Basic Information | |
---|---|
Family ID | F006611 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 369 |
Average Sequence Length | 38 residues |
Representative Sequence | IHREGWTLVLNPDGTTTAWNKDKTKVLHSHGPPARAG |
Number of Associated Samples | 242 |
Number of Associated Scaffolds | 369 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.90 % |
% of genes near scaffold ends (potentially truncated) | 91.33 % |
% of genes from short scaffolds (< 2000 bps) | 85.64 % |
Associated GOLD sequencing projects | 227 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.49 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (78.591 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa (17.886 % of family members) |
Environment Ontology (ENVO) | Unclassified (20.325 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.108 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 20.00% Coil/Unstructured: 80.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 369 Family Scaffolds |
---|---|---|
PF03734 | YkuD | 3.25 |
PF07992 | Pyr_redox_2 | 2.71 |
PF13411 | MerR_1 | 1.90 |
PF00270 | DEAD | 1.63 |
PF11716 | MDMPI_N | 1.63 |
PF00196 | GerE | 1.36 |
PF01406 | tRNA-synt_1e | 1.36 |
PF01370 | Epimerase | 1.36 |
PF01814 | Hemerythrin | 1.36 |
PF03466 | LysR_substrate | 1.36 |
PF16884 | ADH_N_2 | 1.08 |
PF00583 | Acetyltransf_1 | 1.08 |
PF13280 | WYL | 1.08 |
PF01243 | Putative_PNPOx | 1.08 |
PF13561 | adh_short_C2 | 0.81 |
PF03795 | YCII | 0.81 |
PF01717 | Meth_synt_2 | 0.81 |
PF13520 | AA_permease_2 | 0.81 |
PF04851 | ResIII | 0.81 |
PF00596 | Aldolase_II | 0.81 |
PF00903 | Glyoxalase | 0.81 |
PF00303 | Thymidylat_synt | 0.81 |
PF03551 | PadR | 0.54 |
PF13412 | HTH_24 | 0.54 |
PF00107 | ADH_zinc_N | 0.54 |
PF00155 | Aminotran_1_2 | 0.54 |
PF02771 | Acyl-CoA_dh_N | 0.54 |
PF01230 | HIT | 0.54 |
PF01850 | PIN | 0.54 |
PF08241 | Methyltransf_11 | 0.54 |
PF08281 | Sigma70_r4_2 | 0.54 |
PF01326 | PPDK_N | 0.54 |
PF02452 | PemK_toxin | 0.54 |
PF02515 | CoA_transf_3 | 0.54 |
PF13191 | AAA_16 | 0.54 |
PF00293 | NUDIX | 0.54 |
PF08450 | SGL | 0.54 |
PF08044 | DUF1707 | 0.54 |
PF13676 | TIR_2 | 0.54 |
PF08240 | ADH_N | 0.54 |
PF00723 | Glyco_hydro_15 | 0.54 |
PF02720 | DUF222 | 0.54 |
PF07730 | HisKA_3 | 0.54 |
PF01925 | TauE | 0.27 |
PF00582 | Usp | 0.27 |
PF00175 | NAD_binding_1 | 0.27 |
PF01636 | APH | 0.27 |
PF13565 | HTH_32 | 0.27 |
PF01494 | FAD_binding_3 | 0.27 |
PF00970 | FAD_binding_6 | 0.27 |
PF08327 | AHSA1 | 0.27 |
PF00005 | ABC_tran | 0.27 |
PF04203 | Sortase | 0.27 |
PF00067 | p450 | 0.27 |
PF03965 | Penicillinase_R | 0.27 |
PF09922 | DUF2154 | 0.27 |
PF11268 | DUF3071 | 0.27 |
PF00999 | Na_H_Exchanger | 0.27 |
PF01625 | PMSR | 0.27 |
PF17124 | ThiJ_like | 0.27 |
PF02518 | HATPase_c | 0.27 |
PF02817 | E3_binding | 0.27 |
PF13977 | TetR_C_6 | 0.27 |
PF10056 | DUF2293 | 0.27 |
PF14310 | Fn3-like | 0.27 |
PF14224 | DUF4331 | 0.27 |
PF04237 | YjbR | 0.27 |
PF01844 | HNH | 0.27 |
PF00561 | Abhydrolase_1 | 0.27 |
PF13426 | PAS_9 | 0.27 |
PF03703 | bPH_2 | 0.27 |
PF09278 | MerR-DNA-bind | 0.27 |
PF01402 | RHH_1 | 0.27 |
PF01828 | Peptidase_A4 | 0.27 |
PF04655 | APH_6_hur | 0.27 |
PF08388 | GIIM | 0.27 |
PF00271 | Helicase_C | 0.27 |
PF13975 | gag-asp_proteas | 0.27 |
PF00378 | ECH_1 | 0.27 |
PF02782 | FGGY_C | 0.27 |
PF06305 | LapA_dom | 0.27 |
PF13460 | NAD_binding_10 | 0.27 |
PF00324 | AA_permease | 0.27 |
PF13546 | DDE_5 | 0.27 |
PF03707 | MHYT | 0.27 |
PF00574 | CLP_protease | 0.27 |
PF13683 | rve_3 | 0.27 |
PF00484 | Pro_CA | 0.27 |
PF13230 | GATase_4 | 0.27 |
PF13473 | Cupredoxin_1 | 0.27 |
PF12006 | DUF3500 | 0.27 |
PF12225 | DUF5981 | 0.27 |
PF01774 | UreD | 0.27 |
PF02909 | TetR_C_1 | 0.27 |
PF01168 | Ala_racemase_N | 0.27 |
PF12695 | Abhydrolase_5 | 0.27 |
PF01546 | Peptidase_M20 | 0.27 |
PF07045 | DUF1330 | 0.27 |
PF00230 | MIP | 0.27 |
PF01566 | Nramp | 0.27 |
PF01883 | FeS_assembly_P | 0.27 |
PF07110 | EthD | 0.27 |
PF08031 | BBE | 0.27 |
PF01467 | CTP_transf_like | 0.27 |
PF00672 | HAMP | 0.27 |
PF13607 | Succ_CoA_lig | 0.27 |
PF13424 | TPR_12 | 0.27 |
PF13649 | Methyltransf_25 | 0.27 |
PF00753 | Lactamase_B | 0.27 |
PF07690 | MFS_1 | 0.27 |
PF00326 | Peptidase_S9 | 0.27 |
PF05853 | BKACE | 0.27 |
PF01790 | LGT | 0.27 |
PF00106 | adh_short | 0.27 |
PF13345 | Obsolete Pfam Family | 0.27 |
PF05598 | DUF772 | 0.27 |
PF01575 | MaoC_dehydratas | 0.27 |
PF03729 | DUF308 | 0.27 |
PF06445 | GyrI-like | 0.27 |
PF01300 | Sua5_yciO_yrdC | 0.27 |
PF00664 | ABC_membrane | 0.27 |
PF06475 | Glycolipid_bind | 0.27 |
PF02788 | RuBisCO_large_N | 0.27 |
PF08402 | TOBE_2 | 0.27 |
PF14329 | DUF4386 | 0.27 |
PF00069 | Pkinase | 0.27 |
PF07282 | OrfB_Zn_ribbon | 0.27 |
PF00920 | ILVD_EDD | 0.27 |
PF01474 | DAHP_synth_2 | 0.27 |
PF07366 | SnoaL | 0.27 |
PF13419 | HAD_2 | 0.27 |
PF01791 | DeoC | 0.27 |
COG ID | Name | Functional Category | % Frequency in 369 Family Scaffolds |
---|---|---|---|
COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 3.25 |
COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 3.25 |
COG0018 | Arginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.36 |
COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.36 |
COG0215 | Cysteinyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.36 |
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 1.08 |
COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.81 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.81 |
COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 0.81 |
COG0207 | Thymidylate synthase | Nucleotide transport and metabolism [F] | 0.81 |
COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.54 |
COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 0.54 |
COG0129 | Dihydroxyacid dehydratase/phosphogluconate dehydratase | Carbohydrate transport and metabolism [G] | 0.54 |
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.54 |
COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.54 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.54 |
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.54 |
COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.54 |
COG3387 | Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family | Carbohydrate transport and metabolism [G] | 0.54 |
COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.54 |
COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 0.54 |
COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.54 |
COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 0.54 |
COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.54 |
COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.54 |
COG0574 | Phosphoenolpyruvate synthase/pyruvate phosphate dikinase | Carbohydrate transport and metabolism [G] | 0.54 |
COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 0.54 |
COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.27 |
COG3554 | Uncharacterized conserved protein | Function unknown [S] | 0.27 |
COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.27 |
COG3200 | 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthase, class II | Amino acid transport and metabolism [E] | 0.27 |
COG3246 | Uncharacterized conserved protein, DUF849 family | Function unknown [S] | 0.27 |
COG3771 | Lipopolysaccharide assembly protein YciS/LapA, DUF1049 family | Cell wall/membrane/envelope biogenesis [M] | 0.27 |
COG3764 | Sortase (surface protein transpeptidase) | Cell wall/membrane/envelope biogenesis [M] | 0.27 |
COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 0.27 |
COG3247 | Acid resistance membrane protein HdeD, DUF308 family | General function prediction only [R] | 0.27 |
COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.27 |
COG3300 | MHYT domain, NO-binding membrane sensor | Signal transduction mechanisms [T] | 0.27 |
COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.27 |
COG3682 | Transcriptional regulator, CopY/TcrY family | Transcription [K] | 0.27 |
COG3402 | Uncharacterized membrane protein YdbS, contains bPH2 (bacterial pleckstrin homology) domain | Function unknown [S] | 0.27 |
COG3570 | Streptomycin 6-kinase | Defense mechanisms [V] | 0.27 |
COG3428 | Uncharacterized membrane protein YdbT, contains bPH2 (bacterial pleckstrin homology) domain | Function unknown [S] | 0.27 |
COG0682 | Prolipoprotein diacylglyceryltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.27 |
COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.27 |
COG0225 | Peptide methionine sulfoxide reductase MsrA | Posttranslational modification, protein turnover, chaperones [O] | 0.27 |
COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.27 |
COG0288 | Carbonic anhydrase | Inorganic ion transport and metabolism [P] | 0.27 |
COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.27 |
COG0508 | Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component | Energy production and conversion [C] | 0.27 |
COG0531 | Serine transporter YbeC, amino acid:H+ symporter family | Amino acid transport and metabolism [E] | 0.27 |
COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.27 |
COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 0.27 |
COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.27 |
COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.27 |
COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 0.27 |
COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.27 |
COG0789 | DNA-binding transcriptional regulator, MerR family | Transcription [K] | 0.27 |
COG0829 | Urease accessory protein UreH | Posttranslational modification, protein turnover, chaperones [O] | 0.27 |
COG0833 | Amino acid permease | Amino acid transport and metabolism [E] | 0.27 |
COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 0.27 |
COG1113 | L-asparagine transporter or related permease | Amino acid transport and metabolism [E] | 0.27 |
COG1115 | Na+/alanine symporter | Amino acid transport and metabolism [E] | 0.27 |
COG1309 | DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA | Transcription [K] | 0.27 |
COG1850 | Ribulose 1,5-bisphosphate carboxylase, large subunit, or a RuBisCO-like protein | Carbohydrate transport and metabolism [G] | 0.27 |
COG1914 | Mn2+ or Fe2+ transporter, NRAMP family | Inorganic ion transport and metabolism [P] | 0.27 |
COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.27 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 78.59 % |
Unclassified | root | N/A | 21.41 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001593|JGI12635J15846_10750138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 561 | Open in IMG/M |
3300005434|Ga0070709_10836177 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
3300005435|Ga0070714_100595556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1061 | Open in IMG/M |
3300005435|Ga0070714_102107632 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300005435|Ga0070714_102258654 | Not Available | 529 | Open in IMG/M |
3300005435|Ga0070714_102470013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 504 | Open in IMG/M |
3300005437|Ga0070710_10577380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 780 | Open in IMG/M |
3300005437|Ga0070710_10998624 | Not Available | 609 | Open in IMG/M |
3300005471|Ga0070698_100294663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1553 | Open in IMG/M |
3300005537|Ga0070730_10102908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1975 | Open in IMG/M |
3300005548|Ga0070665_100508996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1215 | Open in IMG/M |
3300005548|Ga0070665_101534172 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
3300005548|Ga0070665_102140344 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300005555|Ga0066692_10937202 | Not Available | 530 | Open in IMG/M |
3300005564|Ga0070664_100506121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1113 | Open in IMG/M |
3300005578|Ga0068854_100222873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1493 | Open in IMG/M |
3300005598|Ga0066706_10779587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 756 | Open in IMG/M |
3300005602|Ga0070762_10126313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1508 | Open in IMG/M |
3300005602|Ga0070762_10756289 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
3300005602|Ga0070762_11062838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 557 | Open in IMG/M |
3300005602|Ga0070762_11103658 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300005610|Ga0070763_10774386 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 566 | Open in IMG/M |
3300005614|Ga0068856_100285739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1666 | Open in IMG/M |
3300005614|Ga0068856_100957520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Chondromyces → Chondromyces apiculatus → Chondromyces apiculatus DSM 436 | 874 | Open in IMG/M |
3300005614|Ga0068856_101704825 | Not Available | 642 | Open in IMG/M |
3300005614|Ga0068856_102100984 | Not Available | 574 | Open in IMG/M |
3300005614|Ga0068856_102328272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 543 | Open in IMG/M |
3300005617|Ga0068859_100077976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3354 | Open in IMG/M |
3300005712|Ga0070764_10039534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 2400 | Open in IMG/M |
3300005952|Ga0080026_10064726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 978 | Open in IMG/M |
3300005952|Ga0080026_10165474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 645 | Open in IMG/M |
3300005995|Ga0066790_10011384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3928 | Open in IMG/M |
3300005995|Ga0066790_10050278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1803 | Open in IMG/M |
3300006028|Ga0070717_11062039 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
3300006102|Ga0075015_100258544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 946 | Open in IMG/M |
3300006163|Ga0070715_10354165 | Not Available | 803 | Open in IMG/M |
3300006163|Ga0070715_10635648 | Not Available | 630 | Open in IMG/M |
3300006173|Ga0070716_101037082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 650 | Open in IMG/M |
3300006174|Ga0075014_100872822 | Not Available | 537 | Open in IMG/M |
3300006175|Ga0070712_100572482 | Not Available | 954 | Open in IMG/M |
3300006175|Ga0070712_100659524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 889 | Open in IMG/M |
3300006175|Ga0070712_101043109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 708 | Open in IMG/M |
3300006176|Ga0070765_100090186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae | 2625 | Open in IMG/M |
3300006176|Ga0070765_100349066 | All Organisms → cellular organisms → Bacteria | 1375 | Open in IMG/M |
3300006580|Ga0074049_13176090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 603 | Open in IMG/M |
3300006581|Ga0074048_12150887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. DvalAA-43 | 678 | Open in IMG/M |
3300006755|Ga0079222_12586627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 510 | Open in IMG/M |
3300006804|Ga0079221_10347833 | Not Available | 893 | Open in IMG/M |
3300006804|Ga0079221_10753275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 689 | Open in IMG/M |
3300006804|Ga0079221_10983663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 631 | Open in IMG/M |
3300006804|Ga0079221_11578140 | Not Available | 530 | Open in IMG/M |
3300006854|Ga0075425_102243951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 607 | Open in IMG/M |
3300006893|Ga0073928_10315594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1169 | Open in IMG/M |
3300006903|Ga0075426_10858377 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
3300006914|Ga0075436_100366037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1041 | Open in IMG/M |
3300006914|Ga0075436_101019379 | Not Available | 622 | Open in IMG/M |
3300006954|Ga0079219_11404739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae → Actinospica → Actinospica robiniae | 624 | Open in IMG/M |
3300006954|Ga0079219_11983078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 553 | Open in IMG/M |
3300009088|Ga0099830_10094191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2224 | Open in IMG/M |
3300009090|Ga0099827_10566564 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
3300009101|Ga0105247_11513710 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300009143|Ga0099792_10095167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1553 | Open in IMG/M |
3300009177|Ga0105248_13193283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 521 | Open in IMG/M |
3300009520|Ga0116214_1273097 | Not Available | 645 | Open in IMG/M |
3300009522|Ga0116218_1285170 | Not Available | 740 | Open in IMG/M |
3300009545|Ga0105237_10296859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1619 | Open in IMG/M |
3300009545|Ga0105237_12357157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 542 | Open in IMG/M |
3300009628|Ga0116125_1117938 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
3300009672|Ga0116215_1199944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 881 | Open in IMG/M |
3300009698|Ga0116216_10008092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6671 | Open in IMG/M |
3300009698|Ga0116216_10597582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 665 | Open in IMG/M |
3300009824|Ga0116219_10486576 | Not Available | 683 | Open in IMG/M |
3300010048|Ga0126373_11449146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 752 | Open in IMG/M |
3300010339|Ga0074046_10002247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 16802 | Open in IMG/M |
3300010343|Ga0074044_10139580 | Not Available | 1623 | Open in IMG/M |
3300010343|Ga0074044_10390002 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
3300010359|Ga0126376_11780846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 653 | Open in IMG/M |
3300010359|Ga0126376_12850260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 533 | Open in IMG/M |
3300010360|Ga0126372_10010522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4911 | Open in IMG/M |
3300010366|Ga0126379_13487235 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300010371|Ga0134125_10070574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae | 3885 | Open in IMG/M |
3300010371|Ga0134125_10137054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2725 | Open in IMG/M |
3300010375|Ga0105239_10436681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1484 | Open in IMG/M |
3300010375|Ga0105239_13406200 | Not Available | 517 | Open in IMG/M |
3300010376|Ga0126381_100871604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1295 | Open in IMG/M |
3300010376|Ga0126381_102567224 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
3300010379|Ga0136449_100459453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2230 | Open in IMG/M |
3300010379|Ga0136449_101111450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 1256 | Open in IMG/M |
3300010379|Ga0136449_101667171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 963 | Open in IMG/M |
3300010396|Ga0134126_10450913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1488 | Open in IMG/M |
3300010396|Ga0134126_11323677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 797 | Open in IMG/M |
3300010398|Ga0126383_10911337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 965 | Open in IMG/M |
3300010867|Ga0126347_1124416 | Not Available | 579 | Open in IMG/M |
3300010876|Ga0126361_10540629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1188 | Open in IMG/M |
3300010876|Ga0126361_10763786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 683 | Open in IMG/M |
3300010876|Ga0126361_10831230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 566 | Open in IMG/M |
3300010876|Ga0126361_10883754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 631 | Open in IMG/M |
3300010880|Ga0126350_11794098 | All Organisms → cellular organisms → Bacteria | 1668 | Open in IMG/M |
3300012200|Ga0137382_11280591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis thailandensis | 518 | Open in IMG/M |
3300012204|Ga0137374_11297658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 502 | Open in IMG/M |
3300012206|Ga0137380_10198855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1818 | Open in IMG/M |
3300012206|Ga0137380_11673796 | Not Available | 520 | Open in IMG/M |
3300012208|Ga0137376_10624069 | Not Available | 932 | Open in IMG/M |
3300012209|Ga0137379_10081094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes deccanensis | 3120 | Open in IMG/M |
3300012210|Ga0137378_10408979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1258 | Open in IMG/M |
3300012211|Ga0137377_10082697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3023 | Open in IMG/M |
3300012211|Ga0137377_11822960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 527 | Open in IMG/M |
3300012351|Ga0137386_11280175 | Not Available | 509 | Open in IMG/M |
3300012353|Ga0137367_10580135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 786 | Open in IMG/M |
3300012354|Ga0137366_10030880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4155 | Open in IMG/M |
3300012356|Ga0137371_10428873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1024 | Open in IMG/M |
3300012356|Ga0137371_10452733 | Not Available | 993 | Open in IMG/M |
3300012357|Ga0137384_10931598 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
3300012357|Ga0137384_10974404 | Not Available | 682 | Open in IMG/M |
3300012359|Ga0137385_11667937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 501 | Open in IMG/M |
3300012469|Ga0150984_115532087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 561 | Open in IMG/M |
3300012492|Ga0157335_1013359 | Not Available | 699 | Open in IMG/M |
3300012492|Ga0157335_1039989 | Not Available | 526 | Open in IMG/M |
3300012500|Ga0157314_1019410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 679 | Open in IMG/M |
3300012502|Ga0157347_1014938 | Not Available | 861 | Open in IMG/M |
3300012505|Ga0157339_1038705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 590 | Open in IMG/M |
3300012507|Ga0157342_1065685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 542 | Open in IMG/M |
3300012917|Ga0137395_11206641 | Not Available | 529 | Open in IMG/M |
3300012955|Ga0164298_10122453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1415 | Open in IMG/M |
3300012955|Ga0164298_10919539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 638 | Open in IMG/M |
3300012971|Ga0126369_11564097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 749 | Open in IMG/M |
3300012984|Ga0164309_10382421 | Not Available | 1044 | Open in IMG/M |
3300012985|Ga0164308_10425085 | Not Available | 1093 | Open in IMG/M |
3300012986|Ga0164304_10057403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2150 | Open in IMG/M |
3300012989|Ga0164305_11121913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 677 | Open in IMG/M |
3300013105|Ga0157369_12407294 | Not Available | 533 | Open in IMG/M |
3300013297|Ga0157378_11061409 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 846 | Open in IMG/M |
3300013297|Ga0157378_11591413 | Not Available | 699 | Open in IMG/M |
3300013297|Ga0157378_12066117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 620 | Open in IMG/M |
3300013307|Ga0157372_12722542 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300014157|Ga0134078_10271656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 719 | Open in IMG/M |
3300014166|Ga0134079_10643517 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300014201|Ga0181537_10254247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1207 | Open in IMG/M |
3300014201|Ga0181537_10515509 | Not Available | 818 | Open in IMG/M |
3300014969|Ga0157376_10837765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → unclassified Kribbella → Kribbella sp. VKM Ac-2568 | 934 | Open in IMG/M |
3300015242|Ga0137412_10506790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 923 | Open in IMG/M |
3300015372|Ga0132256_103137392 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300015372|Ga0132256_103202389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 550 | Open in IMG/M |
3300015374|Ga0132255_102105905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 860 | Open in IMG/M |
3300015374|Ga0132255_105290924 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300016422|Ga0182039_10257670 | All Organisms → cellular organisms → Bacteria | 1425 | Open in IMG/M |
3300016422|Ga0182039_12218738 | Not Available | 507 | Open in IMG/M |
3300016445|Ga0182038_11400553 | Not Available | 626 | Open in IMG/M |
3300016445|Ga0182038_11569274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus nigrescens | 592 | Open in IMG/M |
3300017924|Ga0187820_1251714 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
3300017946|Ga0187879_10155410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1293 | Open in IMG/M |
3300017947|Ga0187785_10539979 | Not Available | 588 | Open in IMG/M |
3300017970|Ga0187783_10675680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 746 | Open in IMG/M |
3300017972|Ga0187781_10192912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1436 | Open in IMG/M |
3300017972|Ga0187781_11408840 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300017995|Ga0187816_10007134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 3989 | Open in IMG/M |
3300018037|Ga0187883_10109943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → unclassified Rhodococcus → Rhodococcus sp. WB9 | 1428 | Open in IMG/M |
3300018037|Ga0187883_10225708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 959 | Open in IMG/M |
3300018042|Ga0187871_10083683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1857 | Open in IMG/M |
3300018042|Ga0187871_10101712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1656 | Open in IMG/M |
3300018046|Ga0187851_10136700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1494 | Open in IMG/M |
3300018046|Ga0187851_10282535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 966 | Open in IMG/M |
3300018086|Ga0187769_10384238 | Not Available | 1055 | Open in IMG/M |
3300018468|Ga0066662_10408458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1197 | Open in IMG/M |
3300018468|Ga0066662_12194552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 579 | Open in IMG/M |
3300021171|Ga0210405_10341750 | Not Available | 1181 | Open in IMG/M |
3300021180|Ga0210396_11476707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 560 | Open in IMG/M |
3300021181|Ga0210388_10410822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1190 | Open in IMG/M |
3300021344|Ga0193719_10293494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 683 | Open in IMG/M |
3300021374|Ga0213881_10274236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 751 | Open in IMG/M |
3300021377|Ga0213874_10056006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1223 | Open in IMG/M |
3300021384|Ga0213876_10105960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1492 | Open in IMG/M |
3300021388|Ga0213875_10037232 | All Organisms → cellular organisms → Bacteria | 2293 | Open in IMG/M |
3300021388|Ga0213875_10105693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1314 | Open in IMG/M |
3300021388|Ga0213875_10181989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 987 | Open in IMG/M |
3300021401|Ga0210393_10374432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1160 | Open in IMG/M |
3300021401|Ga0210393_10402370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1116 | Open in IMG/M |
3300021401|Ga0210393_11428624 | Not Available | 552 | Open in IMG/M |
3300021401|Ga0210393_11583724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 520 | Open in IMG/M |
3300021403|Ga0210397_10075862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2216 | Open in IMG/M |
3300021405|Ga0210387_11658234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 543 | Open in IMG/M |
3300021406|Ga0210386_11124478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 666 | Open in IMG/M |
3300021432|Ga0210384_11895908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis thailandensis | 502 | Open in IMG/M |
3300021474|Ga0210390_10113377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2268 | Open in IMG/M |
3300021474|Ga0210390_11124514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 637 | Open in IMG/M |
3300021477|Ga0210398_10014810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6779 | Open in IMG/M |
3300021477|Ga0210398_11171956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 608 | Open in IMG/M |
3300021478|Ga0210402_11016513 | Not Available | 756 | Open in IMG/M |
3300021479|Ga0210410_10382150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1262 | Open in IMG/M |
3300021560|Ga0126371_11926840 | Not Available | 710 | Open in IMG/M |
3300022533|Ga0242662_10298987 | Not Available | 536 | Open in IMG/M |
3300024249|Ga0247676_1057118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 639 | Open in IMG/M |
3300025898|Ga0207692_10318078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 952 | Open in IMG/M |
3300025898|Ga0207692_10707342 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
3300025898|Ga0207692_10985787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 556 | Open in IMG/M |
3300025899|Ga0207642_10586748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 692 | Open in IMG/M |
3300025905|Ga0207685_10083405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Mizugakiibacter → Mizugakiibacter sediminis | 1328 | Open in IMG/M |
3300025906|Ga0207699_10033131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2918 | Open in IMG/M |
3300025906|Ga0207699_10063924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella lactea | 2225 | Open in IMG/M |
3300025910|Ga0207684_10637937 | Not Available | 908 | Open in IMG/M |
3300025914|Ga0207671_11402268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 542 | Open in IMG/M |
3300025915|Ga0207693_11471376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 503 | Open in IMG/M |
3300025916|Ga0207663_10267287 | Not Available | 1265 | Open in IMG/M |
3300025916|Ga0207663_10495679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 948 | Open in IMG/M |
3300025916|Ga0207663_10607042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 860 | Open in IMG/M |
3300025916|Ga0207663_11211481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 608 | Open in IMG/M |
3300025916|Ga0207663_11261844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 595 | Open in IMG/M |
3300025916|Ga0207663_11545757 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300025921|Ga0207652_11181128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 667 | Open in IMG/M |
3300025924|Ga0207694_10216378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1562 | Open in IMG/M |
3300025928|Ga0207700_10035913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3575 | Open in IMG/M |
3300025928|Ga0207700_11627678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 571 | Open in IMG/M |
3300025928|Ga0207700_12022365 | Not Available | 503 | Open in IMG/M |
3300025981|Ga0207640_10169366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1626 | Open in IMG/M |
3300026023|Ga0207677_12101168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 525 | Open in IMG/M |
3300026078|Ga0207702_10728414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 978 | Open in IMG/M |
3300026078|Ga0207702_11752049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 614 | Open in IMG/M |
3300026078|Ga0207702_11811920 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
3300026095|Ga0207676_11305937 | Not Available | 720 | Open in IMG/M |
3300026118|Ga0207675_100108228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2621 | Open in IMG/M |
3300027497|Ga0208199_1000078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 38917 | Open in IMG/M |
3300027641|Ga0208827_1174035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 585 | Open in IMG/M |
3300027765|Ga0209073_10090072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1069 | Open in IMG/M |
3300027775|Ga0209177_10350582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 578 | Open in IMG/M |
3300027787|Ga0209074_10218696 | Not Available | 725 | Open in IMG/M |
3300027846|Ga0209180_10670998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 566 | Open in IMG/M |
3300027869|Ga0209579_10035595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2699 | Open in IMG/M |
3300027869|Ga0209579_10657643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 568 | Open in IMG/M |
3300027884|Ga0209275_10075583 | All Organisms → cellular organisms → Bacteria | 1677 | Open in IMG/M |
3300027905|Ga0209415_10715108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 715 | Open in IMG/M |
3300027908|Ga0209006_10024057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5516 | Open in IMG/M |
3300028380|Ga0268265_11418260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 697 | Open in IMG/M |
3300028381|Ga0268264_11273631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 745 | Open in IMG/M |
3300028718|Ga0307307_10004132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 3691 | Open in IMG/M |
3300028718|Ga0307307_10290527 | Not Available | 526 | Open in IMG/M |
3300028742|Ga0302220_10033789 | All Organisms → cellular organisms → Bacteria | 2271 | Open in IMG/M |
3300028742|Ga0302220_10127945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 980 | Open in IMG/M |
3300028755|Ga0307316_10316436 | Not Available | 572 | Open in IMG/M |
3300028759|Ga0302224_10262107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 691 | Open in IMG/M |
3300028775|Ga0302231_10395066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 582 | Open in IMG/M |
3300028781|Ga0302223_10158627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 747 | Open in IMG/M |
3300028781|Ga0302223_10216940 | Not Available | 631 | Open in IMG/M |
3300028784|Ga0307282_10002533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 6707 | Open in IMG/M |
3300028789|Ga0302232_10012871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4954 | Open in IMG/M |
3300028789|Ga0302232_10103696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1455 | Open in IMG/M |
3300028789|Ga0302232_10380517 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
3300028789|Ga0302232_10592214 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300028795|Ga0302227_10366608 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300028801|Ga0302226_10109501 | All Organisms → cellular organisms → Bacteria | 1225 | Open in IMG/M |
3300028828|Ga0307312_10427262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 871 | Open in IMG/M |
3300028875|Ga0307289_10281495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 684 | Open in IMG/M |
3300028877|Ga0302235_10167651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 976 | Open in IMG/M |
3300028877|Ga0302235_10445494 | Not Available | 552 | Open in IMG/M |
3300028877|Ga0302235_10492448 | Not Available | 521 | Open in IMG/M |
3300028879|Ga0302229_10036213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2551 | Open in IMG/M |
3300028884|Ga0307308_10020802 | All Organisms → cellular organisms → Bacteria | 3014 | Open in IMG/M |
3300029882|Ga0311368_10401090 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
3300029882|Ga0311368_10604909 | Not Available | 772 | Open in IMG/M |
3300029951|Ga0311371_10383836 | All Organisms → cellular organisms → Bacteria | 1921 | Open in IMG/M |
3300029951|Ga0311371_10881752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1086 | Open in IMG/M |
3300029999|Ga0311339_10026342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8411 | Open in IMG/M |
3300029999|Ga0311339_10301887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 1722 | Open in IMG/M |
3300029999|Ga0311339_10440324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1345 | Open in IMG/M |
3300029999|Ga0311339_10758104 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
3300030007|Ga0311338_10030561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 7554 | Open in IMG/M |
3300030007|Ga0311338_10082023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4096 | Open in IMG/M |
3300030007|Ga0311338_10271474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1892 | Open in IMG/M |
3300030007|Ga0311338_10340219 | All Organisms → cellular organisms → Bacteria | 1637 | Open in IMG/M |
3300030007|Ga0311338_10747110 | Not Available | 982 | Open in IMG/M |
3300030007|Ga0311338_10915244 | Not Available | 860 | Open in IMG/M |
3300030013|Ga0302178_10126283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1290 | Open in IMG/M |
3300030013|Ga0302178_10312848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 719 | Open in IMG/M |
3300030053|Ga0302177_10025533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3740 | Open in IMG/M |
3300030053|Ga0302177_10131421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1424 | Open in IMG/M |
3300030053|Ga0302177_10176229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1191 | Open in IMG/M |
3300030053|Ga0302177_10244048 | Not Available | 973 | Open in IMG/M |
3300030053|Ga0302177_10299977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 857 | Open in IMG/M |
3300030056|Ga0302181_10008532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6454 | Open in IMG/M |
3300030056|Ga0302181_10285297 | Not Available | 737 | Open in IMG/M |
3300030058|Ga0302179_10030088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 2538 | Open in IMG/M |
3300030058|Ga0302179_10182488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 927 | Open in IMG/M |
3300030399|Ga0311353_11047750 | Not Available | 680 | Open in IMG/M |
3300030490|Ga0302184_10119108 | Not Available | 1174 | Open in IMG/M |
3300030490|Ga0302184_10429719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 509 | Open in IMG/M |
3300030503|Ga0311370_10411266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1695 | Open in IMG/M |
3300030503|Ga0311370_10586438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1340 | Open in IMG/M |
3300030503|Ga0311370_10815254 | Not Available | 1072 | Open in IMG/M |
3300030503|Ga0311370_10950411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 966 | Open in IMG/M |
3300030520|Ga0311372_10587880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1596 | Open in IMG/M |
3300030524|Ga0311357_10397919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1300 | Open in IMG/M |
3300030524|Ga0311357_10935504 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
3300030617|Ga0311356_11848179 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300030618|Ga0311354_10039143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5623 | Open in IMG/M |
3300030618|Ga0311354_10530575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1157 | Open in IMG/M |
3300030739|Ga0302311_11048844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 512 | Open in IMG/M |
3300030740|Ga0265460_12941218 | Not Available | 512 | Open in IMG/M |
3300031027|Ga0302308_10103075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1945 | Open in IMG/M |
3300031233|Ga0302307_10207868 | Not Available | 1009 | Open in IMG/M |
3300031234|Ga0302325_10224054 | Not Available | 3186 | Open in IMG/M |
3300031234|Ga0302325_10438969 | All Organisms → cellular organisms → Bacteria | 2009 | Open in IMG/M |
3300031236|Ga0302324_100371044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 2150 | Open in IMG/M |
3300031236|Ga0302324_100520685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1730 | Open in IMG/M |
3300031236|Ga0302324_102111129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 702 | Open in IMG/M |
3300031236|Ga0302324_103229291 | Not Available | 536 | Open in IMG/M |
3300031525|Ga0302326_10174387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3648 | Open in IMG/M |
3300031525|Ga0302326_11303970 | Not Available | 989 | Open in IMG/M |
3300031525|Ga0302326_11745126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Pseudarthrobacter → Pseudarthrobacter albicanus | 818 | Open in IMG/M |
3300031572|Ga0318515_10089940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1601 | Open in IMG/M |
3300031573|Ga0310915_11059421 | Not Available | 564 | Open in IMG/M |
3300031640|Ga0318555_10378960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_2_20CM_2_71_6 | 767 | Open in IMG/M |
3300031668|Ga0318542_10211178 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
3300031668|Ga0318542_10768056 | Not Available | 505 | Open in IMG/M |
3300031681|Ga0318572_10330238 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
3300031708|Ga0310686_100368381 | Not Available | 2284 | Open in IMG/M |
3300031708|Ga0310686_106053105 | Not Available | 1009 | Open in IMG/M |
3300031713|Ga0318496_10391458 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
3300031713|Ga0318496_10618561 | Not Available | 598 | Open in IMG/M |
3300031719|Ga0306917_10425408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1039 | Open in IMG/M |
3300031744|Ga0306918_10725436 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 777 | Open in IMG/M |
3300031751|Ga0318494_10059082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2044 | Open in IMG/M |
3300031765|Ga0318554_10484064 | Not Available | 701 | Open in IMG/M |
3300031770|Ga0318521_10657932 | Not Available | 635 | Open in IMG/M |
3300031778|Ga0318498_10254661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 791 | Open in IMG/M |
3300031796|Ga0318576_10083555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1438 | Open in IMG/M |
3300031797|Ga0318550_10245188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 869 | Open in IMG/M |
3300031805|Ga0318497_10453245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 718 | Open in IMG/M |
3300031819|Ga0318568_10375600 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
3300031831|Ga0318564_10161645 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
3300031859|Ga0318527_10423736 | Not Available | 567 | Open in IMG/M |
3300031894|Ga0318522_10072432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1249 | Open in IMG/M |
3300031896|Ga0318551_10875673 | Not Available | 524 | Open in IMG/M |
3300031912|Ga0306921_10537769 | Not Available | 1356 | Open in IMG/M |
3300031945|Ga0310913_10436952 | Not Available | 929 | Open in IMG/M |
3300031945|Ga0310913_10683885 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
3300031947|Ga0310909_10052853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3128 | Open in IMG/M |
3300031954|Ga0306926_11341088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 833 | Open in IMG/M |
3300031996|Ga0308176_10034427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3992 | Open in IMG/M |
3300032044|Ga0318558_10208026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 956 | Open in IMG/M |
3300032044|Ga0318558_10627460 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300032063|Ga0318504_10474634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter pauli | 598 | Open in IMG/M |
3300032065|Ga0318513_10028083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 2413 | Open in IMG/M |
3300032160|Ga0311301_10224904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3154 | Open in IMG/M |
3300032160|Ga0311301_10297111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2592 | Open in IMG/M |
3300032160|Ga0311301_12425497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 590 | Open in IMG/M |
3300032174|Ga0307470_10903547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 694 | Open in IMG/M |
3300032205|Ga0307472_101399106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 678 | Open in IMG/M |
3300032261|Ga0306920_100227170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2785 | Open in IMG/M |
3300032261|Ga0306920_100798188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1386 | Open in IMG/M |
3300032261|Ga0306920_101683314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 899 | Open in IMG/M |
3300032770|Ga0335085_10338158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1769 | Open in IMG/M |
3300032770|Ga0335085_11583380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 679 | Open in IMG/M |
3300032782|Ga0335082_10979835 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
3300032783|Ga0335079_10482111 | All Organisms → cellular organisms → Bacteria | 1325 | Open in IMG/M |
3300032805|Ga0335078_10352172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1955 | Open in IMG/M |
3300032805|Ga0335078_12729068 | Not Available | 502 | Open in IMG/M |
3300032828|Ga0335080_11833184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 591 | Open in IMG/M |
3300032892|Ga0335081_10285223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2199 | Open in IMG/M |
3300032892|Ga0335081_10382525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1818 | Open in IMG/M |
3300032892|Ga0335081_10844195 | Not Available | 1088 | Open in IMG/M |
3300032893|Ga0335069_12106388 | Not Available | 592 | Open in IMG/M |
3300032954|Ga0335083_10384898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1203 | Open in IMG/M |
3300033158|Ga0335077_10661334 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
3300033158|Ga0335077_11010555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 829 | Open in IMG/M |
3300033289|Ga0310914_10721900 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
3300033289|Ga0310914_11401615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 602 | Open in IMG/M |
3300033290|Ga0318519_10402114 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
3300033818|Ga0334804_034586 | Not Available | 1586 | Open in IMG/M |
3300034124|Ga0370483_0140513 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
3300034199|Ga0370514_155265 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 17.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.55% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.59% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.23% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.34% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.06% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.79% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.98% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.44% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.71% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.71% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.71% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.90% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.63% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.63% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.35% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.35% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.35% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 1.35% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.08% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.08% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.08% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.08% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.81% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.81% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.81% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.54% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.54% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.54% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.54% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.54% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.54% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.54% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.54% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.54% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.54% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.54% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.54% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.54% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.54% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.54% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.54% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.54% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.27% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.27% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.27% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.27% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.27% |
Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.27% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Arabidopsis Rhizosphere | 0.27% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.27% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.27% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010867 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Host-Associated | Open in IMG/M |
3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Host-Associated | Open in IMG/M |
3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Host-Associated | Open in IMG/M |
3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Host-Associated | Open in IMG/M |
3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Host-Associated | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024249 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK17 | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
3300028742 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3 | Environmental | Open in IMG/M |
3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
3300028781 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_3 | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
3300028795 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1 | Environmental | Open in IMG/M |
3300028801 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
3300030740 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly | Environmental | Open in IMG/M |
3300031027 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3 | Environmental | Open in IMG/M |
3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
3300033818 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 S-3-M | Environmental | Open in IMG/M |
3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
3300034199 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12635J15846_107501381 | 3300001593 | Forest Soil | VVIHRLGWTLVLNPDGTTTAWNPDRTKVIRSHSPPARAG* |
Ga0070709_108361772 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | EIHRNGWTVVLNPDGTTTAWNKDRTKVLHSHSHSPPPRPG* |
Ga0070714_1005955561 | 3300005435 | Agricultural Soil | EIHRNGWTVVLNPDGTTTAWNKDRTKVLHSHSRNHSPPARPL* |
Ga0070714_1021076321 | 3300005435 | Agricultural Soil | IHRRGWTLIVNPDGTTTAWNKDRTKVLHSHGPPGRAGPSGTG* |
Ga0070714_1022586541 | 3300005435 | Agricultural Soil | QVMIHQRGWTLVVNPDGTTTAWNKDKTKVLHSHGPPARAG* |
Ga0070714_1024700132 | 3300005435 | Agricultural Soil | IVIHRWGWTLAVNPDGTTTTWNKNKTKVLHSHGRPARAG* |
Ga0070710_105773801 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | IHRNGWTVVLNPDGTTTAWNKDRTKVLHSHSRNHSPPARPL* |
Ga0070710_109986241 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | VEIHRNGWTVILNPDGTTTAWNKDKTKTLHSHSRNRNHSPPPRPG* |
Ga0070698_1002946632 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MAPHLTPQASQGWTLVLNPDGTTTARNKDNTKVVHSHGPPARPG* |
Ga0070730_101029081 | 3300005537 | Surface Soil | GWTVTLNPDGIATAWNKDRTKILHSHSHSHSPPPRPG* |
Ga0070665_1005089961 | 3300005548 | Switchgrass Rhizosphere | WGWTLVVNPDGTTTAWNKNKTKVLHSHGPPARAG* |
Ga0070665_1015341721 | 3300005548 | Switchgrass Rhizosphere | WGWTLVLNPDGTTTAWNKDKTKVLHSHGPPVRPG* |
Ga0070665_1021403442 | 3300005548 | Switchgrass Rhizosphere | RWGWTLVVNPDGTTTAWNKDKTKVLHSHGPPARAG* |
Ga0066692_109372021 | 3300005555 | Soil | WAWTLVLNPDGTTSAWNKDRTKVLHSHGPPARAG* |
Ga0070664_1005061213 | 3300005564 | Corn Rhizosphere | WGWTLIVNPDGTTTAWNKDKTKVLHSHGPPVRPG* |
Ga0068854_1002228731 | 3300005578 | Corn Rhizosphere | RWGWTLIVNPDGTTTAWNKDKTKVLHSHGPPVRPG* |
Ga0066706_107795871 | 3300005598 | Soil | WGWTLVLNPDGTTTAWNKNRTKILHSHGPPARAG* |
Ga0070762_101263131 | 3300005602 | Soil | WGWTLVLNPDGTTTAWNPDRTKVLHSHSPPARAG* |
Ga0070762_107562891 | 3300005602 | Soil | WGWTLVLNPDGTTTAWNKDKTKVLHSHGSPARAG* |
Ga0070762_110628382 | 3300005602 | Soil | QVVIHRQGWTLVLNPDGTTSAWNRDKTKELHSHSPPARAG* |
Ga0070762_111036583 | 3300005602 | Soil | WGWTLVVNPDGTTSAWNKNKTKTLHSHGPPARAG* |
Ga0070763_107743862 | 3300005610 | Soil | RWGWTLVLNPDGTTTAWNPDKTKVLHSHSPPVRPG* |
Ga0068856_1002857393 | 3300005614 | Corn Rhizosphere | LGWTLVVNPDGTTTAWNKDKTKVLHSHGPPARAG* |
Ga0068856_1009575201 | 3300005614 | Corn Rhizosphere | EIHRNGWTVVLNPDGTTTAWNKDKTKVLHSHSRNHSPPPRSG* |
Ga0068856_1017048252 | 3300005614 | Corn Rhizosphere | VVIHQWGWTVVLNPDGTTTAWNKDKTKIIHSHSPPVRPG* |
Ga0068856_1021009841 | 3300005614 | Corn Rhizosphere | EIHRNGWTVVLNPDGTTTAWNKDRTKVLHSHSRNHSPPPRPG* |
Ga0068856_1023282722 | 3300005614 | Corn Rhizosphere | WGWTLVLNPDGTTTAWNKDKTKMLHSHGPPVRPG* |
Ga0068859_1000779761 | 3300005617 | Switchgrass Rhizosphere | MIMINFRWGWTLVVNPDGTTSAWNKNKTKVLHSHG |
Ga0070764_100395344 | 3300005712 | Soil | VMIHRMGWTLVRNPDGTTTAWNRNRTKVLRSHSPPARAG* |
Ga0080026_100647262 | 3300005952 | Permafrost Soil | HHHVVIHRMGWTLVRHPDGTTMAWNRDKSKVLRSHSPPARAG* |
Ga0080026_101654741 | 3300005952 | Permafrost Soil | MIHRRGWTLVRNPDGTTTAWNRDRGKVLRSHSPPARAV* |
Ga0066790_100113845 | 3300005995 | Soil | MGWTLVRHPDGTTTAWNRDKTKVLRSHSPPARAG* |
Ga0066790_100502783 | 3300005995 | Soil | MGWTLVRHPDGTTIAWNRDKSKVFRSHSPPARAG* |
Ga0070717_110620392 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | IHRWGWTLVVNPDGTTSAWNKNKTKVLHSHGPPARAG* |
Ga0075015_1002585441 | 3300006102 | Watersheds | HVVIHQMGWTVELNPDGTTTAWNPDKTKVLHSHSPPANTG* |
Ga0070715_103541652 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | HRWGWTLVVNPDGTTSAWNKNKTKVLHSHGPPARAG* |
Ga0070715_106356482 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | QGWTLVLNPDGTTTAWNKDKTKVLRSHGPPARPG* |
Ga0070716_1010370821 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | IHRQGWTLVLNPDGTTTAWNKDKTKILHSHGPPARPG* |
Ga0075014_1008728222 | 3300006174 | Watersheds | WGWTLVLNPDGTTTAWNPDKTKVLRSHSPPTHPG* |
Ga0070712_1005724822 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | ILNPDGTTTAWNKDKTKTLHSHSRNRNHSPPPRPG* |
Ga0070712_1006595241 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | HRWGWTLVVNPDGTTSAWNKTKTKVLHSHGPPVRPG* |
Ga0070712_1010431092 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | HRNGWTVVLNPDGTTTAWNKDRTKVLHSHSRNHSPPARPG* |
Ga0070765_1000901861 | 3300006176 | Soil | QVVIHRWGWTLVLNPDGTTTAWNPDRTKVLHSHGTRPGPDKQSR* |
Ga0070765_1003490661 | 3300006176 | Soil | WGWTLVLNPDGTTTAWNPDKTKILHSHSPPANTG* |
Ga0074049_131760901 | 3300006580 | Soil | WGWTLVLNPDGTTTAWNKDRTKVLHSHGPPVRPG* |
Ga0074048_121508871 | 3300006581 | Soil | MADRRGWTLVLDPDGTTTAWNKDRTKVLHSHGPPARAG |
Ga0079222_125866272 | 3300006755 | Agricultural Soil | HRWGWTLVVNPDGTTSAWNKNKTKVLHSHGPPVRPG* |
Ga0079221_103478331 | 3300006804 | Agricultural Soil | VVIHRWGWTVVLNPDGTTTAWNKDRTKVLHSHSRNHSPPPRPG* |
Ga0079221_107532752 | 3300006804 | Agricultural Soil | VIHQWGWTVVLNPDGTTTAWNKDKTKIIHSHSPPVRPG* |
Ga0079221_109836631 | 3300006804 | Agricultural Soil | RWGWTLVVNPDGTTTAWNKDKTRVLHSHSPPARAG* |
Ga0079221_115781401 | 3300006804 | Agricultural Soil | RRGWTLVLNPDGTTTAWNKDRTRVLHSHGPPGRAGPSAAG* |
Ga0075425_1022439511 | 3300006854 | Populus Rhizosphere | VIHRWGWTLVVNPDGTTSAWNKNKTKVLHSHGPPARAG* |
Ga0073928_103155942 | 3300006893 | Iron-Sulfur Acid Spring | MIYRLGDLVLNPDGTTTAWNKDQTKVLHSHGPPARAE* |
Ga0075426_108583772 | 3300006903 | Populus Rhizosphere | QVMIHRRGWTLVVNPDGTTTAWNKDKTRVLHSHGPPARAG* |
Ga0075436_1003660372 | 3300006914 | Populus Rhizosphere | HHHQVEIHRNGWTVVLNPDGTTTAWNKDRTKVLHSHSRNHSPPPRPG* |
Ga0075436_1010193793 | 3300006914 | Populus Rhizosphere | IHQQGWTLVLNPDGTTTAWNKDRTKALHSHGPPVRPG* |
Ga0079219_114047392 | 3300006954 | Agricultural Soil | HRNGWTVVLNPDGTTTAWNKDRTKVLHSHSHSRNHSPSARPG* |
Ga0079219_119830782 | 3300006954 | Agricultural Soil | RWGWTLVVNPDGTTTAWNKNKTKVLHSHGPPARAG* |
Ga0099830_100941911 | 3300009088 | Vadose Zone Soil | RWGWTLVLNPDGTTTAWNPAKTKVLHSHSPPTPPP* |
Ga0099827_105665642 | 3300009090 | Vadose Zone Soil | HHQVTIHQQGWTVVLNPDGTTTAWNKDKTKVLRSHSPPARPG* |
Ga0105247_115137101 | 3300009101 | Switchgrass Rhizosphere | QIMIHQRGWTLVVNPDGTTTAWNKDKTKVLHSHGPPARAG* |
Ga0099792_100951673 | 3300009143 | Vadose Zone Soil | RRWTLVVNPDGTTTAWNKNKTRVLHSHGPPARAG* |
Ga0105248_131932831 | 3300009177 | Switchgrass Rhizosphere | IHRQGWTLVLRPDGTTAAWNKDKTKVLRSHGPPARTG* |
Ga0116214_12730972 | 3300009520 | Peatlands Soil | VVIHRMGWTVVLNTDGTTTAWNPGKTKILHSHSPPAQAG* |
Ga0116218_12851701 | 3300009522 | Peatlands Soil | MGWTVVLNPDGTTSAWNKDRTKVLHSHGPPAGTG* |
Ga0105237_102968593 | 3300009545 | Corn Rhizosphere | VIHRWGWTLVVNPDGTTTAWNKNKTKVLRSHGPPARAG* |
Ga0105237_123571571 | 3300009545 | Corn Rhizosphere | WGWTLVVNPDGTTSAWNKNKTKVLHSHGPPARPG* |
Ga0116125_11179381 | 3300009628 | Peatland | HHHVMIHRMGWTLVRNPDGTTTAWNRDRTKVLRSHSPPARTG* |
Ga0116215_11999442 | 3300009672 | Peatlands Soil | MNGWALVLNPDGTTTAWNPDRTKVLYNHGPPAGAG* |
Ga0116216_1000809211 | 3300009698 | Peatlands Soil | CVLLCSYHHQVVIHCWGWTLVLNKDGTTTAWNPDRTKVLHSHSPPARAG* |
Ga0116216_105975821 | 3300009698 | Peatlands Soil | VVIHRRGWTLVLNPDGTTTAWNKDKTKMLHSHGPRARAG* |
Ga0116219_104865761 | 3300009824 | Peatlands Soil | HRWGWALVLNPDGTTTAWNPDRTKVLYNHGPPAGAG* |
Ga0126373_114491461 | 3300010048 | Tropical Forest Soil | WGWTLVLNPDGTTTAWNKDKTKILRSHGPPARPG* |
Ga0074046_1000224718 | 3300010339 | Bog Forest Soil | VVIHQMGWTVVLNPDGTTTAWNKDRTKVLHSHSPPARPG* |
Ga0074044_101395802 | 3300010343 | Bog Forest Soil | VIHQMGWTLVLNPDGTTTAWNKDKTKVLHSHGPPARAE* |
Ga0074044_103900022 | 3300010343 | Bog Forest Soil | HRRGWTLVLNPDGTTTAWNPDRTKVLYSHGPPVRPG* |
Ga0126376_117808461 | 3300010359 | Tropical Forest Soil | PTAPCSASSTLGLIHQWGWTVVLNPDGTTTAWNEDKTKVIHSHSPSARPG* |
Ga0126376_128502601 | 3300010359 | Tropical Forest Soil | HRWGWMLVLIQDGTSTARNKDQTKVLHSHGPPIRPA* |
Ga0126372_100105221 | 3300010360 | Tropical Forest Soil | RWGWTLVLNADGTTTAWNKDKTTVLHSHGPPARAG* |
Ga0126379_134872352 | 3300010366 | Tropical Forest Soil | FHHQVMIHRLGWTLVLNPDGTTMAWNKDKTKVLRSHSPPARAG* |
Ga0134125_100705741 | 3300010371 | Terrestrial Soil | VILNPDGTTTAWNKDRTKTLHSHSRNHSPPARPG* |
Ga0134125_101370541 | 3300010371 | Terrestrial Soil | IHRWGWTLVVNPDGTTSAWNKNKTKVLHSHGPPARPG* |
Ga0105239_104366813 | 3300010375 | Corn Rhizosphere | WGWTLVVNPDGTTSAWNKNKTKILHSHGPPARAG* |
Ga0105239_134062002 | 3300010375 | Corn Rhizosphere | WGWTLVVNPDGTTSAWNKDKTKTLHSHGPPARAG* |
Ga0126381_1008716043 | 3300010376 | Tropical Forest Soil | IHRWGWTLVLNPDGTTTAWNKDRIKVLHSHSLPTRAG* |
Ga0126381_1025672242 | 3300010376 | Tropical Forest Soil | HRWGWTLVLNPDGTTTAWNKNKTKILHSHSPPARAG* |
Ga0136449_1004594533 | 3300010379 | Peatlands Soil | VVIHRWGWTLVLNPDGTTAWNPDKTKILHSHSPPVRPG* |
Ga0136449_1011114502 | 3300010379 | Peatlands Soil | GWTLVLNKDGTTTAWNPDRTKVLHSHGPHSPPARAG* |
Ga0136449_1016671712 | 3300010379 | Peatlands Soil | VIHRWGWTLVLNADRTTTAWNKDKTEVLRSHGPPVRPG* |
Ga0134126_104509132 | 3300010396 | Terrestrial Soil | WGWTLVVNPDGTTSAWNKNKTKVLHSHGPPARAG* |
Ga0134126_113236771 | 3300010396 | Terrestrial Soil | GPRWGWTLVLNPDGTTTAWNKNKTKVLHSHGPPARAG* |
Ga0126383_109113371 | 3300010398 | Tropical Forest Soil | QVVIHRRGWTLVLNPDGTTTAWNKDKTKVLHSHGPPARPG* |
Ga0126347_11244162 | 3300010867 | Boreal Forest Soil | VVVHRMGWTMVRHPDGTTMAWNRDKTKVLRSRSRSRSHSPPAGAG* |
Ga0126361_105406291 | 3300010876 | Boreal Forest Soil | HHHIAIHQLGWTLTRHPDGTTTARNRDHTKTLRSHSPPARAG* |
Ga0126361_107637862 | 3300010876 | Boreal Forest Soil | HHHVMIHRMGWTLVRHPDGTTTAWNRDKTKVLRSHGPPARAG* |
Ga0126361_108312301 | 3300010876 | Boreal Forest Soil | IHRMGWTLVRHPDGTTMAWNRDKSKVLRSHSPPARAG* |
Ga0126361_108837541 | 3300010876 | Boreal Forest Soil | MTRKLKIRWGWTLALNPDGTTTAWNPDRTKVLRSHSPPARA* |
Ga0126350_117940981 | 3300010880 | Boreal Forest Soil | QVMIHRLGWTLIVNPDGTTTAWNKNKTKVLHSHGPPARAG* |
Ga0137382_112805912 | 3300012200 | Vadose Zone Soil | WGWTLVLNPDGTTTAWNKDKTKVLHSHGPPARAG* |
Ga0137374_112976581 | 3300012204 | Vadose Zone Soil | IHQWGWTVVLNPDGTTTAWNKDKSKIIHSHSPPVRPG* |
Ga0137380_101988554 | 3300012206 | Vadose Zone Soil | HRWGWTLVLNPDGTTTAWNKNKTKVLHSHGPPVRPG* |
Ga0137380_116737962 | 3300012206 | Vadose Zone Soil | WGWTLVLNPDGTTSAWNKNKTKVLHSHGPPARTG* |
Ga0137376_106240692 | 3300012208 | Vadose Zone Soil | WGWTLVLNPDGTTTAWNKDKSKVLHSHGPPARAG* |
Ga0137379_100810941 | 3300012209 | Vadose Zone Soil | HQQGWTVVLNPDGTTTAWNKDKTKVLRSHSPPARPG* |
Ga0137378_104089791 | 3300012210 | Vadose Zone Soil | IHQWGWTVVLNPDGTTTTGWNKDRTKVLHSHGPPVRPG* |
Ga0137377_100826971 | 3300012211 | Vadose Zone Soil | QVVIHRWGWTLVLNPDGTISAWNKNKTKVLHSHGPPARTG* |
Ga0137377_118229602 | 3300012211 | Vadose Zone Soil | RWGWTLVLNPDGTTSAWNKNKTKVLHSHGPPARAG* |
Ga0137386_112801751 | 3300012351 | Vadose Zone Soil | VVIHQQGWTVILNPDGTTTAWNKDKTKILRSHSPPARPG* |
Ga0137367_105801351 | 3300012353 | Vadose Zone Soil | RWGWTLVVNPDGTTSAWNKNKTKVLHSHGPPARAG* |
Ga0137366_100308801 | 3300012354 | Vadose Zone Soil | QVVIHRWGWTLVVNPDGTTSAWNNNKTKVLHSHGPPARAG* |
Ga0137371_104288732 | 3300012356 | Vadose Zone Soil | VIHRWGWTLVVNPDGTTSAWNRNKTKVLHSHGPPARAG* |
Ga0137371_104527331 | 3300012356 | Vadose Zone Soil | HRWGWTLVVNPDGTTSAWNKNKTKTLHSHGPPARAG* |
Ga0137384_109315981 | 3300012357 | Vadose Zone Soil | HHQVEIHRNGWTVVLNPDGTTTAWNKDKTKILHSHSRNHSPPARPG* |
Ga0137384_109744041 | 3300012357 | Vadose Zone Soil | HQRGWTLVVNPDGTTTAWNKDKTRVLHSHSPPARAG* |
Ga0137385_116679371 | 3300012359 | Vadose Zone Soil | HRQGWTVILNPDGTTTAWNKDKSKILHSHSHNHSPPARPG* |
Ga0150984_1155320871 | 3300012469 | Avena Fatua Rhizosphere | IHQWGWTVVLNPDGTTTAWNKDKTKIIHSHSPPVRPG* |
Ga0157335_10133592 | 3300012492 | Arabidopsis Rhizosphere | HRWGWTLVVNPDGTTTAWNKNKTKVLHSHGPPARAG* |
Ga0157335_10399891 | 3300012492 | Arabidopsis Rhizosphere | HRWGWTLAVNPDGTTTAWNKNKTKVLHSHGPPARAR* |
Ga0157314_10194101 | 3300012500 | Arabidopsis Rhizosphere | WDWSLVLNRDGTTTAWNKDRTKVLHSHGPPVRPG* |
Ga0157347_10149381 | 3300012502 | Arabidopsis Rhizosphere | RWGWTLVLNPDGTTTAWNKDKTKVLHSHSPPVRPG* |
Ga0157339_10387052 | 3300012505 | Arabidopsis Rhizosphere | WGWTLVVNPDGTTTAWNKDKTKVLHSHGPPVRPG* |
Ga0157342_10656852 | 3300012507 | Arabidopsis Rhizosphere | WGWTLVLNPDGTTSAWNKDKTKVLHSHGPPVRPG* |
Ga0137395_112066413 | 3300012917 | Vadose Zone Soil | WGWTLVLNPDGTTTAWNKDQTKVLHSHGPPVRPG* |
Ga0164298_101224532 | 3300012955 | Soil | MVSAIWTLVVNPDGTTSAWNKNKTKVLHSHGPPARAG* |
Ga0164298_109195391 | 3300012955 | Soil | WGWTLIVNPDGTTTAWNKNKTKVLHSHGPPARPG* |
Ga0126369_115640971 | 3300012971 | Tropical Forest Soil | VVIHRQGWTLVLNPDGTTTAWNKDKTKILHSHSPPARAG* |
Ga0164309_103824212 | 3300012984 | Soil | MGDRRGWTLVLAPDGTTTAWNKDRTKVLHSHGPPAR |
Ga0164308_104250851 | 3300012985 | Soil | RWGWTLVVNPDGTTTAWNRDKTKVLHSHGPPVRPG* |
Ga0164304_100574035 | 3300012986 | Soil | HRWGWTLVLNPDGTTTAWNKAKTKVLHSHGPPVRPG* |
Ga0164305_111219131 | 3300012989 | Soil | IHRQGWALVLRPDGTTAAWNKDKTKVLRSHGPPARTG* |
Ga0157369_124072941 | 3300013105 | Corn Rhizosphere | HHHQVEIHRNGWTVVLNPDGTTTAWNKDRTKILHSHSRNHSPPARPG* |
Ga0157378_110614092 | 3300013297 | Miscanthus Rhizosphere | WGWTLVVNPDGTTSAWNKNKTKVLHSHRPPARPG* |
Ga0157378_115914131 | 3300013297 | Miscanthus Rhizosphere | WVWTLIVNPEGTTTAWNKDSTKVLHSHGPPVRPG* |
Ga0157378_120661172 | 3300013297 | Miscanthus Rhizosphere | WGWTLVVNPDGTTSAWNKNKTKVLHSHGSPARAG* |
Ga0157372_127225422 | 3300013307 | Corn Rhizosphere | HHHIVIRRWSWTLVVNRDGTTAAWDKNKTKVLHSHGPPARAG* |
Ga0134078_102716562 | 3300014157 | Grasslands Soil | IHRWGWTLVVNPDGTTSAWDKNKTKVLHSHGPPARAG* |
Ga0134079_106435171 | 3300014166 | Grasslands Soil | YHHQVMIHRRGWTLVVNPDGTTTAWNKDRTKILHRHSRNHSRPARPG* |
Ga0181537_102542471 | 3300014201 | Bog | VMIHRRGWTLVRNPDGTTTAWNRDRSKVLRSHSPPARAG* |
Ga0181537_105155091 | 3300014201 | Bog | MIHRRGWTLVRNPDGTTTAWNRDRSKVLRSHSPPARAG* |
Ga0157376_108377651 | 3300014969 | Miscanthus Rhizosphere | WGWTLVVNPDGTTTAWNKNKTKVLHSLGPPARAG* |
Ga0137412_105067901 | 3300015242 | Vadose Zone Soil | WGWTLVLNSDGTTTAWNKDKTKVLHSHGPPARPG* |
Ga0132256_1031373923 | 3300015372 | Arabidopsis Rhizosphere | RQGWTLVLNPDGTTTAWNKDRSKILHSHGPPARAG* |
Ga0132256_1032023892 | 3300015372 | Arabidopsis Rhizosphere | VIHRWGWTLAVNPDGTTTAWNKNKTKVLHSHGPPARAG* |
Ga0132255_1021059051 | 3300015374 | Arabidopsis Rhizosphere | IQRWGWTLIVNPDGTTTAWNKDKTKVLHSHGPPVRPG* |
Ga0132255_1052909241 | 3300015374 | Arabidopsis Rhizosphere | RWGWTLVVNPDGTTTAWNKDKTKVLHSHGPPARGG* |
Ga0182039_102576701 | 3300016422 | Soil | IHQQGWTVVLNPDGTTTAWNKDKTKIIHSHSPPVRPG |
Ga0182039_122187382 | 3300016422 | Soil | IHRQGWTLVLNPDGTTTAWNKDRTKVLHSHGPPTRPG |
Ga0182038_114005532 | 3300016445 | Soil | RVVIHQWGWTVVLNPDGTTTAWNKDKTKVIHSHSPPARRG |
Ga0182038_115692742 | 3300016445 | Soil | HRQGWTLVLNADGTTTAWNTDKTKVLHSHGPPARAG |
Ga0187820_12517141 | 3300017924 | Freshwater Sediment | RRGWTLVLNTDGTTTAWNPDKTKILHSHSPPVRPG |
Ga0187879_101554101 | 3300017946 | Peatland | HRMGWTLVRHPDGTTTAWNRDQSKVLRSHSPPARAG |
Ga0187785_105399793 | 3300017947 | Tropical Peatland | HQWCWTLVLNPDSTTTAWNKDKTKFLRSHGPPARAG |
Ga0187783_106756802 | 3300017970 | Tropical Peatland | HQRGWTLTLNPDATTTAFSPDGTKVYHSHAPPARAG |
Ga0187781_101929121 | 3300017972 | Tropical Peatland | RWGWTLALNPDGTTTAWNRDRTKVLHSHGPPARPG |
Ga0187781_114088403 | 3300017972 | Tropical Peatland | RWGWRLMLNPEGTMTAWNPDRTKVLYSRGPPTGAG |
Ga0187816_100071348 | 3300017995 | Freshwater Sediment | RWGWTLALNPDGTTTAWNADRTKVLHSHSPPARAG |
Ga0187883_101099431 | 3300018037 | Peatland | RMGWTLVRNPDGTTTAWNRDRTNVLRSHSPPARAG |
Ga0187883_102257082 | 3300018037 | Peatland | MVHRMGWTLVRNPDGTTTAWNRDRTKVLRSHGPPARAG |
Ga0187871_100836831 | 3300018042 | Peatland | IHRMGWTLVRNPDGTTTAWNRDRTKVLRSHSPPARAG |
Ga0187871_101017124 | 3300018042 | Peatland | FHHHQVMIHRMGWTLVRNPDGTTTAWNRDRSKVLRSHSPPARAG |
Ga0187851_101367001 | 3300018046 | Peatland | HRRGWTLVRNPDGTTTAWNRDRSKVLRSHSPPARAG |
Ga0187851_102825353 | 3300018046 | Peatland | MIHRMGWVLVRNPDGTTTAWNRARTKVLRSHSPPARAG |
Ga0187769_103842382 | 3300018086 | Tropical Peatland | AWRSLKCQSYRTLVLNPDGTTTAWNPDRTKVLHSHSPPARAG |
Ga0066662_104084581 | 3300018468 | Grasslands Soil | VVIHRQGWTVILNPDGTTTAWNKDKTKILHSHSPPARAG |
Ga0066662_121945522 | 3300018468 | Grasslands Soil | HQIIVHRQGWTLILDPDGTTTAWNKDKTKVLRSHSPPARAG |
Ga0210405_103417502 | 3300021171 | Soil | QDVIHRQGWTLVLNPDGTTTARNKDNTKVLHSHGPPARPG |
Ga0210396_114767072 | 3300021180 | Soil | QVMIHRQGWTLVLNPDGTTSAWNRDKTKVLHSHSHSPPARAG |
Ga0210388_104108221 | 3300021181 | Soil | HRMGWTLVRNPDGTTTAWNRNRTKVLRSHSPPARAG |
Ga0193719_102934942 | 3300021344 | Soil | KWGWTLILNPDGTTSAWNKDRTKVLHSHGPPARAG |
Ga0213881_102742362 | 3300021374 | Exposed Rock | MIHRQGWTLVLNPDGTTTAWNKDRTKVLHSHGPPARSG |
Ga0213874_100560062 | 3300021377 | Plant Roots | VIIHRQGWTLVLNPDGTTTAWNKDKTKILHSHGPPARPG |
Ga0213876_101059602 | 3300021384 | Plant Roots | MIHRRGWTLIVNPDGTTTAWNKDRTKVLHSHGPPARAG |
Ga0213875_100372323 | 3300021388 | Plant Roots | TQVMIHRLGWTLIVNPDGTTTAWNKDKTKVLHSHGPPARAG |
Ga0213875_101056933 | 3300021388 | Plant Roots | MIHRLGWTLIVNPDGTTTAWNKDKTKVLHSHGPPARAG |
Ga0213875_101819891 | 3300021388 | Plant Roots | IHRQGWTLKLNPDGTTTAWNKDRSRILHSHSPPARTG |
Ga0210393_103744321 | 3300021401 | Soil | QVMIHRLGWTLILNPDGTTTAWNKNRTKTLHSHSPPTRTG |
Ga0210393_104023701 | 3300021401 | Soil | MIHRLGWTLILNPDGTTTAWNKNRTKTLHSHSPPARTG |
Ga0210393_114286242 | 3300021401 | Soil | QVVIHQQGWTLVLNPDGTTTAWNRDKTKVLHSHSHSPPPRAG |
Ga0210393_115837241 | 3300021401 | Soil | QVVIHRWGWTVVLNPDGTTTAWNKDKTKILHSHSHSPPPRPG |
Ga0210397_100758621 | 3300021403 | Soil | IHRLGWTLILNPDGTTTAWNKDRTKTLHSHSPPARTG |
Ga0210387_116582342 | 3300021405 | Soil | IQRQGRTLVLNPDGTTTARNKDKTKVLHSHGPPTRPG |
Ga0210386_111244781 | 3300021406 | Soil | VIHRHGWTLMVNPDGTTTAWNNDHSKTLHSHGPPTRPG |
Ga0210384_118959081 | 3300021432 | Soil | QIVIHRWGWTLVVNPDGTTSAWNKNKTKTKVLHSHGPPARAG |
Ga0210390_101133774 | 3300021474 | Soil | IHRLGWTLILNPDGTTTAWNKNRTKTLHSHSPPARTG |
Ga0210390_111245141 | 3300021474 | Soil | RLGWTLVLNPDGTTTAWNKDHTKTLHSHSPPARAG |
Ga0210398_100148101 | 3300021477 | Soil | QVMIHRLGWTLILNPDGTTTAWNKNRTKTLHSHSPPARAG |
Ga0210398_111719561 | 3300021477 | Soil | GGQYAVNQVVIHRQGWTLVLNPDGTTTWNPDHTKILHSHSPPARAG |
Ga0210402_110165131 | 3300021478 | Soil | IHRWGWTVVLNPDGTTTAWNKDKTKIIHSHSPPARPG |
Ga0210410_103821503 | 3300021479 | Soil | QVVIHRQGWTLVLNPDGTTTARNKDNTKVLHSHGPPARPG |
Ga0126371_119268403 | 3300021560 | Tropical Forest Soil | HRQGWTLVLNPDGTTTAWNPGRTKILHSHAPPARPG |
Ga0242662_102989871 | 3300022533 | Soil | HRWGWTLVVNPDGTTTAWNRDKTKVLHSHGPPVRPG |
Ga0247676_10571181 | 3300024249 | Soil | RWGWTLIVNPDGTTTAWNKDKTKVLHSHGPPVRPG |
Ga0207692_103180781 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | IVIHRWGWTLVVNPDGTTSAWNKNKTKVLHSHGPPARPG |
Ga0207692_107073422 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | VMIHRRGWTLIVNPDGTTTAWNKDRTKVLHSHGPPGRAGPSGTG |
Ga0207692_109857871 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | IHRWGWTLVVNPDGTTSAWNKNKTKVLHSHGPPARPG |
Ga0207642_105867482 | 3300025899 | Miscanthus Rhizosphere | RWGWTLVVNPDGTTTAWNKDRTKVLHSHGPPVRPG |
Ga0207685_100834051 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | WTVVLNPDGTTTAWNKDRTKVLHSHSHSHSPPPRPG |
Ga0207699_100331311 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | LIVNPDGTTTAWNKDRTKVLHSHGPPGRAGPSGAG |
Ga0207699_100639243 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSAIWTLVVNPDGTTSAWNKNKTKVLHSHGPPARAA |
Ga0207684_106379371 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | QIVIHKRGWTLVLNPDGTTSAWNKDRTKVLHSHGPPARAG |
Ga0207671_114022681 | 3300025914 | Corn Rhizosphere | HRWGWTLVVNPDGTTTAWNKNKTKVLHSHGPPARAG |
Ga0207693_114713762 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MIHRLGWTLVVNPDGTTTAWNKDKTKVLHSHGPPARAG |
Ga0207663_102672871 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VVIHRQGWTLVLNPDGTTTAWNKDKSKVLHSHGPPARPG |
Ga0207663_104956791 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | TVILNPDGSVTAWNKDRTKVLHSHSRNHSPPPRPG |
Ga0207663_106070421 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VIHRQGWSLVLNPDGTTTAWNKDKTKILHSHGPPARPG |
Ga0207663_112114811 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | RWGWTLVVNPDGTTTAWNKDKTRVLHSHSPPARAG |
Ga0207663_112618441 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | RWGWTLVVNPDGTTTAWNKDKTRVLHSHSPPARTG |
Ga0207663_115457571 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | HRWGWTLVLHPDSTTTAWNKDKTKVLHSHGPPARAG |
Ga0207652_111811282 | 3300025921 | Corn Rhizosphere | HRWGWTLVVNPDGTTTAWNKDRTKMLRSHGPPARAGPPRAG |
Ga0207694_102163784 | 3300025924 | Corn Rhizosphere | VVIHQWGWTVVLNPDGTTTAWNKDKTKIIHSHSPPVRPG |
Ga0207700_100359134 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | RWGWTLVVNPDGTTSAWNKNKTKVLHSHGPPARAG |
Ga0207700_116276782 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VIHQWGWTVVLNPDGTTTAWNKDKTKIIHSHSPPVRPG |
Ga0207700_120223652 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VVIHRWGWTVVLNPDGTTTAWNKDKTKILHSHTRNHSPPARPG |
Ga0207640_101693663 | 3300025981 | Corn Rhizosphere | ADKQRHWIVIHRWGWTLAVNPDGTTTTWNKNKTKVLHSHGRPARAG |
Ga0207677_121011681 | 3300026023 | Miscanthus Rhizosphere | TQIGLGEPVIHRWGWTLVVNPYGTTTAWDKDKTKVLHSHGPPVRPG |
Ga0207702_107284143 | 3300026078 | Corn Rhizosphere | RWGWTLVVNPDGTTSAWNKDKTKVLHSHGPPARAG |
Ga0207702_117520491 | 3300026078 | Corn Rhizosphere | VMIHRLGWTLVVNPDGTTTAWSKDKTKVLHSHGPPARAG |
Ga0207702_118119201 | 3300026078 | Corn Rhizosphere | IHRQGWTLVVNPDGTTSAWNKNKTKVLHSHGPPARAG |
Ga0207676_113059371 | 3300026095 | Switchgrass Rhizosphere | HRWGWTLAVNPDGTTTAWNKNKTKVLHSHGPPARAG |
Ga0207675_1001082284 | 3300026118 | Switchgrass Rhizosphere | RWGWTLVVNPDGTTTAWNKDKTKVLHSHGPPARAG |
Ga0208199_10000781 | 3300027497 | Peatlands Soil | VIHRRGWTLVLNKDGTTTAWNPDRTKVLHSHGPHSPPARAG |
Ga0208827_11740352 | 3300027641 | Peatlands Soil | IHRWGWTLVLNKDGTTTAWNPDRTKVLHSHGPHSPPARAG |
Ga0209073_100900721 | 3300027765 | Agricultural Soil | HQVEIHRNGWTVVLNPDGTTTAWNKDRTKVLHSHSRNHSPPPRPG |
Ga0209177_103505821 | 3300027775 | Agricultural Soil | WTLVVNPDGTTTAWNKNRTKVLRSHGPPARAGPSAAG |
Ga0209074_102186961 | 3300027787 | Agricultural Soil | IHRWGWTVILNPDGTTTAWNKDRTKILHSHPHTRNHSPPDQPG |
Ga0209180_106709982 | 3300027846 | Vadose Zone Soil | RWGWTLVLNPDGTTTAWNPDKTKVLRSHSPPVRPG |
Ga0209579_100355951 | 3300027869 | Surface Soil | RWGWALVLHPDGTTTAWNRDKTKVLRSHSPPPRPG |
Ga0209579_106576431 | 3300027869 | Surface Soil | IHRLGWTLILNRDGTTTAWNKDRTKTLHSHSPPAPR |
Ga0209275_100755833 | 3300027884 | Soil | MIHRRGWTLVRNADGTTTAWNRDRSKVLRSHGPPARAG |
Ga0209415_107151082 | 3300027905 | Peatlands Soil | VIHRWGWTLVLHPDGTTTAWNRNKTKVLRSHSPPPGPG |
Ga0209006_100240571 | 3300027908 | Forest Soil | HRMGWTLVRHHDGTTTAWNRDRTKVLRSHSPPARAG |
Ga0268265_114182601 | 3300028380 | Switchgrass Rhizosphere | VIHRWGWTLVVNPDGTTSAWNKNKTKVLHSHGPPARAG |
Ga0268264_112736311 | 3300028381 | Switchgrass Rhizosphere | RWGWALVVNPDGTTTAWNKDKTKVLHSHGPPARAG |
Ga0307307_100041326 | 3300028718 | Soil | RWGWTLVLNPDGTTTAWNKDKTKVLHSHGPPGPAGVTSPGASREKVDPDTV |
Ga0307307_102905271 | 3300028718 | Soil | VHRQGWTLVLNPDGTTTAWNKDKTKVLHSHGPPGPAGVTSPGASR |
Ga0302220_100337891 | 3300028742 | Palsa | HQVMIHRMGWTLVRHPDGTTTAWNRDRTKVLRSHSPPARAG |
Ga0302220_101279452 | 3300028742 | Palsa | MIHRMGWTLARNPDGTTTAWNRDRTKVLRSHSPPARAG |
Ga0307316_103164362 | 3300028755 | Soil | HRWGWTLVLNPDGTTSAWNKNKTKVLHSHGPPARTG |
Ga0302224_102621071 | 3300028759 | Palsa | IHRLGWTLVRNPDGTTTAWNRDRTKVLRSHSPPARAG |
Ga0302231_103950661 | 3300028775 | Palsa | HRMGWTLARNPDGTTTAWNRDRTKVLRSHSPPARAG |
Ga0302223_101586271 | 3300028781 | Palsa | QIMIHRMGWTLVRNPDGTTTAWNRDRTKVLRSHSPPARAG |
Ga0302223_102169401 | 3300028781 | Palsa | MIHRMGWTLVRNPDGTTTAWNRDRTKVLRSHSPPARAG |
Ga0307282_100025338 | 3300028784 | Soil | VRAIPIPVLNRDGTTTAWNKDKTKVLHSHGPPVRPG |
Ga0302232_100128716 | 3300028789 | Palsa | HQVMIHRLGWTLVRNPDGTTTAWNRDRTKVLRSHSPPARAG |
Ga0302232_101036961 | 3300028789 | Palsa | MIHRTGWTLVRNPDGTTSAWNRDRTKVLRSHSPPARAG |
Ga0302232_103805171 | 3300028789 | Palsa | HHQVMIHRMGWTLVRNPDGTTTAWNRDRSKVLRSHSPPARAG |
Ga0302232_105922141 | 3300028789 | Palsa | AVMIHRTGWTLVRHPDGTTTAWNRDRTKVLRSHSPPARAG |
Ga0302227_103666081 | 3300028795 | Palsa | VIHRMGWTLVRHPDGTTTAWNRDRTKVLRSHSPPARAG |
Ga0302226_101095011 | 3300028801 | Palsa | QVMIHRLGWTLARNPDGTTTAWNRDRTKVLRSHSPPARAG |
Ga0307312_104272621 | 3300028828 | Soil | RQGWTLGLNPDGTTTAWNKDKTKVLHSHGPPVRPG |
Ga0307289_102814952 | 3300028875 | Soil | QIAIHRWGWTLVLNPDGTTTASNKDKTKVLHGPPARAG |
Ga0302235_101676512 | 3300028877 | Palsa | LICFFHHQVMIHRRGWTLVRNADGTTTAWNRDRSKVLRSHSPPARAG |
Ga0302235_104454941 | 3300028877 | Palsa | FHHHQAMIHRIGWTLVRNPDGTTTAWNRDRTKVLRSHSPPARAG |
Ga0302235_104924482 | 3300028877 | Palsa | FFHHHVMIHRMGWTLVRNRDGTTTAWNRDRSKVLRSHSPPARAG |
Ga0302229_100362133 | 3300028879 | Palsa | RMGWTLVRNPDGTTTAWNRDRTKVLRSHSPPARTG |
Ga0307308_100208021 | 3300028884 | Soil | IHRWGWTLVVNPDGTTSAWNKNKTKVLHSHGPPARTG |
Ga0311368_104010901 | 3300029882 | Palsa | HRMGWTLVRHPDGTTTAWNRDRTKVLRSHSPPARAG |
Ga0311368_106049091 | 3300029882 | Palsa | HHHQVMIHRMGWTLVRNPDGTTTAWNRDRTKVLRSHSPPARAG |
Ga0311371_103838363 | 3300029951 | Palsa | LCFFHHAVMIHRTGWTLVRNPDGTTAAWNRDRTKVLRSHSPPARAG |
Ga0311371_108817521 | 3300029951 | Palsa | IHRMGWTLVRNPDGTTTAWNQDRSKVLRSHSPPARAG |
Ga0311339_100263423 | 3300029999 | Palsa | MIHRMGWTLVRHPDGTTTAWNRDRTKVLRSHSPPARAG |
Ga0311339_103018873 | 3300029999 | Palsa | HAVLIHRMGWTLVRNPDGTTTAWNRNRTKVLRSHSPPARAG |
Ga0311339_104403241 | 3300029999 | Palsa | HRWGWTLALNGDGTTTAWNKDHTQVLHSHAPPTARAG |
Ga0311339_107581041 | 3300029999 | Palsa | RTGWTLVRHPDGTTTAWNRDRTKVLRSHSPPARAG |
Ga0311338_100305611 | 3300030007 | Palsa | LIHRMGWTLVRNPDGTTTAWNRNRTKVLRSHSPPARAG |
Ga0311338_100820236 | 3300030007 | Palsa | HHQVMIHRLGWTLVRNPDGTTTAWNRDRTKVLRSHSPPARAG |
Ga0311338_102714741 | 3300030007 | Palsa | HVMIHRMGWTLVRNPDGTTTAWNQDRSKVLRSHSPPARAG |
Ga0311338_103402193 | 3300030007 | Palsa | HAVMIHRTGWTLVRHPDGTTTAWNRDRTKVLRSHSPPARAG |
Ga0311338_107471101 | 3300030007 | Palsa | RMGRTLVRNRDGTTTAWNRDRSKVLRSHSPPARAG |
Ga0311338_109152442 | 3300030007 | Palsa | LCFFHHHVMIHRMGWTLVRNRDGTTTAWNRDRSKVLRSHSPPARAG |
Ga0302178_101262834 | 3300030013 | Palsa | HRMGWTLVRNPDGTTTAWNQDRSKVLRSHSPPARAG |
Ga0302178_103128482 | 3300030013 | Palsa | RMGWTLVRHPDGTTTAWNRDRTKVLRSHSPPARAG |
Ga0302177_100255335 | 3300030053 | Palsa | IHRMGWTLARNPDGTTSAWNRDRTKVLRSHSPPARAG |
Ga0302177_101314213 | 3300030053 | Palsa | HHQIVIHRMGWTLVRNPDGTTTAWNRDRTKVLRSHSPPARTG |
Ga0302177_101762291 | 3300030053 | Palsa | IHRRGWTLVRNADGTTTAWNRDRSKVLRSHSPPARAG |
Ga0302177_102440481 | 3300030053 | Palsa | HKVMIHRLGWTLVRNPDGTTSAWNRDRSKVLRSHSPPARAG |
Ga0302177_102999771 | 3300030053 | Palsa | AVMIHRTGWTLVRNPDGTTSAWNRDRTKVLRSHSPPARAG |
Ga0302181_100085321 | 3300030056 | Palsa | RLGWTLARNPDGTTTAWNRDRTKVLRSHSPPARAG |
Ga0302181_102852972 | 3300030056 | Palsa | QVMIHRMGWTLVRHPDGTTTAWNRDRTKVLRSHSPPARAG |
Ga0302179_100300881 | 3300030058 | Palsa | LCFHHHHVMIHRMGWTLVRNPDGTTTAWNRNRTKVLRSHSPPARAG |
Ga0302179_101824881 | 3300030058 | Palsa | AVLIHRMGWTLVRNPDGTTTAWNRNRTKVLRSHSPPARAG |
Ga0311353_110477502 | 3300030399 | Palsa | VMIHRTGWTLVRHPDGTTTAWNRDRTKVLRSHSPPARAG |
Ga0302184_101191081 | 3300030490 | Palsa | HHQIMIHRKGWTLVRNADGTTTAWNRDRSKVLRSHSPPARAG |
Ga0302184_104297191 | 3300030490 | Palsa | LVAIHRWGWTLALNGDGTTTAWNKDHTKVLHSHAPPTTRAG |
Ga0311370_104112664 | 3300030503 | Palsa | RMGWTLVRNPDGTTTAWNRNRTKVLRSHSPPARAG |
Ga0311370_105864383 | 3300030503 | Palsa | HAVMIHRTGWTLVRNPDGTTSAWNRDRTKVLRSHSPPARAG |
Ga0311370_108152541 | 3300030503 | Palsa | MIHRTGWTQVRNPDGTTTAWNRDRTKVLRSHSPPARAG |
Ga0311370_109504112 | 3300030503 | Palsa | MIHRMGWTLVRNPDGTTTAWNQDRSKVLRSHSPPARAG |
Ga0311372_105878801 | 3300030520 | Palsa | IHRMGWTLVRNPDGTTTAWNRNRTKVLRSHSPPARAG |
Ga0311357_103979191 | 3300030524 | Palsa | FHHAVMIHRTGWTLVRNPDGTTSAWNRDRTKVLRSHSPPARAG |
Ga0311357_109355042 | 3300030524 | Palsa | FHHHQIVIHRMGWTLVRNPDGTTTAWNRDRTKVLRSHSPPARTG |
Ga0311356_118481792 | 3300030617 | Palsa | MIHRTGWTLVRHPDGTTTAWNRDRTKVLRSHSPPARAG |
Ga0311354_100391439 | 3300030618 | Palsa | HRMGWILVRNPDGTTTAWNRDRTKVLRSHSPPARAG |
Ga0311354_105305751 | 3300030618 | Palsa | VAIHRMGWTLVRNADGTTTAWNRDRSKVLRSHSPPARAG |
Ga0302311_110488441 | 3300030739 | Palsa | FFHHNVMIHRMGWTLVRNPDGTTTAWNRDRTKVLRSHSPPARAG |
Ga0265460_129412181 | 3300030740 | Soil | QGWTLVLDPDGTTTAWNRDKTKVLHSHSHSPPARAG |
Ga0302308_101030753 | 3300031027 | Palsa | CFHHHQVMIHRMGWILVRNPDGTTTAWNRDRTKVLRSHSPPARAG |
Ga0302307_102078682 | 3300031233 | Palsa | QVMIHRMGWTLVRNADGTTTAWNRDRTKVLRSHSPPARTG |
Ga0302325_102240541 | 3300031234 | Palsa | QVMIHRRGWTLVRNADGTTTAWNRDRSKVLRSHSPPARAG |
Ga0302325_104389693 | 3300031234 | Palsa | FFHHAVMIHRTGWTLVRNPDGTTAAWNRDRTKVLRSHSPPARAG |
Ga0302324_1003710441 | 3300031236 | Palsa | VMIHRMGWTLVRNPDGTTTAWNRDRTKVLRSHSPPARAG |
Ga0302324_1005206853 | 3300031236 | Palsa | HHVMIHRMGWTLVRHPDGTTTAWNRDRTKVLRSHSPPARAG |
Ga0302324_1021111291 | 3300031236 | Palsa | HRMGWTLVRNPDGTTTAWNRDRTKVLRSHSPPARAG |
Ga0302324_1032292912 | 3300031236 | Palsa | FHHHQVMIHRMGWTLARNPDGTTTAWNRDRTKVLRSHSPPARAG |
Ga0302326_101743876 | 3300031525 | Palsa | RMGWTLVRNPDGTTTAWNRDRTKVLRSHSPPARAG |
Ga0302326_113039702 | 3300031525 | Palsa | MIHRMGWTLVRNPDGTTTAWNRDRSKVLRSHSPPARAG |
Ga0302326_117451262 | 3300031525 | Palsa | FHHHAVMIHRMGWTLVRNPDGTTTAWNRDRTKVLRSHSPPARAG |
Ga0318515_100899401 | 3300031572 | Soil | HRQGWTLVLNPDGTTTAWNKDRTKILHSHGPPARAG |
Ga0310915_110594211 | 3300031573 | Soil | HQQGWTVVLNPDGTTTAWNQDKTKIIHSHSPPARPG |
Ga0318555_103789602 | 3300031640 | Soil | RWGWTLILHPEGTTTAWNGNKTKVLRSHSPPARAG |
Ga0318542_102111782 | 3300031668 | Soil | HQQGWTVVLNPDGTTTAWNKDKTKIIHSHSPPVRPG |
Ga0318542_107680561 | 3300031668 | Soil | HHQVIIHQQGWTVVLNPDGTTTAWNKDKTKIIHSHSPPARPG |
Ga0318572_103302381 | 3300031681 | Soil | HQQGWTVVLNPDGTTAAWNKDKTKIIHSHSPPVRPG |
Ga0310686_1003683811 | 3300031708 | Soil | MIHRMGWTLVRNPDGTTTAWNRNRTKVLRSHSPPARAG |
Ga0310686_1060531051 | 3300031708 | Soil | HQLMIHRMGWTLVRNPDGTTTAWNRNRTKVLRSHSPPARAG |
Ga0318496_103914582 | 3300031713 | Soil | HQVIIHQQGWTVVLNPDGTTTAWNKDKTKIIHSHSPPVRPG |
Ga0318496_106185612 | 3300031713 | Soil | RWGWTLVLNPDGTTIAWNPNRTKILHSHSPPARAG |
Ga0306917_104254081 | 3300031719 | Soil | RWGWTLVLNPDGTTTAWNKDKTKVLHSHGPPARPG |
Ga0306918_107254363 | 3300031744 | Soil | RWGWTLILNPDGTTTAWNKDRTKVLHSHGPPVRPG |
Ga0318494_100590823 | 3300031751 | Soil | IHQRGWTVVLNPDGTTTAWNKDKTKIIHSHSPPARPG |
Ga0318554_104840642 | 3300031765 | Soil | AGSAPLVLNPDGTTTAWNKDKTKVLHSHSPPARAG |
Ga0318521_106579321 | 3300031770 | Soil | VMIHRQGWTPVLNPDGTTTAWNKDRTKVLHSHGPPARAG |
Ga0318498_102546613 | 3300031778 | Soil | QVMIHRQGWTLVLNPDGTTSAWNKTKTKVLHSHGPPARAG |
Ga0318576_100835553 | 3300031796 | Soil | VCITIHLRHVEIIIHQQGWTVVLNPDGTTTAWNKDKTKIIHSHSPPARPG |
Ga0318550_102451883 | 3300031797 | Soil | VVIHQQGWTVVLNPDGTTTAWNRDKTKIIHSHSPPARPG |
Ga0318497_104532451 | 3300031805 | Soil | QRGWTVVLNPDGTTTAWNKDKTKIIHSHSPPARPG |
Ga0318568_103756002 | 3300031819 | Soil | HQRGWTVVLNPDGTTTAWNKDKTKVIHSHSPPARPG |
Ga0318564_101616452 | 3300031831 | Soil | QQGWTVVLNPDGTTTAWNKDKTKIIHSHSPPVRPG |
Ga0318527_104237361 | 3300031859 | Soil | HHQVIIHQQGWTVVLNPDGTTTAWNKDKTKVIHSHSPPARPG |
Ga0318522_100724322 | 3300031894 | Soil | VSIHQQGWTVVLNPDGTTTAWNQDKTKIIHSHSPPARPG |
Ga0318551_108756732 | 3300031896 | Soil | QQGWTVVLNPDGTTTAWNQDKTKIIHSHSPPARPG |
Ga0306921_105377691 | 3300031912 | Soil | RSGPPGSAPLVLNPDGTTTAWNKDKTKVLHSHSPPARAG |
Ga0310913_104369522 | 3300031945 | Soil | GSGPAGSAPLVLNPDGTTTAWNKDKTKVLHSHSPPARAG |
Ga0310913_106838852 | 3300031945 | Soil | IHQWGWTVVLNPDGTTTAWNKDKTKILHSHSPPARPG |
Ga0310909_100528534 | 3300031947 | Soil | VCITIHLRHVEIIIHQQGWTVVLNPDGTTTAWNKDKTKIIHSHSPPVRPG |
Ga0306926_113410881 | 3300031954 | Soil | VMIHRQGWTLVLNPDGTTSAWNKTKTKVLHSHGPPARAG |
Ga0308176_100344271 | 3300031996 | Soil | VMIHRRGWTLVVNPDGTTTAWNKDMSKVLHSHGPPARAGPSGAG |
Ga0318558_102080263 | 3300032044 | Soil | RWGWTLVLNKDGTTTAWNPDRTKILRSHSPPTTRAG |
Ga0318558_106274601 | 3300032044 | Soil | VMIHRQGWTLVLNPDGTTTAWNKDKTKVLHSHGPPARAG |
Ga0318504_104746342 | 3300032063 | Soil | VIIHQQGWTVVLNPDGTTTAWNKDKTKIIHSHSPPARPG |
Ga0318513_100280831 | 3300032065 | Soil | HQWGWTVVLNPDGTTTAWNKDKIKVLHSHGPPARPG |
Ga0311301_102249042 | 3300032160 | Peatlands Soil | VVIHRWGWTLVLNPDGTTAWNPDKTKILHSHSPPVRPG |
Ga0311301_102971113 | 3300032160 | Peatlands Soil | MNGWALVLNPDGTTTAWNPDRTKVLYNHGPPAGAG |
Ga0311301_124254971 | 3300032160 | Peatlands Soil | RWGWTLVLNPDGTTTAWNPDKTKVLHSHSPPVSPG |
Ga0307470_109035472 | 3300032174 | Hardwood Forest Soil | VIHRWDWTLAVNPDGTTTTWNKNKTKVLHSHGRPARAG |
Ga0307472_1013991061 | 3300032205 | Hardwood Forest Soil | IHRWGWTLVVNPDGTTSAWNKNKTKVLRSHGPPARAG |
Ga0306920_1002271701 | 3300032261 | Soil | HQVIIHQQGWTVVLNPDGTTTAWNKDKTKIIHSHSPPARPG |
Ga0306920_1007981883 | 3300032261 | Soil | MIHRQGWTLVLNPDGTTTAWNKDRTTVLHSHGPPARAG |
Ga0306920_1016833141 | 3300032261 | Soil | QQGWTVVLNPDGTTTAWNKDKTKIIHSHSPPARPG |
Ga0335085_103381583 | 3300032770 | Soil | MIHRQGWTLVLNPDGTTTAWNKDRTEVLHSHGPPARAG |
Ga0335085_115833801 | 3300032770 | Soil | IHRQGWTLILNPDGTTTVWNKDKTKILHSHGPPARAG |
Ga0335082_109798351 | 3300032782 | Soil | HQVMIHRRGWILIVNPDGTTTAWNKDKTKVLHSHGPPGRAGPSRAG |
Ga0335079_104821111 | 3300032783 | Soil | QVVIHQWGWTVVLNPDGTTTAWNKDKTKIIHSHSPPARPG |
Ga0335078_103521722 | 3300032805 | Soil | VIHRQGWTLVLNPDGTTAAWNKDRTKILHSHGPPARPG |
Ga0335078_127290682 | 3300032805 | Soil | VMIHRRGWTLVVNPDGTTTAWNKDRTKVLHSHGPPARAG |
Ga0335080_118331842 | 3300032828 | Soil | VVIHRQGWTLVLNPDGTTTAWNKDKTKILHSHGPPARAG |
Ga0335081_102852235 | 3300032892 | Soil | IHQWGWTVVLNPDGTTTAWNKDKTKIIHSHSPPARPG |
Ga0335081_103825254 | 3300032892 | Soil | HQWGWTVVLNPDGTTTAWNKDKTKIIHSHSPPARPG |
Ga0335081_108441951 | 3300032892 | Soil | VMIHRQGWTLVLNPDGTTTAWNKDKTKILHSHGPPARPG |
Ga0335069_121063881 | 3300032893 | Soil | IHRWGWTVVLNPDGTTTAWNKDRTKILHSHSPPVRPG |
Ga0335083_103848981 | 3300032954 | Soil | QWGWTVVLNPDGTTTAWNKDKTKVLHSHGPPARAG |
Ga0335077_106613341 | 3300033158 | Soil | IHREGWTLVLNPDGTTTAWNKDKTKVLHSHGPPARAG |
Ga0335077_110105551 | 3300033158 | Soil | HQVMIHRQGWTLVVNPDGTTTAWNKNKTKVLHSHGPPARAG |
Ga0310914_107219001 | 3300033289 | Soil | IHRQGWTLVLNPDGTTTAWNTDKTKVLHSHGPPARAG |
Ga0310914_114016152 | 3300033289 | Soil | VIHQQGWTVVLNPDGTTTAWNKDKTKIIHSHSPPVRPG |
Ga0318519_104021141 | 3300033290 | Soil | HQQGWTVVLNPDGTTTAWNKDKTKVIHSHSPPARPG |
Ga0334804_034586_1463_1585 | 3300033818 | Soil | QVVIHRMGWTLARSPDGSTTAWNPDRTKVLRSHGPPARAG |
Ga0370483_0140513_669_809 | 3300034124 | Untreated Peat Soil | LRFFHHAVMIHRMGWTLVRNPDGTTSAWNRDRTKVLRSHSPPARAG |
Ga0370514_155265_1_114 | 3300034199 | Untreated Peat Soil | IHRMGWTLVRNPDGTTTAWNRDRSKVLRSHSPPARAG |
⦗Top⦘ |