRLCIAWWVFGLLRFLPDELAGKIVDKLLGMILLGMIGLA* |
| Ga0114346_11058133 | 3300008113 | Freshwater, Plankton | MNEYQKQADKFFKIFAKLYVAYLVIGLLPHLPDELAGKIVDKLFGMIGL* |
| Ga0114346_12246471 | 3300008113 | Freshwater, Plankton | VNEYQKQFDLFFKVFVRLCVAWWVLGLLRFLPDDVAKKVLGMFGL |
| Ga0114347_10034211 | 3300008114 | Freshwater, Plankton | MNDYQKQFDLFLKIFVRMCVAWYAVGFLRFLPDSLSDKIVAKFLAYIGLG* |
| Ga0114350_10702833 | 3300008116 | Freshwater, Plankton | VNEYQKQFDLFLKVFVRLCVAWWVLGFLQFLPDELAGKIVAKLLGMIGLG* |
| Ga0114359_11422833 | 3300008122 | Freshwater, Plankton | VNEYQKQADKFFKIFAKLYVAYLVIGLLPHLPDELAGKIVDKLLGMI |
| Ga0114337_11046352 | 3300008262 | Freshwater, Plankton | VNEYQKQADLFFKVCVRLCVAWWVLGLLRFLPDELAGKIVDKLLGMIGL* |
| Ga0114361_11354912 | 3300008265 | Freshwater, Plankton | VNEYQKQFDLFLKVFVRLCIAWWVLGLLRFLPDEVAGKIVDKLLGMIGLG* |
| Ga0114363_10554224 | 3300008266 | Freshwater, Plankton | EYQKQADKFFKIFAKLYVAYLVIGLLPHLPDELAGKIVDKLLGMIGL* |
| Ga0114363_10745364 | 3300008266 | Freshwater, Plankton | FAKLYVAYLVVGLLPHLPDELAGKIVDKLLGMIGL* |
| Ga0114363_11169723 | 3300008266 | Freshwater, Plankton | IKVWSVNEYQKQADLFFKVFVRLCIAWWVLGLLRFLPDNVAKKLLGMFGL* |
| Ga0114363_11172762 | 3300008266 | Freshwater, Plankton | VNDYQKQADKFFKIFAKLYVAYLVVGLLPHLPDELASNDKLLGMIGL* |
| Ga0114363_11261663 | 3300008266 | Freshwater, Plankton | KVFVRLCIAWWVLGFLQFLPDELAGKIVDKLLGMIGLG* |
| Ga0114364_10028708 | 3300008267 | Freshwater, Plankton | VNEYQKQFDQFLKIFVRLCIVWWVLGLLQYLPDELAGKIVDKLLGMIGL* |
| Ga0114364_10317354 | 3300008267 | Freshwater, Plankton | VNEYQKQADLFFKVFVRLCIAWWVLGLLRFLPDELAGKIVDKLLGMIGLG* |
| Ga0114364_10384462 | 3300008267 | Freshwater, Plankton | VNEYQKQADLFFKVFVRLCIAWWVLGLLRFLPDELAGKIVDKLLGMIGL* |
| Ga0114364_10570523 | 3300008267 | Freshwater, Plankton | VNEYQKQFDLFLKVFVRLCIVWWVLGLLRFLPDELAGKIVDKLLGMIGLG* |
| Ga0114364_11257492 | 3300008267 | Freshwater, Plankton | MNEYQKQADKFFKIFARLYVAYLVVGLLPHLPDELASKIVDKLLGMIGL* |
| Ga0114364_11363182 | 3300008267 | Freshwater, Plankton | VNEYQKQFDLFLKVFVRLCIAWWVLGLLRFLPDELAGKIVDKLLEMIGL* |
| Ga0114364_11419502 | 3300008267 | Freshwater, Plankton | VNEYQKQFELFCKVFVRLCIAIWVLGLLKFIPDALADKIVNKLLGMIGL* |
| Ga0114876_100226711 | 3300008448 | Freshwater Lake | VNEYQKQADKFFKIFARLYVAYLVIGLLPHLPDELAGKIVDKFLGMIGL* |
| Ga0114876_100408323 | 3300008448 | Freshwater Lake | VNDYQKQADKFFKIFAKLYVAYLVIGLLPHLPDKLASKIIDKLLGMIGL* |
| Ga0114876_10780052 | 3300008448 | Freshwater Lake | VNEYQKQADLFFKVFVRLCIAWWVLGLLRFLPDNVAKKLLGMFGL* |
| Ga0114876_11296763 | 3300008448 | Freshwater Lake | VNEYQKQFELFCKVFVRLCIAIWVLGLLKFIPDALADKIVNKLLGMIGLA* |
| Ga0114876_11474732 | 3300008448 | Freshwater Lake | VWAVNEYQKQFDLFLKVFVRLCIAWWVLGLLQFLPDDVAKKVLGMFGL* |
| Ga0114876_11615793 | 3300008448 | Freshwater Lake | MNEYQKQADKFFKIFAKLYVAYLVVGLLPHLPDELAGKIVDKLLGMIGL* |
| Ga0114876_11666372 | 3300008448 | Freshwater Lake | VWSVNEYQKQADLFFKVFVRLCVAWWVLGLLRFLPDDVAKKVLGMFGL* |
| Ga0114876_12081892 | 3300008448 | Freshwater Lake | DLFCKVFVRLCIAWWVLGLLRFLPDELAGKIVDKLLGMIGL* |
| Ga0114876_12497211 | 3300008448 | Freshwater Lake | IFAKLYVAYLVIGLLPHLPDELAGKIVDKLLGMIGL* |
| Ga0114876_12559222 | 3300008448 | Freshwater Lake | QFDLFLKVFVRLCIAWWVLGLLRFLPDELAGKIVDKLLGMIGL* |
| Ga0114880_100514212 | 3300008450 | Freshwater Lake | VNEYQKQFDLFCKVFVRICVAWWVLGLLPHLPDELASKIVDKLLGMIGL* |
| Ga0114880_11135523 | 3300008450 | Freshwater Lake | MRYQQVWAVNEYQKQFDLFLKVFVRLCIAWWVFGLLRFLPDELAGKIVDKLLGMIGLG* |
| Ga0114880_11704461 | 3300008450 | Freshwater Lake | EYQKQFDLFLKVFVRLCIAWWVLGLLRFLPDELAGKIVDKLLGMIGLG* |
| Ga0114880_11761862 | 3300008450 | Freshwater Lake | VNEYQKQADKFFKIFAKLYVAYLVVGLLPHLPDELASKIVDKLLGMIGL* |
| Ga0102831_11469463 | 3300008996 | Estuarine | VNEYQKQFDLFLKVFVRLCVAWYVVGFLRFLPDELADKVVNKL |
| Ga0102831_12150372 | 3300008996 | Estuarine | MWAVNEYQKQFDLFLKVFVRLCIAWWVLGFLQFLPDNLSDKIVNKLLGMIGLG* |
| Ga0102816_10965181 | 3300008999 | Estuarine | KVWSVNEYQKQFDLFCKVFVRLCIAWWVLGFLRFLPDDVAKKVLGMFGI* |
| Ga0102829_11045381 | 3300009026 | Estuarine | VWSVNEYQKQFDLFCKVFVRLCIAWWVLGFLRFLPDDVAKKVLGMFGI* |
| Ga0102860_10799463 | 3300009056 | Estuarine | EYQKQADLFFKVFVRLCVAWWVLGLLRFLPDDVAKKVLGMFGL* |
| Ga0102830_12325612 | 3300009059 | Estuarine | WSVNEYQKQFDLFLKVFVRLCVAWYVVGFLRFLPDELADKVVNKLLGMIGL* |
| Ga0115566_107326391 | 3300009071 | Pelagic Marine | VNEYQKQADKFFKIFAKLYVAYLVIGLLPHLPDELAGKIVDKLLGMIGL* |
| Ga0105099_105775582 | 3300009082 | Freshwater Sediment | VNEYQKQFDQFLKIFVRMYIVWWVLGLLQHLPDDLAGKIVDKLLGMIGL* |
| Ga0114978_101343582 | 3300009159 | Freshwater Lake | VWSVNEYQEQFDMFLKVFVRLCIAWWVLGLLRFLPDSLADKIVNKLLGMIGL* |
| Ga0114978_104014541 | 3300009159 | Freshwater Lake | QKVWSVNEYQKQADLFFKVFVRLCVAWWVLGLLQFLPDDVAKKVLGMFGL* |
| Ga0105102_103786052 | 3300009165 | Freshwater Sediment | VWAVNEYQKQFDLFLKVFVRLCIAWWVLGLLRFLPDELAGKIVDKLLGMIVL* |
| Ga0105102_105801562 | 3300009165 | Freshwater Sediment | YQKVWSVNEYQKQFDLFCKVFVRLCIAWWVLGLLQFLPDDVAKKVLGMFGL* |
| Ga0105102_106059432 | 3300009165 | Freshwater Sediment | VNEYQKQFDLFLKVFVRLCIAWWVLGLLQYLPDELAGKIVDKLLGMIGL* |
| Ga0105097_109296552 | 3300009169 | Freshwater Sediment | LKVFVRLCIAWWVLGLLQYLPDELAGKIVNKLLGMIGL* |
| Ga0114979_100473476 | 3300009180 | Freshwater Lake | NEYQEQFDMFLKVFVRLCIAWWVLGLLRFLPDSLADKIVNKLLGMIGL* |
| Ga0114976_100995485 | 3300009184 | Freshwater Lake | VNEYQKQFDLFLKVFVRLCIAWWVLGLLRFLPDNLSDKIVNKLLGMIGL* |
| Ga0114982_10858292 | 3300009419 | Deep Subsurface | VNEYQKQFDQFLKIFVRMYIAWWVLGLLQYLPDELAGKIVDKLLGMIGL* |
| Ga0114958_101981941 | 3300009684 | Freshwater Lake | KQFDLFLKVFIKLLIAWWVLGLLRFLPDSLSDKIVNKLLGMIGL* |
| Ga0133913_100221537 | 3300010885 | Freshwater Lake | VNEYQKQADLFFKVFVRLCVAWWVLGLLQFLPDDVAKKVLGMFGL* |
| Ga0137675_10001046 | 3300010966 | Pond Fresh Water | VWAVNEYQKQFDLFLKIFVRLCVVWWVLGLLKYLPDALADKIVNKLLGMIGL* |
| Ga0137575_100031794 | 3300010970 | Pond Fresh Water | VNEYQKQFDLFLKIFVRLCVVWWVLGLLKYLPDALADKIVNKLLGMIGL* |
| Ga0139557_10429702 | 3300011010 | Freshwater | VNEYQKQADKFFKIFAKLYVAYLVVGLLPHLPDELAGKIVNKLLGMIGLG* |
| Ga0151514_104798 | 3300011115 | Freshwater | VNEYQKQADLFFKVFVRLCVAWWVLGLLRFLPDEVAKKVLGMFGL* |
| Ga0151514_1048113 | 3300011115 | Freshwater | VNEYQKQFDQFLKVFVRLCIVIWVLGLLKYIPDALADKIVNKLLGMIGL* |
| Ga0151516_100457 | 3300011116 | Freshwater | VNEYQKQFDMFLKVFVRLCIAWWVLGLLRFLPDELAGKIVDKLLGMIGL* |
| Ga0136713_10466442 | 3300011183 | Freshwater | VRLCIAWWVLGLLRFLPDELAGKIVDKLLGMIGL* |
| Ga0153698_10241 | 3300011335 | Freshwater | VNEYQKQFDMFLKVFVRLCVAWWVLGLLQYLPDELAGKIVDKLLGMIGL* |
| Ga0153698_102480 | 3300011335 | Freshwater | AVNEYQKQFDMFLKVFVRLCVAWWVLGLLQYLTDELAGKIVDKLLGMIGL* |
| Ga0153700_1108711 | 3300011339 | Freshwater | VNEYQKQFDQFLKIFVRLCVVIWVLGLLQHIPDALADKIVNKLLGMIGL* |
| Ga0153805_10349353 | 3300012013 | Surface Ice | VNEYQKQADKFFKIFARLYVAYLVIGLLPHLPDELAGKIVDKLFGMIGL* |
| Ga0153805_10968411 | 3300012013 | Surface Ice | QADKFFKIFAKLYVAYLVIGLLPHLPDELAGKIVDKLLGMIGL* |
| Ga0157208_100003092 | 3300012667 | Freshwater | VNEYQKQFDQFLKIFVRLCIVWWVLGLLRFLPDELADKVVNKFLGMIGL* |
| Ga0164293_105015062 | 3300013004 | Freshwater | VNEYQKQFDLFCKVFVRLCIAWWVLGLLRFLPDEVAKKVLGMFGI* |
| Ga0164293_108563632 | 3300013004 | Freshwater | VNEYQKQFDQWLKIFVRLCIAWWLLGLLRFLPDDVAKKVLGMFGL* |
| Ga0164292_107311691 | 3300013005 | Freshwater | KQFDLFLKVFVRLCIAWWVLGLLRFLPDELAGKIVDKLLGMVGL* |
| Ga0177922_102312792 | 3300013372 | Freshwater | MNEYQKQAELFFKVATRLLIAWWVLGLLQHIPDALADKIVNKLLGMIGLG* |
| Ga0177922_102697392 | 3300013372 | Freshwater | LNEYQKQFDLFLKVFVRLYIAWWVFGLLQFLPDELAGKIVDKLLGMIGL* |
| Ga0177922_110684001 | 3300013372 | Freshwater | LFIQGWEMNEYQKQADKFFKIFAKLYVAYLVIGLLPHLPDELAGKIVDKLLGMIGL* |
| Ga0177922_112740563 | 3300013372 | Freshwater | FVRLCIAWWVLGLLRFLPDNLSDKIVNKLLGMIGLG* |
| Ga0134314_10000439 | 3300014711 | Surface Water | VNEYQKQFDLFLKVFVRMCVAWYAVGFLRFLPNDLSDKIVNKFLKMLGL* |
| Ga0119960_10170671 | 3300014811 | Aquatic | VNEYQKQFDLFLKVFVRLCIAWWVLGLLRFLPDELASKIVDKLLGMIGLG* |
| Ga0119960_10618631 | 3300014811 | Aquatic | VNEYQKQADKFFKIFAKLYVAYLVVGLLPHLPDELAGKIVDKLLGT* |
| Ga0119960_10760151 | 3300014811 | Aquatic | VNEYQKQFDLFLKVFVRLCVAWWVLGLLRFLPDELAGKIVNKLLGS* |
| Ga0181338_10496842 | 3300015050 | Freshwater Lake | VNEYQKQAELFFKVFVRLCIAWWVLGLLRFLPDELAGKIVNKLLGMIGLG* |
| Ga0181364_10268473 | 3300017701 | Freshwater Lake | CKIAVRLCVAIWVLGLLQFIPDPLADKIVNKLLGMIGL |
| Ga0181363_10039707 | 3300017707 | Freshwater Lake | MRYSKVWLVNEYQKQFDLFLKVFVRLCIAWWVIGLLRFLPDELAGKIVDKLLGMIGLG |
| Ga0181363_10514551 | 3300017707 | Freshwater Lake | QKQFDLFCKVFVRLCIAWWVLGLLRFLPDDVAKKVLGMFGL |
| Ga0181363_10894361 | 3300017707 | Freshwater Lake | GALRSVSESQQPFDLFLLAFVRLCFAWWVLGLLQFLPDDVAKKVLGMFGL |
| Ga0181350_10022743 | 3300017716 | Freshwater Lake | MRYSKVWAVNEYQKQADKFFKIFAKLYVAYLVIGLLPHLPNELAGKIVDKLLGMIGL |
| Ga0181350_10283612 | 3300017716 | Freshwater Lake | VNEYQKQFDLFCKVFVRLCIAWWVLGLLRFLPDDVAKKILGMFGL |
| Ga0181350_10764331 | 3300017716 | Freshwater Lake | VNEYQKQFDLFCKVFVRLCIAWWVLGLLRFLPDELAGKIVDKLLGM |
| Ga0181350_10859491 | 3300017716 | Freshwater Lake | QADLFFKVFVRLCVAWWVLGLLRFLPDDVAKKVLGMFGL |
| Ga0181350_11122002 | 3300017716 | Freshwater Lake | FLKVFVRLCIAWWVLGLLRFLPDELAGKIVDKLLGMIGL |
| Ga0181347_10878692 | 3300017722 | Freshwater Lake | VWSVNEYQKQFDLFCKVFVRLCIAWWVLGLLRFLPDDVAKKVLGMFGL |
| Ga0181347_11690622 | 3300017722 | Freshwater Lake | LNEYQKQFDLFLKVFVRLYIAWWVFGLLQFLPDELAGKIVNKLLKMIGL |
| Ga0181365_10946292 | 3300017736 | Freshwater Lake | LNEYQKQAELFFKVATRLIIAWWVLGLLQHLPDSLTDKIVNKLLGMIGL |
| Ga0181365_11018302 | 3300017736 | Freshwater Lake | GFLCNNQKVWSVNEYQKQAELFFKVFVRLCIAWWVLGLLRFLPDELAGKIVNKLLGMIGL |
| Ga0181352_10676892 | 3300017747 | Freshwater Lake | VCQDKVWSVNEYQKQFDLFLKVFVRLCVAWYVVGFLRFLPDELADKVVTKILGMFGL |
| Ga0181352_11234781 | 3300017747 | Freshwater Lake | LLCQDKVWSVNEYQKQFDLFLKVFVRLCVAWWVLGLLQYLPDELADKVVNKLLGMIGL |
| Ga0181344_10281924 | 3300017754 | Freshwater Lake | VNEYQKQFDQFLKIFVRLCVVWWVLGLLRFLPDELADKVVNKLLGMIGL |
| Ga0181344_10344933 | 3300017754 | Freshwater Lake | VNEYQKQFDQFLKIFVRLCIVIWVLGLLKYIPDTLADKIMDKLLSFIGLG |
| Ga0181344_10348732 | 3300017754 | Freshwater Lake | VRQDKVWSVNEYQKQFELFCKVFVRLCIAWWVLGLLRFLPDNVAKKLLGMFGL |
| Ga0181344_10390953 | 3300017754 | Freshwater Lake | VNEYQKQFDQFLKIFVRLCIVIWVLGLLKFIPDTLADKIVSKLLGMIGL |
| Ga0181344_11245592 | 3300017754 | Freshwater Lake | WSVNEYQKQFDLFCKVFVRLCIAWWVLGLLQFLPDDVAKKVLGMFGL |
| Ga0181344_11422591 | 3300017754 | Freshwater Lake | VNEYQKQFDLFCKVFVRLCIAWWVLGLLRFLPDEVAKKVLGMFG |
| Ga0181344_11672442 | 3300017754 | Freshwater Lake | VWSVNEYQKQADLFFKVFVRLCVAWWVLGLLRFLPDELAGKIVDKLLGMIGL |
| Ga0181344_12000001 | 3300017754 | Freshwater Lake | KVRAVNEYQKQFDQFLKIFVRLCIVIWVLGLLKFIPDSLADKIVDKLLGMIGLA |
| Ga0181356_10597022 | 3300017761 | Freshwater Lake | VNEYQKQADKFFKIFAKLYVAYLVVGLLPHLPEELAGKIVDKLLGMIGL |
| Ga0181356_12053002 | 3300017761 | Freshwater Lake | SLNEYQKQFDLFLKVFVRLCIAWWVLGLLRFLPDELAGKIVDKLLGMIGL |
| Ga0181356_12161882 | 3300017761 | Freshwater Lake | SVNEYQKQFDLFCKVFVRLCIAWWVLGLLRFLPDDVAKKVLGMFGI |
| Ga0181343_11486733 | 3300017766 | Freshwater Lake | DVSQDRVWSVNEYQKQFDLFLKVFVRLCIAWWVLGLLRFLPDELASKIVNKLLGMIGL |
| Ga0181358_12158452 | 3300017774 | Freshwater Lake | VRQVKVWSVNEYQKQFDLFLKVFVRLCVAWWVLGLLQYLPDELAGKIVNKLLGMIGL |
| Ga0181357_10062265 | 3300017777 | Freshwater Lake | VNEYQKQFDQFLKVFVRLCIVIWVLGLLKHIPDALADKIVTKLLGMIGL |
| Ga0181357_11343182 | 3300017777 | Freshwater Lake | VNEYQKQFDQFLKVFVRLYIAWWVLGLLRFLPDELAGKIVDKLLGMIGLG |
| Ga0181349_10911742 | 3300017778 | Freshwater Lake | VNEYQKQYDLFCKGFVRLCIAWWVLGLLRFLPDDVAKKVLGMFGL |
| Ga0181349_11053531 | 3300017778 | Freshwater Lake | QKQADKFFKIFAKLYVAYLVVGLLPHLPDELAGKIVDKLLGMIGL |
| Ga0181346_10863662 | 3300017780 | Freshwater Lake | VWSVNEYQKQFDLFCKVFVRLCIAWWVLGLLRFLPDEVAKKVLGMFGI |
| Ga0181346_11626782 | 3300017780 | Freshwater Lake | VNEYQKQFDLFLKVFVRLYIAWWVFGLLQFLPDELAGKIVNKLLKMIGL |
| Ga0181348_10900622 | 3300017784 | Freshwater Lake | VNEYQKQADKFFKIFAKLYVAYLVVGLLPHLPDELAGKIVDKLLGKIGL |
| Ga0181355_101500410 | 3300017785 | Freshwater Lake | LFIQGWEMNEYQKQADKFFKIFAKLYVAYLVIGLLPHLPDELAGKIVDKLLGMIGL |
| Ga0181355_12034593 | 3300017785 | Freshwater Lake | VNEYQKQFDLFLKVFVRLCIAWWVLGLLRFLPDELADKVVTKILG |
| Ga0181360_1076352 | 3300019781 | Freshwater Lake | MNEYQKQADKFFKIFAKLYVAYLVIGLLPHLPDELAGKIVDKLLGMIGL |
| Ga0181360_1135462 | 3300019781 | Freshwater Lake | FDLFLKIFVRLCIAWWVLGLLRFLPDDVANKLLRMIGLG |
| Ga0181359_10026307 | 3300019784 | Freshwater Lake | VNEYQKQFDLFLKVFVRLCVAWWVLGLLQHLPDELAGKIVDKLLGMIGL |
| Ga0181359_10217791 | 3300019784 | Freshwater Lake | LNEYQKQFDLFLKVFVRLCIAWWVLGLLRFLPDELAGKIVDKLLGMIGL |
| Ga0181359_10253624 | 3300019784 | Freshwater Lake | VNEYQKQAELFFKVFVRLCIAWWVLGLLRFLPDELAGKIVNKLLGMIGLG |
| Ga0181359_10833642 | 3300019784 | Freshwater Lake | VNEYQKQFDLFCKVFVRLCIAWWVLGLLRFLPDDVAKKVLGMFGL |
| Ga0181359_10921512 | 3300019784 | Freshwater Lake | VNEYQKQFDLFLKVFVRLCVAWWVLGLLQYLPDELAGKIVNKLLGMIGL |
| Ga0181359_11332671 | 3300019784 | Freshwater Lake | VNEYQKQFDLFCKVFVRLCIAWWVLGLLRFLPDELAGKIVDKLLGMIGL |
| Ga0181359_12043192 | 3300019784 | Freshwater Lake | VNEYQKQFDLFLKVFVRLCVAWYVVGFLRFLPDELADKVVNKLLGMIGL |
| Ga0181359_12172412 | 3300019784 | Freshwater Lake | VNEYQKQFDLFLKVFVRLCIAWWVLGLLRFLPDELAGKIVNKLLGMIGLG |
| Ga0211733_1013470711 | 3300020160 | Freshwater | VNEYQKQFDMFLKVFVRLCIVWWVLGLLRFLPDDVAKKVLGMFGL |
| Ga0211729_109198422 | 3300020172 | Freshwater | FDLFCKVFVRLCVAWWVLGLLRFLPDDVAKKVLGMFGL |
| Ga0211731_107592592 | 3300020205 | Freshwater | VNEYQKQAELFFKVFVRLCVAWWVLGLLRFLPDDVAKKVLGMFGL |
| Ga0211731_115468722 | 3300020205 | Freshwater | VNEYQKQAELFFKVFVRLCIAWWVFGLLRFLPDELAGKIVDKLLGMIGLG |
| Ga0208050_10154823 | 3300020498 | Freshwater | LKVFVRLCIAWWVLGFLQFLPDNLSDKIVNKLLGMIGLG |
| Ga0208856_10099353 | 3300020548 | Freshwater | VNEYQKQFDLFLKVFVRLCVAWYVVGFLRFLPDELADKVVNKLLGMIGLG |
| Ga0208723_10578182 | 3300020571 | Freshwater | VNEYQKQFDLFLKVFVRLCIAWWVLGLLRFLPDELAGKIVDKLLGM |
| Ga0213922_10251512 | 3300021956 | Freshwater | VNEYQKQFDLFLKIFVRMCVAWWVLGFLRFLPNDLSDKIVGKFLKMLGL |
| Ga0213922_11064042 | 3300021956 | Freshwater | VNEYQKQFDLFLKVFIRLCVVWWVLGFLRFLPDNLSDKIVNKFLGMIGLG |
| Ga0222714_100220927 | 3300021961 | Estuarine Water | VNEYQKQFDLFLKVFVRLCIAWWVLGLLRFLPDELASKIVDKLLGMIGL |
| Ga0222714_100377903 | 3300021961 | Estuarine Water | MRYSKVWAVNDYQKQADKFFKIFAKLYVAYLVIGLLPHLPDELASKIVNKLLGMIGL |
| Ga0222713_104538971 | 3300021962 | Estuarine Water | IFAKLYVAYLVIGLLPHLPDELAGKIVDKLLGMIGL |
| Ga0222712_100333365 | 3300021963 | Estuarine Water | VNEYQKQFDLFLKVFVRLCIAWWVLGLLRFLPDDVAKKLLGMFGL |
| Ga0222712_106849742 | 3300021963 | Estuarine Water | QWLKIFVRMCIAWYAVGFLKFLPDALADKVVSKFLSMIGLG |
| Ga0181353_10015908 | 3300022179 | Freshwater Lake | VNEYQKQFDLFLKVFVRLCIAWWVIGLLRFLPDELAGKIVDKLLGMIGLG |
| Ga0181353_10140932 | 3300022179 | Freshwater Lake | MWSVNEYQKQADLFFKVFVRLCVAWWVLGLLRFLPDDVAKKVLGMFGL |
| Ga0181353_10270672 | 3300022179 | Freshwater Lake | VNEYQKQFDLFLKVFVRLCIAWWVLGLLQFLPDDVAKKVLGMFGL |
| Ga0181353_10693862 | 3300022179 | Freshwater Lake | VCQDRVWSVNEYQKQFDLFLKVFVRLCIAWYVVGFLRFLPNELADKVVNKLLGMIGL |
| Ga0181353_11007662 | 3300022179 | Freshwater Lake | VCQDKVWSVNEYQKQFDLFLKVFVRLCIAWWVLGLLQYLPDELAGKIVDKLLGMIGL |
| Ga0181354_10179303 | 3300022190 | Freshwater Lake | VNEYQKQFDQFLKIFVRLCIVIWVLGLLKFIPDALADKIVSKLLGMIGL |
| Ga0181354_11020423 | 3300022190 | Freshwater Lake | KVRSLNEYQKQFDLFLKVFVRLCIAWWVLGLLRFLPDELAGKIVDKLLGMIGL |
| Ga0181351_10478384 | 3300022407 | Freshwater Lake | VNEYQKQFELFCKVFVRLCVAWWVLGLLPYLPDELAGKIVNKLLGMIGL |
| Ga0181351_10592911 | 3300022407 | Freshwater Lake | EYQKQADKFFKIFARLYVAYLVVGLLPHLPDELAGKIVDKLLGMIGL |
| Ga0181351_10720813 | 3300022407 | Freshwater Lake | VNEYQKQADLFFTVFVRLCVAWWVLGLLRFLPDELAGKIVDKLLGMIGLG |
| Ga0181351_11061463 | 3300022407 | Freshwater Lake | VNEYQKQFDQFLKIFVRMCVAWYVVGFLRFLPDELSDKIVNKFLSYIGLG |
| Ga0181351_11246512 | 3300022407 | Freshwater Lake | VNEYQKQAELFFKVFVRLCIAWWVLGLLRFLPDELAGKIVDKLLGMIGLG |
| Ga0181351_11269842 | 3300022407 | Freshwater Lake | VNEYQKQFDLFLKVFVRLCIAWWVLGLLPYLPDELASKIVDKLLGMIGL |
| Ga0181351_11806252 | 3300022407 | Freshwater Lake | VNEYQEQFELFCKVFVRLCVAWWVLGLLRFLPDELAGKIVDKLLGMIGL |
| Ga0181351_12196462 | 3300022407 | Freshwater Lake | VNEYQKQFDLFCKVFVRLCVAWYVVGFLRFLPDELADKVVNKLLGMIGL |
| Ga0181351_12234842 | 3300022407 | Freshwater Lake | KQFDLFLKVFVRLCVAWWVLGLLQYLPDELAGKIVDKLLGMIGL |
| Ga0244775_1000194620 | 3300024346 | Estuarine | VNEYQKQFDLFLKVFVRLCIAWWVLGLLRFLPDELAGKIVDKLLGMIGL |
| Ga0244775_100702634 | 3300024346 | Estuarine | VWSVNEYQKQFDLFLKVFVRLCIAWWVLGLLRFLPDELASKIVDKLLGMIGL |
| Ga0244775_103479893 | 3300024346 | Estuarine | VNEYQKQFDLFCKVFVRLCIAWWVLGFLRFLPDDVAKKVLGMFGI |
| Ga0209615_1023202 | 3300025075 | Freshwater | VNEYQKQFDLFLKVFVRLCVAWYVVGFLRFLPDELAEKVVTKILGMFGL |
| Ga0209615_1073311 | 3300025075 | Freshwater | VNEYQKQFDLFLKVFVRLCVAWYVVGFLRFLPDELADKVVTKILGMFGL |
| Ga0208424_10004414 | 3300025445 | Aqueous | VNEYQKQFDLFLKVFVRMCVAWWVLGFLRFLPDNLSDKIVNKLLGMLGL |
| Ga0208147_10075413 | 3300025635 | Aqueous | VWAVNEYQKQFDLFLKVFVRMCVAWYVVGFLRFLPNDLSDKIVAKLLGMVGL |
| Ga0255113_10782521 | 3300027147 | Freshwater | VNEYQKQFDLFCKVFVRLCIAWWVFGLLRFLPDELAGKIVDKLLGMIG |
| Ga0208438_10216493 | 3300027196 | Estuarine | DRVWSVNEYQKQFDLFLKVFVRLCIAWWVLGLLRFLPDELAGKIVDKLLGMIGL |
| Ga0208307_10004536 | 3300027211 | Estuarine | VNEYQKQFDQFLKVFVRLYIAWWVLGLLRFLPDELAGKIVDKLLGMIGL |
| Ga0255123_10264521 | 3300027589 | Freshwater | VNEYQKQFDLFLKVFVRLCIAWWVLGFLQFLPDNLSDKIVNKL |
| Ga0208974_10015249 | 3300027608 | Freshwater Lentic | VNEYQKQFDLFCKVFVRLCVAWWVLGLLRFLPDDVAKKVLGMFGL |
| Ga0208974_10706591 | 3300027608 | Freshwater Lentic | KVFVRLCIAWWVLGLLRFLPDELAGKIVDKLLGMIGLG |
| Ga0208975_10142601 | 3300027659 | Freshwater Lentic | QKQADKFFKIFAKLYVAYLVIGLLPHLPDELAGKIVDKLFGMIGL |
| Ga0208975_10804971 | 3300027659 | Freshwater Lentic | YQKQFDLFLKVFVRLCIAWWVLGLLRFLPDELASKIVNKLLGMIGL |
| Ga0208975_11348792 | 3300027659 | Freshwater Lentic | VNEYQKQADKFFKIFAKLYVAYLVVGLLPHLPDELASKIIDKLLGMIGL |
| Ga0209704_10383822 | 3300027693 | Freshwater Sediment | MWAVNEYQKQFDLFLKVFVRLCIAWWVLGLLRFLPDELAGKIVDKLLGMIGL |
| Ga0209704_12635551 | 3300027693 | Freshwater Sediment | NYQKVWSVNEYQKQFDLFCKVFVRLCIAWWVLGLLQFLPDDVAKKVLGMFGL |
| Ga0209599_100626842 | 3300027710 | Deep Subsurface | VNEYQKQFDQFLKIFVRMYIAWWVLGLLQYLPDELAGKIVDKLLGMIGL |
| Ga0209492_10905101 | 3300027721 | Freshwater Sediment | VNEYQKQFDLFLKVFVRLCIAWWVLGLLPYLPDELAGKIVDKLLGMIGL |
| Ga0209492_11458403 | 3300027721 | Freshwater Sediment | FDLFLKVFVRLCIAWWVLGLLPYLPDELAGKIVDKLLGMIGL |
| Ga0209190_10972884 | 3300027736 | Freshwater Lake | VLCCQQVWAVNEYQKQFDLFLKVFVRLYIAWWVFGLLQYLPDKLAGKIVDKLLGMIGL |
| Ga0209134_103059942 | 3300027764 | Freshwater Lake | MCQIKVRAVNEYQKQFDLFLKVFVRLCIAWWVLGLLRFLPDNIADKIVNKLLGVIGL |
| Ga0209500_101366203 | 3300027782 | Freshwater Lake | VWSVNEYQEQFDMFLKVFVRLCIAWWVLGLLRFLPDSLADKIVNKLLGMIGL |
| Ga0209246_100034624 | 3300027785 | Freshwater Lake | VNEYQKQFDLFLKVFVRLCIAWWVIGLLRFLPDELAGKIVDKLLGMIGL |
| Ga0209972_103079901 | 3300027793 | Freshwater Lake | NDYQKQADKFFKIFAKLYVAYLVVGLLPHLPDELASKIVDKLLGMIGL |
| Ga0209972_103672332 | 3300027793 | Freshwater Lake | VNEYQKQFDLFLKVFVRLCIAWWVFGLLRFLPDELAGKIVDKLLGMIGLG |
| Ga0209353_101125824 | 3300027798 | Freshwater Lake | FVRQVKVWSVNEYQKQFDLFLKVFVRLCVAWWVLGLLQYLPDELAGKIVNKLLGMIGL |
| Ga0209353_103021752 | 3300027798 | Freshwater Lake | VWAVNEYQKQFDLFLKVFVRLCIAWWVLGLLRFLPDELAGKIVDKLLGMIGL |
| Ga0209229_100025869 | 3300027805 | Freshwater And Sediment | VNEYQKQADLFFKVFVRLCVAWWVLGLLQYLPDELAGKIVDKLLGMIGL |
| Ga0209229_100503342 | 3300027805 | Freshwater And Sediment | VNEYQKQADKFFKIFARLYVAYLVIGLLPHLPDELAGKIVNKFLGMIGL |
| Ga0209354_100679455 | 3300027808 | Freshwater Lake | WIRGAVAWYVLGFLQFLPDSLSNKIMDKLLGMIGLG |
| Ga0209354_103144142 | 3300027808 | Freshwater Lake | VWAVNEYQKQADKFFKIFAKLYVAYLVVGLLPHLPDELAGKIVNKLLGMIGLG |
| Ga0209354_103258841 | 3300027808 | Freshwater Lake | VRQVKVWSVNEYQKQFDLFLKVFVRLCVAWWVLGLLQYLPDELAGKIVNK |
| Ga0209990_101441823 | 3300027816 | Freshwater Lake | FDLFCKVFVRLCIAWWVLGLLRFLPDELAGKIVDKLLGMIGLG |
| Ga0209990_102871522 | 3300027816 | Freshwater Lake | VWAVNEYQKQFDLFLKVFVRLCIAWWVLGFLQFLPDELAGKIVDKLLGMIGLG |
| Ga0209990_104450952 | 3300027816 | Freshwater Lake | IFARLYVAYLVIGLLPHLPDELAGKIVDKLLGMIGL |
| Ga0209230_104356401 | 3300027836 | Freshwater And Sediment | KIFARLYVAYLVVGLLPHLPDELAGKIVDKLLGMIGL |
| Ga0209230_105945781 | 3300027836 | Freshwater And Sediment | ADKFFKIFAKLYVAYLVVGLLPHLPDELAGKIVDKLLGMIGL |
| Ga0247723_100008929 | 3300028025 | Deep Subsurface Sediment | VNEYQKQFDLFLKVFVRLCIAWWVLGLLRFLPDELAKKIVDKLLGMIGL |
| Ga0247723_100097015 | 3300028025 | Deep Subsurface Sediment | VNEYQKQFDLFLKVFVRLCVAWWVLGLLRFLPDELAEKVVNKLLGMIGL |
| Ga0247723_10012047 | 3300028025 | Deep Subsurface Sediment | VNEYQKQADLFFKVFVRLCVAWWVLGLLRFLPDEVAKKVLGMFGL |
| Ga0247723_100244413 | 3300028025 | Deep Subsurface Sediment | VNEYQKQAEMFFKVATRLIIAWWVVGLLQHLPDALADKIVNKLLGMIGL |
| Ga0247723_10045112 | 3300028025 | Deep Subsurface Sediment | VWSVNEYQKQFDQFLKVFVRLYIAWWVLGLLRFLPDELAGKIVDKLLGMIGL |
| Ga0247723_10049231 | 3300028025 | Deep Subsurface Sediment | CQDKVWSVNEYQKQFDLFLKVFVRLCIAWWVLGLLQYLPDELAGKIVDKLLGMIGL |
| Ga0247723_10063414 | 3300028025 | Deep Subsurface Sediment | VNEYQKQFDLFLKVFVRLCVAWWVLGLLQYLPDELADKVVNKLLGMIGL |
| Ga0247723_10102532 | 3300028025 | Deep Subsurface Sediment | VNEYQKQFDLFCKVFVRLCVAWWVLGLLQFLPDDVAKKVLGMFGL |
| Ga0247723_10186856 | 3300028025 | Deep Subsurface Sediment | VWAVNEYQKQADLFFKVFVRLCVAWWVLGLLRFLPDELAGKIVDKLLGMIGL |
| Ga0247723_10197214 | 3300028025 | Deep Subsurface Sediment | VNEYQKQADLFFKVFVRLCVAWWVLGLLRFLPDEVAKKVLGMFGI |
| Ga0247723_10278694 | 3300028025 | Deep Subsurface Sediment | VNEYQKQFDQFLKIFVRLCIAWWVLGLLRFLPDELADKVVTKILGMFGL |
| Ga0247723_10371141 | 3300028025 | Deep Subsurface Sediment | VNEYQKQFDLFLKIFVRLCVVWWVLGLLRFLPDELAGKIVDKLLGMIGLG |
| Ga0247723_11064902 | 3300028025 | Deep Subsurface Sediment | DLFCKVFVRLCIAWWVLGLLRFLPDEVAKKVLGMFGI |
| Ga0247722_101139092 | 3300028027 | Deep Subsurface Sediment | VCQDRVWSVNEYQKQFDLFLKVFVRLCIAWYVVGFLRFLPDELADKVVNKLLGMIGL |
| (restricted) Ga0247843_10360944 | 3300028569 | Freshwater | VNEYQKQFDLFLKVFVRLCIVWWVLGLLHFLPDELAGKIVDKLLGMIGL |
| (restricted) Ga0247843_10464931 | 3300028569 | Freshwater | VRQIKVWAVNEYQKQFDLFLKVFVRLCIAWWVLGLLRFLPDELAGKIVDKLLGMIGLG |
| Ga0315907_100076645 | 3300031758 | Freshwater | MNDYQKQFDLFLKIFVRMCVAWYAVGFLRFLPDSLSDKIVAKFLAYIGLG |
| Ga0315907_100142631 | 3300031758 | Freshwater | MRYQQVWAVNEYQKQFDLFLKVFVRLCIAWWVLGLLRFLPDELAGKIVNKLLGMIGLG |
| Ga0315907_100645675 | 3300031758 | Freshwater | MRYQQVWAVNEYQKQFDLFLKVFVRLCIAWWVLGLLRFLPDELAGKIVDKLLGMIGL |
| Ga0315907_100670618 | 3300031758 | Freshwater | LRPIKVWAVNEYQKQADKFFKIFARLYVAYLVIGLLPHLPDELAGKIVNKLLGMIGL |
| Ga0315907_101477982 | 3300031758 | Freshwater | VWAVNEYQKQFDLFLKVFVRLCIAWWVLGLLRFLPDELAGKIVDKLLGMIGLG |
| Ga0315907_101611384 | 3300031758 | Freshwater | FDLFLKVFVRLCIAWWVLGLLRFLPDELAGKIVDKLLGMIGLG |
| Ga0315907_103874133 | 3300031758 | Freshwater | VNEYQKQFDLFLKVFVRLCIAWWVLGFLQFLPDELAGKIVDKLLGMIGLG |
| Ga0315907_103941931 | 3300031758 | Freshwater | FAKLYVAYLVVGLLPHLPDELASKIVDKLLGMIGL |
| Ga0315907_104261633 | 3300031758 | Freshwater | MRYQQVWAVNEYQKQFDLFLKVFVRLCIAWWVFGLLRFLPDELAGKIVDKLLGMIGLG |
| Ga0315907_105224163 | 3300031758 | Freshwater | VNEYQKQFDLFLKVFVRLCIAWWVLGLLRFLPDELAGKIVDKLLGMIGLG |
| Ga0315907_106284662 | 3300031758 | Freshwater | MRYSKVWSVNEYQKQFDLFCKVFVRLCIAWWVFGLLRFLPDELAGKIVDKLLGMIGLG |
| Ga0315899_104835641 | 3300031784 | Freshwater | FCKVFVRLCIAWWVFGLLRFLPDELAGKIVDKLLGMIGLG |
| Ga0315899_116914092 | 3300031784 | Freshwater | VNEYQKQADKFFKIFARLYVAYLVIGLLPHLPNELAGKIVNKLLGMIGL |
| Ga0315909_101403213 | 3300031857 | Freshwater | VNEYQKQFDLFLKVFVRLCIAWWVLGLLRFLPDELAGKIVDKLLGMVGL |
| Ga0315909_101654121 | 3300031857 | Freshwater | FARLYVAYLVVGLLPHLPDELAGKIVDKLLGMIGL |
| Ga0315909_102016341 | 3300031857 | Freshwater | VWSVNEYQKQFDQFLKIFVRLCVAWWVLGFLRFLPDHIADKVVNKILGMFGL |
| Ga0315909_103238642 | 3300031857 | Freshwater | VNEYQKQFDLFCKVFVRLCIAWWVFGLLRFLPDELAGKIVDKLLGMIGLG |
| Ga0315909_103457743 | 3300031857 | Freshwater | VFVRLCIAWWVLGLLRFLPDELAGKIVDKLLGMIGL |
| Ga0315904_102356175 | 3300031951 | Freshwater | VNEYQKQFDQFLKIFVRLCVAWWVLGFLRFLPDHIADKVVNKILGMFGL |
| Ga0315904_104339281 | 3300031951 | Freshwater | KVWSVNEYQKQFDLFLKVFVRLCVAWWVLGLLQYLPDELAGKIVNKLLGMIGL |
| Ga0315904_107976521 | 3300031951 | Freshwater | YQKQADKFFKIFAKLYVAYLVIGLLPHLPDELAGKIVDKLLGMIGL |
| Ga0315904_108709622 | 3300031951 | Freshwater | MRYDKVRAVNEYQKQFDQFLKIFVRLCIVIWVLGLLKFIPDSLADKIVSKLLGMIGL |
| Ga0315294_1008929711 | 3300031952 | Sediment | FVRLCIVIWVLGLLKHIPDALADKIVTKLLGMIGL |
| Ga0315294_115481332 | 3300031952 | Sediment | VNEYQKQADLFFKVFVRLCIAWWVLGLLRFLPDNVAKKLLGMFGL |
| Ga0315901_105083851 | 3300031963 | Freshwater | VWSVNEYQKQADLFFKVFVRLCIAWWVLGLLRFLPDNVAKKLLGMFGL |
| Ga0315901_105568652 | 3300031963 | Freshwater | MRYDKVRAVNEYQKQADKFFKIFARLYVAYLVIGLLPHLPNELAGKIVNKLLGMIGL |
| Ga0315274_120236322 | 3300031999 | Sediment | VNEYQKQAELFFKVATRLIIAWWVVGLLQHLPNELASKIVNKLLGMIGL |
| Ga0315906_102800121 | 3300032050 | Freshwater | WEMNEYQKQADKFFKIFAKLYVAYLVIGLLPHLPDELAGKIVDKLLGMIGL |
| Ga0315906_108153181 | 3300032050 | Freshwater | DLFLKVFVRLCIAWWVLGLLRFLPDELAGKIVDKLLGMIGLG |
| Ga0315905_100089375 | 3300032092 | Freshwater | VNEYQKQFDLFCKVFVRICVAWWVLGLLPHLPDELASKIVDKLLGMIGL |
| Ga0315905_113886742 | 3300032092 | Freshwater | VNEYQKQFDLFLKVFVRLYIAWWVFGLLQFLPDELAGKIVDKLLGMIGL |
| Ga0315902_100060359 | 3300032093 | Freshwater | LFFKVFVRLCVAWWVLGLLRFLPDELAGKIVDKLLGMIGL |
| Ga0315902_101356045 | 3300032093 | Freshwater | FIQGWEMNEYQKQADKFFKIFARLYVAYLVVGLLPHLPDELAGKIVDKLLGMIGL |
| Ga0315903_109754191 | 3300032116 | Freshwater | QKQADKFFKIFAKLYVAYLVIGLLPHLPDELAGKIVDKLLGMIGL |
| Ga0315903_110934192 | 3300032116 | Freshwater | VNEYQKQADKFFKIFARLYVAYLVIGLLPHLPDELAGKIVDKFLGMIGL |
| Ga0315903_111711532 | 3300032116 | Freshwater | DKVWSVNEYQKQFDQFLKIFVRLCVVWWVLGLLRFLPDELAEKVVNKLLGMIGL |
| Ga0334977_0013720_2541_2717 | 3300033978 | Freshwater | MRYNKVRAVNEYQKQFDQFLKIFVRLCIVIWVLGLLKFIPDSLANKIVDKLLGMIGLA |
| Ga0334978_0003208_4096_4233 | 3300033979 | Freshwater | VNEYQKQFDLFCKVFVRLCIAWWVLGLLRFLPDEVAKKVLGMFGI |
| Ga0334982_0000109_23092_23250 | 3300033981 | Freshwater | VWSVNEYQKQFDLFLKVFVRLCIAWYVVGFLRFLPDELADKVVNKLLGMIGL |
| Ga0334982_0289944_424_597 | 3300033981 | Freshwater | MRQIKVWSVNEYQKQFDQFLKIFVRLCVVWWVLGLLRFLPDELADKVVNKLLGMIGL |
| Ga0334982_0528515_240_398 | 3300033981 | Freshwater | VWSVNEYQKQFDLFLKVFVRLCIAWWVLGLLRFLPDELAGKIVDKLLGMIGL |
| Ga0334994_0000570_15573_15731 | 3300033993 | Freshwater | VWAVNEYQKQFDLFLKVFVRLCIAWWVLGLLRFLPDELASKIVNKLLGMIGL |
| Ga0334996_0083964_347_496 | 3300033994 | Freshwater | VNEYQKQFDLFCKVFVRLCVAWWVLGLLQYLPDELAGKIVNKLLGMIGL |
| Ga0334979_0142558_677_838 | 3300033996 | Freshwater | VRQDKVWSVNEYQKQFDQWLKIFVRLCIAWWLLGLLRFLPDDVAKKVLGMFGL |
| Ga0334979_0733703_77_235 | 3300033996 | Freshwater | VWAVNEYQKQFDLFLKVFVRLCIVWWVLGLLRFLPDELAGKIVDKLLGMIGL |
| Ga0334986_0012508_525_674 | 3300034012 | Freshwater | VNEYQKQFDLFLKVFVRLCVAWWVLGLLRYLPDELAEKIVNKLFGMIGL |
| Ga0334986_0211523_818_994 | 3300034012 | Freshwater | VCQIKVWAVNEYQKQFDLFLKVFVRLCIAWWVLGLLRFLPDELAGKIVDKLLGMIGLG |
| Ga0334991_0025283_1126_1275 | 3300034013 | Freshwater | VNEYQKQFDLFLKVFVRLCIAWYVVGFLRFLPDELADKVVTKILGMFGL |
| Ga0335004_0620190_142_315 | 3300034021 | Freshwater | MRYDKVRAVNEYQKQFDQFLKIFVRLCIVIWVLGLLKFIPDTLADKIVNKLLGLIGL |
| Ga0335004_0733875_368_505 | 3300034021 | Freshwater | MCKIKVWAVNEYQKQFDLFLKVFVRLCIAWWVLGLLRFLPDELAGK |
| Ga0335005_0316242_598_774 | 3300034022 | Freshwater | MCQIKVWAVNEYQKQFDLFLKVFVRLCIAWWVLGFLQFLPDNLSDKIVNKLLGMIGLG |
| Ga0335005_0546539_8_184 | 3300034022 | Freshwater | VCKIKVWAVNEYQKQFDLFLKVFVRLCIAWWVLGLLRFLPDELAGKIVDKLLGMIGLG |
| Ga0334987_0164379_316_474 | 3300034061 | Freshwater | VWSVNEYQKQFDQFLKIFVRLCVVWWVLGLLRFLPDELADKVVNKLLGMIGL |
| Ga0334995_0461001_615_776 | 3300034062 | Freshwater | MWAVNEYQKQFDLFLKVFVRLCIAWWVLGFLQFLPDNLSDKIVNKLLGMIGLG |
| Ga0334995_0475815_598_756 | 3300034062 | Freshwater | WAVNEYQKQFDLFLKVFVRLCIAWWVLGLLRFLPDELAGKIVDKLLGMIGLG |
| Ga0335019_0003941_4311_4460 | 3300034066 | Freshwater | VNEYQKQFDLFCKVFVRLCVAWWVLGLLQHLPDELASKIVDKLLGMIGL |
| Ga0335019_0727582_13_171 | 3300034066 | Freshwater | VWSVNEYQKQFDLFLKVFVRLCIAWWVLGLLQYLPDALAGKIVDKLLGMIGL |
| Ga0335019_0864732_321_467 | 3300034066 | Freshwater | MWSVNEYQKQFDLFLKVFVRLCVAWWVLGLLRFLPDDVAKKVLGMFGL |
| Ga0334990_0221841_879_1031 | 3300034068 | Freshwater | VNEYQKQFDQFLKIFVRLCIVIWVLGLLKFIPDSLADKIVDKLLGMIGLA |
| Ga0334990_0424471_1_162 | 3300034068 | Freshwater | MRYDKVRAVNEYQKQFDQFLKIFVRLCIVIWVLGLLKFIPDSLADKIVDKLLGM |
| Ga0335028_0471316_50_223 | 3300034071 | Freshwater | VCQIKVWSVNEYQKQFDLFLKVFVRLCVAWYVVGFLRFLPDELADKVVNKLLGMIGL |
| Ga0335028_0557498_484_621 | 3300034071 | Freshwater | VNEYQKQFDQWLKIFVRLCIAWWLLGLLRFLPDDVAKKVLGMLGL |
| Ga0335010_0045937_3004_3177 | 3300034092 | Freshwater | VCQIKVWAVNEYHKQFDLFLKVFVRLCIAWWVLGLLRFLPDELAGKIVDKLLGMIGL |
| Ga0335012_0410871_546_659 | 3300034093 | Freshwater | KVFVRLCIAWWVLGLLRFLPDELAGKIVDKLLGMIGL |
| Ga0335012_0516830_1_123 | 3300034093 | Freshwater | FLKVFVRLCIAWWVLGFLQFLPDNLSDKIVNKLLGMIGLG |
| Ga0335012_0569966_343_501 | 3300034093 | Freshwater | VWAVNEYQKQFDLFLKVFVRLCIAWWVLGLLRFLPDELAGTIVDKLLGMIGL |
| Ga0335030_0843919_2_109 | 3300034103 | Freshwater | VRLCIAWWVLGLLRFLPDDLAGKIVNKLLGMIGLG |
| Ga0335031_0196756_1195_1365 | 3300034104 | Freshwater | GILCNYQKVWSVNEYQKQFDLFCKVFVRLCIAWWVLGLLQFLPDDVAKKVLGMFGI |
| Ga0335031_0376829_716_862 | 3300034104 | Freshwater | MWSVNEYQKQFDLFCKVFVRLCIAWWVLGLLQFLPDDVAKKVLGMFGI |
| Ga0335031_0385452_2_130 | 3300034104 | Freshwater | FDLFLKVFVRLCVAWWVLGLLQYLPDELAGKIVNKLLGMIGL |
| Ga0335031_0411812_7_195 | 3300034104 | Freshwater | MSWLNCGQDKVWSVNEYQKQFDLFLKVFVRLCIAWWVLGLLQYLPDELAGKIVDKLLGMIGL |
| Ga0335035_0021172_4202_4339 | 3300034105 | Freshwater | QKQFDLFLKVFVRLCIAWWVLGLLRFLPDELAGKIVDKLLGMIGL |
| Ga0335035_0308051_81_230 | 3300034105 | Freshwater | LNEYQKQFDLFLKVFVRLCIAWWVLGLLRFLPDELAGKIVGKLLGMIGL |
| Ga0335036_0044227_1116_1274 | 3300034106 | Freshwater | VWSVNEYQKQFDLFLKVFVRLCVAWYVVGFLRFLPDELAEKVVNKLLGMIGL |
| Ga0335036_0065577_2532_2705 | 3300034106 | Freshwater | MRQDKVWSVNEYQKQFDLFLKVFVRLCVAWWVLGLLQYLPDDLSDKIVNKLLGMFGL |
| Ga0335036_0342936_864_977 | 3300034106 | Freshwater | KVFVRLCIAWWVLGLLRFLPDELAGKIVDKLLGMVGL |
| Ga0335036_0622279_517_651 | 3300034106 | Freshwater | NEYQKQFDLFCKVFVRLCIAWWVLGLLQFLPDDVAKKVLGMFGI |
| Ga0335066_0685306_2_133 | 3300034112 | Freshwater | QFDLFLKVFVRLCVAWWVLGLLQYLPDELAGKIVDKLLGMIGL |
| Ga0335033_0334782_642_764 | 3300034117 | Freshwater | LFLKVFVRLCIAWWVLGLLRFLPDELAGKIVDKLLGMIGL |
| Ga0335054_0119510_764_922 | 3300034119 | Freshwater | VWSVNEYQKQFDLFLKVFVRLCIAWWVLGLLQYLPDELAGKIVDKLLGMIGL |
| Ga0335054_0568495_57_215 | 3300034119 | Freshwater | VWSVNEYQKQFDQFLKIFVRLCIVWWVLGLLRFLPDELADKVVTKILGMFGL |
| Ga0335060_0376724_634_756 | 3300034122 | Freshwater | LFLKVFVRLCVAWWVLGLLQYLPDELAGKIVDKLLGMIGL |
| Ga0335017_0124181_237_386 | 3300034167 | Freshwater | VNEYQKQFDLFLKVFVRLCVAWWVLGLLPYLPDELASKIVDKLFGMIGL |
| Ga0335061_0416170_68_214 | 3300034168 | Freshwater | MWSVNEYQKQFDLFCKVFVRLCIAWWVLGLLRFLPDEVAKKVLGMFGI |
| Ga0335065_0015560_4140_4289 | 3300034200 | Freshwater | VNEYQKQFDLFLKVFVRLCVAWYVVGFLRFLPDELAEKVVNKLLGMIGL |
| Ga0335052_0513068_334_510 | 3300034279 | Freshwater | VCQIKVWAVNEYQKQFDLFLKVFVRLCIAWWVLGFLQFLPDNLSDKIVNKLLGMIGLG |
| Ga0335007_0789277_195_353 | 3300034283 | Freshwater | VWSVNEYQKQFDQFLKIFVRLCVVWWVLGLLRFLPDELADKVVNKILGIFGL |
| ⦗Top⦘ |