NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F006144

Metagenome / Metatranscriptome Family F006144

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F006144
Family Type Metagenome / Metatranscriptome
Number of Sequences 380
Average Sequence Length 143 residues
Representative Sequence MTETGSEAHEHLTNALHSLNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Number of Associated Samples 190
Number of Associated Scaffolds 380

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 12.37 %
% of genes near scaffold ends (potentially truncated) 60.53 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 175
AlphaFold2 3D model prediction Yes
3D model pTM-score0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (100.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(43.158 % of family members)
Environment Ontology (ENVO) Unclassified
(70.789 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(85.263 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 16.88%    β-sheet: 23.75%    Coil/Unstructured: 59.37%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.42
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 380 Family Scaffolds
PF01138RNase_PH 0.26
PF00575S1 0.26

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 380 Family Scaffolds
COG0689Ribonuclease PHTranslation, ribosomal structure and biogenesis [J] 0.26
COG1185Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase)Translation, ribosomal structure and biogenesis [J] 0.26
COG2123Exosome complex RNA-binding protein Rrp42, RNase PH superfamilyIntracellular trafficking, secretion, and vesicular transport [U] 0.26


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002776|Ga0005234J37281_1024368All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium626Open in IMG/M
3300004097|Ga0055584_101818648All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium627Open in IMG/M
3300005433|Ga0066830_10089499All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium649Open in IMG/M
3300005516|Ga0066831_10066727All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium972Open in IMG/M
3300005608|Ga0066840_10129732All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium531Open in IMG/M
3300006383|Ga0075504_1418233All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium616Open in IMG/M
3300007513|Ga0105019_1164136All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1140Open in IMG/M
3300007955|Ga0105740_1096943All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium517Open in IMG/M
3300009130|Ga0118729_1196824All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium834Open in IMG/M
3300009216|Ga0103842_1036857All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium569Open in IMG/M
3300009279|Ga0103880_10076435All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium526Open in IMG/M
3300009425|Ga0114997_10634053All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium561Open in IMG/M
3300009436|Ga0115008_10290849All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1160Open in IMG/M
3300009436|Ga0115008_10297178All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1146Open in IMG/M
3300009436|Ga0115008_11213292All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium572Open in IMG/M
3300009544|Ga0115006_11565561All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium597Open in IMG/M
3300009550|Ga0115013_10521979All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium779Open in IMG/M
3300009593|Ga0115011_10359934All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1122Open in IMG/M
3300009593|Ga0115011_11090887All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium681Open in IMG/M
3300009599|Ga0115103_1280570All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium660Open in IMG/M
3300009677|Ga0115104_10543449All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium663Open in IMG/M
3300009677|Ga0115104_10610006All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium571Open in IMG/M
3300009677|Ga0115104_10722377All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium617Open in IMG/M
3300009677|Ga0115104_11043551All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium551Open in IMG/M
3300009677|Ga0115104_11284342All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium774Open in IMG/M
3300009679|Ga0115105_10125708All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium565Open in IMG/M
3300009679|Ga0115105_10858986All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium555Open in IMG/M
3300009679|Ga0115105_10959865All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium614Open in IMG/M
3300009679|Ga0115105_11237900All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium652Open in IMG/M
3300009679|Ga0115105_11318274All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium674Open in IMG/M
3300009705|Ga0115000_10246684All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1166Open in IMG/M
3300009748|Ga0123370_1045661All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium530Open in IMG/M
3300009785|Ga0115001_10279284All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1063Open in IMG/M
3300009790|Ga0115012_11593458All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium565Open in IMG/M
3300010135|Ga0123382_1050232All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium501Open in IMG/M
3300010883|Ga0133547_11993978All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1063Open in IMG/M
3300010883|Ga0133547_12000068All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1061Open in IMG/M
3300010981|Ga0138316_10032198All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium612Open in IMG/M
3300010981|Ga0138316_10184810All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium615Open in IMG/M
3300010981|Ga0138316_10485691All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium566Open in IMG/M
3300010981|Ga0138316_10544211All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium517Open in IMG/M
3300010981|Ga0138316_11222412All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium659Open in IMG/M
3300010981|Ga0138316_11520317All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium573Open in IMG/M
3300010985|Ga0138326_10450838All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium576Open in IMG/M
3300010987|Ga0138324_10447122All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium636Open in IMG/M
3300010987|Ga0138324_10452282All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium633Open in IMG/M
3300010987|Ga0138324_10461347All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium627Open in IMG/M
3300010987|Ga0138324_10467528All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium622Open in IMG/M
3300010987|Ga0138324_10705472All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium508Open in IMG/M
3300012524|Ga0129331_1050441All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium621Open in IMG/M
3300012920|Ga0160423_10286842All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1134Open in IMG/M
3300012952|Ga0163180_10637257All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium815Open in IMG/M
3300012952|Ga0163180_10706909All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium779Open in IMG/M
3300012953|Ga0163179_10377342All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1144Open in IMG/M
3300012953|Ga0163179_10418755All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1090Open in IMG/M
3300012953|Ga0163179_11132301All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium689Open in IMG/M
3300012953|Ga0163179_11386952All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium628Open in IMG/M
3300012953|Ga0163179_12040187All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium529Open in IMG/M
3300012969|Ga0129332_1009229All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium673Open in IMG/M
3300017717|Ga0181404_1168950All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium525Open in IMG/M
3300017783|Ga0181379_1331055All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium514Open in IMG/M
3300018515|Ga0192960_106029All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium578Open in IMG/M
3300018575|Ga0193474_1010319All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium720Open in IMG/M
3300018575|Ga0193474_1010817All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium702Open in IMG/M
3300018575|Ga0193474_1013522All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium617Open in IMG/M
3300018622|Ga0188862_1016216All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium687Open in IMG/M
3300018628|Ga0193355_1010516All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium822Open in IMG/M
3300018666|Ga0193159_1028793All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium722Open in IMG/M
3300018674|Ga0193166_1023098All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium571Open in IMG/M
3300018692|Ga0192944_1035476All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium723Open in IMG/M
3300018703|Ga0193274_1029113All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium581Open in IMG/M
3300018725|Ga0193517_1055555All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium687Open in IMG/M
3300018725|Ga0193517_1058445All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium661Open in IMG/M
3300018725|Ga0193517_1060948All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium639Open in IMG/M
3300018726|Ga0194246_1060246All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium597Open in IMG/M
3300018730|Ga0192967_1047112All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium722Open in IMG/M
3300018742|Ga0193138_1036333All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium649Open in IMG/M
3300018742|Ga0193138_1036936All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium644Open in IMG/M
3300018742|Ga0193138_1037339All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium640Open in IMG/M
3300018742|Ga0193138_1038019All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium634Open in IMG/M
3300018742|Ga0193138_1047311All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium566Open in IMG/M
3300018742|Ga0193138_1059468All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium502Open in IMG/M
3300018745|Ga0193000_1042589All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium684Open in IMG/M
3300018747|Ga0193147_1068557All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium590Open in IMG/M
3300018747|Ga0193147_1081056All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium533Open in IMG/M
3300018765|Ga0193031_1044156All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium732Open in IMG/M
3300018765|Ga0193031_1052468All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium680Open in IMG/M
3300018765|Ga0193031_1052625All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium679Open in IMG/M
3300018765|Ga0193031_1058257All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium648Open in IMG/M
3300018765|Ga0193031_1058642All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium646Open in IMG/M
3300018765|Ga0193031_1059308All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium643Open in IMG/M
3300018765|Ga0193031_1064752All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium617Open in IMG/M
3300018765|Ga0193031_1070820All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium589Open in IMG/M
3300018765|Ga0193031_1072004All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium584Open in IMG/M
3300018779|Ga0193149_1035481All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium706Open in IMG/M
3300018779|Ga0193149_1036177All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium699Open in IMG/M
3300018779|Ga0193149_1036648All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium695Open in IMG/M
3300018779|Ga0193149_1041214All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium656Open in IMG/M
3300018779|Ga0193149_1042166All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium649Open in IMG/M
3300018779|Ga0193149_1048629All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium604Open in IMG/M
3300018779|Ga0193149_1054548All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium568Open in IMG/M
3300018779|Ga0193149_1056663All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium557Open in IMG/M
3300018796|Ga0193117_1054180All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium670Open in IMG/M
3300018812|Ga0192829_1080416All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium611Open in IMG/M
3300018855|Ga0193475_1040063All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium750Open in IMG/M
3300018861|Ga0193072_1071089All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium681Open in IMG/M
3300018862|Ga0193308_1059648All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium624Open in IMG/M
3300018862|Ga0193308_1075183All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium549Open in IMG/M
3300018862|Ga0193308_1077093All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium542Open in IMG/M
3300018871|Ga0192978_1033630All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium960Open in IMG/M
3300018871|Ga0192978_1081069All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium594Open in IMG/M
3300018873|Ga0193553_1100422All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium738Open in IMG/M
3300018913|Ga0192868_10080369All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium535Open in IMG/M
3300018913|Ga0192868_10082147All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium531Open in IMG/M
3300018928|Ga0193260_10114194All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium584Open in IMG/M
3300018947|Ga0193066_10229434All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium522Open in IMG/M
3300018949|Ga0193010_10082412All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium561Open in IMG/M
3300018967|Ga0193178_10047095All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium638Open in IMG/M
3300018968|Ga0192894_10253462All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium589Open in IMG/M
3300018969|Ga0193143_10188584All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium599Open in IMG/M
3300018974|Ga0192873_10400547All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium552Open in IMG/M
3300018974|Ga0192873_10421399All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium530Open in IMG/M
3300018975|Ga0193006_10208794All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium571Open in IMG/M
3300018975|Ga0193006_10220273All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium552Open in IMG/M
3300018975|Ga0193006_10226297All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium543Open in IMG/M
3300018975|Ga0193006_10236292All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium528Open in IMG/M
3300018975|Ga0193006_10238036All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium526Open in IMG/M
3300018975|Ga0193006_10249641All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium510Open in IMG/M
3300018975|Ga0193006_10250458All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium509Open in IMG/M
3300018977|Ga0193353_10155250All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium683Open in IMG/M
3300018977|Ga0193353_10158583All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium674Open in IMG/M
3300018977|Ga0193353_10170797All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium644Open in IMG/M
3300018977|Ga0193353_10212140All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium562Open in IMG/M
3300018980|Ga0192961_10133958All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium755Open in IMG/M
3300018982|Ga0192947_10158867All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium753Open in IMG/M
3300018982|Ga0192947_10160439All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium749Open in IMG/M
3300018982|Ga0192947_10169837All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium725Open in IMG/M
3300018982|Ga0192947_10186310All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium686Open in IMG/M
3300018982|Ga0192947_10222613All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium615Open in IMG/M
3300018988|Ga0193275_10131083All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium749Open in IMG/M
3300018989|Ga0193030_10129924All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium802Open in IMG/M
3300018989|Ga0193030_10135311All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium788Open in IMG/M
3300018989|Ga0193030_10136899All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium784Open in IMG/M
3300018989|Ga0193030_10138446All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium780Open in IMG/M
3300018989|Ga0193030_10139310All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium778Open in IMG/M
3300018989|Ga0193030_10139712All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium777Open in IMG/M
3300018989|Ga0193030_10140564All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium775Open in IMG/M
3300018989|Ga0193030_10140567All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium775Open in IMG/M
3300018989|Ga0193030_10140971All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium774Open in IMG/M
3300018989|Ga0193030_10143589All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium768Open in IMG/M
3300018989|Ga0193030_10146596All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium761Open in IMG/M
3300018989|Ga0193030_10165124All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium721Open in IMG/M
3300018989|Ga0193030_10172685All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium706Open in IMG/M
3300018989|Ga0193030_10176925All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium698Open in IMG/M
3300018989|Ga0193030_10200531All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium656Open in IMG/M
3300018989|Ga0193030_10203661All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium651Open in IMG/M
3300018989|Ga0193030_10222485All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium621Open in IMG/M
3300018989|Ga0193030_10231560All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium607Open in IMG/M
3300018989|Ga0193030_10235307All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium602Open in IMG/M
3300018989|Ga0193030_10249942All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium581Open in IMG/M
3300018989|Ga0193030_10249948All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium581Open in IMG/M
3300018989|Ga0193030_10294424All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium526Open in IMG/M
3300019001|Ga0193034_10124744All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium609Open in IMG/M
3300019001|Ga0193034_10153438All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium560Open in IMG/M
3300019001|Ga0193034_10187044All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium516Open in IMG/M
3300019001|Ga0193034_10198970All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium503Open in IMG/M
3300019009|Ga0192880_10106803All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium712Open in IMG/M
3300019021|Ga0192982_10220339All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium678Open in IMG/M
3300019027|Ga0192909_10166624All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium633Open in IMG/M
3300019031|Ga0193516_10152561All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium780Open in IMG/M
3300019031|Ga0193516_10167868All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium737Open in IMG/M
3300019031|Ga0193516_10175505All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium717Open in IMG/M
3300019031|Ga0193516_10175912All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium716Open in IMG/M
3300019031|Ga0193516_10179248All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium708Open in IMG/M
3300019031|Ga0193516_10200216All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium662Open in IMG/M
3300019031|Ga0193516_10207228All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium648Open in IMG/M
3300019031|Ga0193516_10306058All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium509Open in IMG/M
3300019032|Ga0192869_10112866All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1070Open in IMG/M
3300019032|Ga0192869_10202161All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium845Open in IMG/M
3300019032|Ga0192869_10286586All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium717Open in IMG/M
3300019032|Ga0192869_10347787All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium647Open in IMG/M
3300019032|Ga0192869_10482412All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium532Open in IMG/M
3300019032|Ga0192869_10483629All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium531Open in IMG/M
3300019033|Ga0193037_10338276All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium531Open in IMG/M
3300019033|Ga0193037_10350587All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium521Open in IMG/M
3300019036|Ga0192945_10157638All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium731Open in IMG/M
3300019036|Ga0192945_10175838All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium690Open in IMG/M
3300019036|Ga0192945_10229573All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium591Open in IMG/M
3300019045|Ga0193336_10227138All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium771Open in IMG/M
3300019045|Ga0193336_10379602All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium650Open in IMG/M
3300019048|Ga0192981_10121701All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1029Open in IMG/M
3300019048|Ga0192981_10131467All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium989Open in IMG/M
3300019048|Ga0192981_10209146All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium759Open in IMG/M
3300019049|Ga0193082_10463298All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium699Open in IMG/M
3300019051|Ga0192826_10330367All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium554Open in IMG/M
3300019051|Ga0192826_10337491All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium547Open in IMG/M
3300019097|Ga0193153_1033677All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium523Open in IMG/M
3300019097|Ga0193153_1036162All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium502Open in IMG/M
3300019116|Ga0193243_1039819All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium650Open in IMG/M
3300019117|Ga0193054_1035551All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium748Open in IMG/M
3300019118|Ga0193157_1019056All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium691Open in IMG/M
3300019118|Ga0193157_1019185All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium689Open in IMG/M
3300019118|Ga0193157_1020426All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium671Open in IMG/M
3300019118|Ga0193157_1022804All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium640Open in IMG/M
3300019118|Ga0193157_1024317All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium623Open in IMG/M
3300019118|Ga0193157_1025147All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium614Open in IMG/M
3300019118|Ga0193157_1025979All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium605Open in IMG/M
3300019118|Ga0193157_1028648All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium579Open in IMG/M
3300019118|Ga0193157_1030197All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium564Open in IMG/M
3300019118|Ga0193157_1032563All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium544Open in IMG/M
3300019118|Ga0193157_1033142All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium539Open in IMG/M
3300019118|Ga0193157_1033406All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium537Open in IMG/M
3300019123|Ga0192980_1031937All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1005Open in IMG/M
3300019125|Ga0193104_1033369All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium714Open in IMG/M
3300019125|Ga0193104_1055410All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium552Open in IMG/M
3300019149|Ga0188870_10102449All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium685Open in IMG/M
3300019149|Ga0188870_10116268All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium631Open in IMG/M
3300021169|Ga0206687_1254544All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium623Open in IMG/M
3300021169|Ga0206687_1433044All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium674Open in IMG/M
3300021169|Ga0206687_1831942All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium638Open in IMG/M
3300021342|Ga0206691_1751153All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium502Open in IMG/M
3300021345|Ga0206688_10446935All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium673Open in IMG/M
3300021345|Ga0206688_10718052All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium557Open in IMG/M
3300021345|Ga0206688_10990401All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium679Open in IMG/M
3300021345|Ga0206688_10991272All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium678Open in IMG/M
3300021348|Ga0206695_1027184All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium687Open in IMG/M
3300021348|Ga0206695_1212400All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium660Open in IMG/M
3300021348|Ga0206695_1569825All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium664Open in IMG/M
3300021348|Ga0206695_1688499All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium516Open in IMG/M
3300021348|Ga0206695_1725842All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium691Open in IMG/M
3300021348|Ga0206695_1731213All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium525Open in IMG/M
3300021350|Ga0206692_1114227All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium912Open in IMG/M
3300021353|Ga0206693_1235774All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium647Open in IMG/M
3300021353|Ga0206693_1847575All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium848Open in IMG/M
3300021353|Ga0206693_1855055All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium699Open in IMG/M
3300021355|Ga0206690_10171062All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium712Open in IMG/M
3300021355|Ga0206690_10173439All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium592Open in IMG/M
3300021355|Ga0206690_10218361All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium707Open in IMG/M
3300021359|Ga0206689_10000420All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium691Open in IMG/M
3300021359|Ga0206689_10196532All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium526Open in IMG/M
3300021359|Ga0206689_10704787All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium715Open in IMG/M
3300021359|Ga0206689_10816304All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium686Open in IMG/M
3300021359|Ga0206689_10959923All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium794Open in IMG/M
3300021866|Ga0063109_101081All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium618Open in IMG/M
3300021868|Ga0063111_117221All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium604Open in IMG/M
3300021872|Ga0063132_101755All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium707Open in IMG/M
3300021872|Ga0063132_120076All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium557Open in IMG/M
3300021883|Ga0063126_1012659All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium531Open in IMG/M
3300021885|Ga0063125_1002752All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium627Open in IMG/M
3300021885|Ga0063125_1015578All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium607Open in IMG/M
3300021889|Ga0063089_1017565All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium659Open in IMG/M
3300021893|Ga0063142_1053969All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium642Open in IMG/M
3300021893|Ga0063142_1068121All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium586Open in IMG/M
3300021897|Ga0063873_1029407All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium621Open in IMG/M
3300021904|Ga0063131_1112877All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium519Open in IMG/M
3300021911|Ga0063106_1131086All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium528Open in IMG/M
3300021912|Ga0063133_1010803All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium657Open in IMG/M
3300021912|Ga0063133_1021705All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium622Open in IMG/M
3300021925|Ga0063096_1001541All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium673Open in IMG/M
3300021928|Ga0063134_1021320All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium684Open in IMG/M
3300021928|Ga0063134_1030433All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium627Open in IMG/M
3300021928|Ga0063134_1134961All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium621Open in IMG/M
3300021932|Ga0063872_1050740All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium518Open in IMG/M
3300021934|Ga0063139_1090597All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium502Open in IMG/M
3300021950|Ga0063101_1025394All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium704Open in IMG/M
3300021957|Ga0222717_10219984All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1117Open in IMG/M
3300022369|Ga0210310_1022337All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium648Open in IMG/M
3300023674|Ga0228697_125412All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium556Open in IMG/M
3300023679|Ga0232113_1022740All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium673Open in IMG/M
3300023693|Ga0232112_1039877All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium525Open in IMG/M
3300023694|Ga0228683_1022206All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium685Open in IMG/M
3300023695|Ga0228680_1034265All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium584Open in IMG/M
3300023696|Ga0228687_1025090All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium691Open in IMG/M
3300023701|Ga0228685_1076846All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium508Open in IMG/M
3300023704|Ga0228684_1054507All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium622Open in IMG/M
3300025138|Ga0209634_1116574All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1148Open in IMG/M
3300025138|Ga0209634_1120876All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1118Open in IMG/M
3300025626|Ga0209716_1134250All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium659Open in IMG/M
3300026182|Ga0208275_1036160All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1012Open in IMG/M
3300026182|Ga0208275_1057051All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium772Open in IMG/M
3300026420|Ga0247581_1073342All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium547Open in IMG/M
3300026443|Ga0247559_1114217All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium553Open in IMG/M
3300026448|Ga0247594_1055693All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium681Open in IMG/M
3300026449|Ga0247593_1087256All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium610Open in IMG/M
3300026461|Ga0247600_1043522All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium872Open in IMG/M
3300026462|Ga0247568_1076810All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium653Open in IMG/M
3300026465|Ga0247588_1079062All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium654Open in IMG/M
3300026465|Ga0247588_1085730All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium628Open in IMG/M
3300026465|Ga0247588_1086034All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium627Open in IMG/M
3300026466|Ga0247598_1172325All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium503Open in IMG/M
3300026468|Ga0247603_1049411All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium847Open in IMG/M
3300026468|Ga0247603_1107003All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium576Open in IMG/M
3300026470|Ga0247599_1086475All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium658Open in IMG/M
3300026470|Ga0247599_1140248All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium503Open in IMG/M
3300026495|Ga0247571_1101825All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium667Open in IMG/M
3300026495|Ga0247571_1132690All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium584Open in IMG/M
3300026500|Ga0247592_1093826All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium725Open in IMG/M
3300026503|Ga0247605_1112656All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium661Open in IMG/M
3300026513|Ga0247590_1122441All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium670Open in IMG/M
3300027833|Ga0209092_10610068All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium544Open in IMG/M
3300027859|Ga0209503_10627466All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium536Open in IMG/M
3300027906|Ga0209404_10247280All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1122Open in IMG/M
3300027906|Ga0209404_10653199All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium706Open in IMG/M
3300028106|Ga0247596_1120330All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium596Open in IMG/M
3300028109|Ga0247582_1136162All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium634Open in IMG/M
3300028110|Ga0247584_1189406All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium501Open in IMG/M
3300028134|Ga0256411_1127199All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium852Open in IMG/M
3300028134|Ga0256411_1187909All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium659Open in IMG/M
3300028134|Ga0256411_1199475All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium634Open in IMG/M
3300028137|Ga0256412_1249095All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium655Open in IMG/M
3300028137|Ga0256412_1249871All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium654Open in IMG/M
3300028282|Ga0256413_1235526All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium652Open in IMG/M
3300028282|Ga0256413_1237492All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium649Open in IMG/M
3300028282|Ga0256413_1249218All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium631Open in IMG/M
3300028282|Ga0256413_1335263All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium530Open in IMG/M
3300028290|Ga0247572_1132910All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium620Open in IMG/M
3300028335|Ga0247566_1057081All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium651Open in IMG/M
3300028335|Ga0247566_1070056All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium589Open in IMG/M
3300028575|Ga0304731_10423005All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium659Open in IMG/M
3300028575|Ga0304731_10513819All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium517Open in IMG/M
3300028575|Ga0304731_11229431All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium615Open in IMG/M
3300028575|Ga0304731_11229925All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium573Open in IMG/M
3300028575|Ga0304731_11494060All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium566Open in IMG/M
3300028575|Ga0304731_11626961All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium612Open in IMG/M
3300030670|Ga0307401_10530778All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium536Open in IMG/M
3300030670|Ga0307401_10590571All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium503Open in IMG/M
3300030699|Ga0307398_10544577All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium641Open in IMG/M
3300030699|Ga0307398_10759302All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium537Open in IMG/M
3300030721|Ga0308133_1035125All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium681Open in IMG/M
3300030721|Ga0308133_1040698All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium628Open in IMG/M
3300030722|Ga0308137_1070633All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium620Open in IMG/M
3300030726|Ga0308126_1036263All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium698Open in IMG/M
3300030780|Ga0073988_10003790All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium655Open in IMG/M
3300030780|Ga0073988_12325537All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium565Open in IMG/M
3300030780|Ga0073988_12350498All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium623Open in IMG/M
3300030780|Ga0073988_12358515All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium653Open in IMG/M
3300030781|Ga0073982_11726194All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium641Open in IMG/M
3300030781|Ga0073982_11747591All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium506Open in IMG/M
3300030856|Ga0073990_12030198All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium590Open in IMG/M
3300030856|Ga0073990_12046257All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium660Open in IMG/M
3300030857|Ga0073981_11635354All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium630Open in IMG/M
3300030857|Ga0073981_11719264All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium548Open in IMG/M
3300030912|Ga0073987_10000411All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium652Open in IMG/M
3300030912|Ga0073987_11219053All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium568Open in IMG/M
3300030912|Ga0073987_11222049All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium504Open in IMG/M
3300030912|Ga0073987_11229662All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium533Open in IMG/M
3300030918|Ga0073985_11000145All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium559Open in IMG/M
3300031004|Ga0073984_11286981All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium566Open in IMG/M
3300031038|Ga0073986_10005993All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium643Open in IMG/M
3300031522|Ga0307388_10383686All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium907Open in IMG/M
3300031542|Ga0308149_1047022All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium543Open in IMG/M
3300031579|Ga0308134_1152321All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium529Open in IMG/M
3300031580|Ga0308132_1059452All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium792Open in IMG/M
3300031580|Ga0308132_1082199All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium663Open in IMG/M
3300031621|Ga0302114_10205741All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium825Open in IMG/M
3300031622|Ga0302126_10246364All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium619Open in IMG/M
3300031660|Ga0307994_1260164All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium525Open in IMG/M
3300031688|Ga0308011_10216442All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium576Open in IMG/M
3300031710|Ga0307386_10409135All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium699Open in IMG/M
3300031710|Ga0307386_10467864All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium656Open in IMG/M
3300031710|Ga0307386_10483112All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium646Open in IMG/M
3300031710|Ga0307386_10538505All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium614Open in IMG/M
3300031710|Ga0307386_10728811All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium532Open in IMG/M
3300031725|Ga0307381_10253518All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium625Open in IMG/M
3300031725|Ga0307381_10308782All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium570Open in IMG/M
3300031734|Ga0307397_10351447All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium675Open in IMG/M
3300031735|Ga0307394_10415446All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium539Open in IMG/M
3300031737|Ga0307387_10292492All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium967Open in IMG/M
3300031737|Ga0307387_10780764All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium603Open in IMG/M
3300031738|Ga0307384_10461006All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium598Open in IMG/M
3300031738|Ga0307384_10599530All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium527Open in IMG/M
3300031739|Ga0307383_10456484All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium633Open in IMG/M
3300031742|Ga0307395_10310355All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium681Open in IMG/M
3300031743|Ga0307382_10407678All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium618Open in IMG/M
3300031750|Ga0307389_10503029All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium777Open in IMG/M
3300032615|Ga0314674_10621484All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium550Open in IMG/M
3300032616|Ga0314671_10518214All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium648Open in IMG/M
3300032666|Ga0314678_10044170All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii1462Open in IMG/M
3300032711|Ga0314681_10699820All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum559Open in IMG/M
3300032752|Ga0314700_10402341All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium728Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine43.16%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine30.53%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater11.05%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater8.68%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.32%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.79%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous0.79%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.53%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.53%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.53%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water0.26%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.26%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.26%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.26%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.26%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine0.26%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.26%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water0.26%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002776Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - MetaT SI072_150m_B (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300005433Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF45BEnvironmentalOpen in IMG/M
3300005516Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49BEnvironmentalOpen in IMG/M
3300005608Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302PF84AEnvironmentalOpen in IMG/M
3300006383Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007513Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300007955Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373B_3.0umEnvironmentalOpen in IMG/M
3300009130Combined Assembly of Gp0139511, Gp0139512EnvironmentalOpen in IMG/M
3300009216Microbial communities of water from the North Atlantic ocean - ACM47EnvironmentalOpen in IMG/M
3300009279Eukaryotic communities of water from the North Atlantic ocean - ACM42EnvironmentalOpen in IMG/M
3300009425Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009544Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M MetagenomeEnvironmentalOpen in IMG/M
3300009550Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 MetagenomeEnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009705Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128EnvironmentalOpen in IMG/M
3300009748Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_210_18m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300009790Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 MetagenomeEnvironmentalOpen in IMG/M
3300010135Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_257_18m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010883western Arctic Ocean co-assemblyEnvironmentalOpen in IMG/M
3300010981Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4)EnvironmentalOpen in IMG/M
3300010985Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 8)EnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300012524Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300012952Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 MetagenomeEnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300012969Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017717Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25EnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300018515Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782216-ERR1712231)EnvironmentalOpen in IMG/M
3300018575Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002191 (ERX1782379-ERR1712162)EnvironmentalOpen in IMG/M
3300018622Metatranscriptome of marine microbial communities from Baltic Sea - GS684_3p0_dTEnvironmentalOpen in IMG/M
3300018628Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001820 (ERX1782125-ERR1711885)EnvironmentalOpen in IMG/M
3300018666Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000398 (ERX1782307-ERR1712184)EnvironmentalOpen in IMG/M
3300018674Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_026 - TARA_E400007200 (ERX1782187-ERR1712006)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018703Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001580 (ERX1782405-ERR1712108)EnvironmentalOpen in IMG/M
3300018725Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782256-ERR1712230)EnvironmentalOpen in IMG/M
3300018726Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000618 (ERX1782150-ERR1711887)EnvironmentalOpen in IMG/M
3300018730Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782285-ERR1712028)EnvironmentalOpen in IMG/M
3300018742Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000534 (ERX1789653-ERR1719224)EnvironmentalOpen in IMG/M
3300018745Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001746 (ERX1782385-ERR1712134)EnvironmentalOpen in IMG/M
3300018747Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000696 (ERX1782435-ERR1712076)EnvironmentalOpen in IMG/M
3300018765Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782330-ERR1712010)EnvironmentalOpen in IMG/M
3300018779Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000698 (ERX1789670-ERR1719303)EnvironmentalOpen in IMG/M
3300018796Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_004 - TARA_X000000410 (ERX1789505-ERR1719432)EnvironmentalOpen in IMG/M
3300018812Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000065 (ERX1789716-ERR1719392)EnvironmentalOpen in IMG/M
3300018855Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002191 (ERX1782341-ERR1711903)EnvironmentalOpen in IMG/M
3300018861Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002482 (ERX1789410-ERR1719398)EnvironmentalOpen in IMG/M
3300018862Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001652 (ERX1789608-ERR1719146)EnvironmentalOpen in IMG/M
3300018871Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001026 (ERX1789475-ERR1719345)EnvironmentalOpen in IMG/M
3300018873Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001098EnvironmentalOpen in IMG/M
3300018913Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782451-ERR1712205)EnvironmentalOpen in IMG/M
3300018928Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001111 (ERX1789573-ERR1719386)EnvironmentalOpen in IMG/M
3300018947Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003102 (ERX1782406-ERR1712029)EnvironmentalOpen in IMG/M
3300018949Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002172 (ERX1782262-ERR1712034)EnvironmentalOpen in IMG/M
3300018967Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000316 (ERX1789557-ERR1719488)EnvironmentalOpen in IMG/M
3300018968Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000713 (ERX1782205-ERR1712096)EnvironmentalOpen in IMG/M
3300018969Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000539 (ERX1782234-ERR1712179)EnvironmentalOpen in IMG/M
3300018974Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782160-ERR1711971)EnvironmentalOpen in IMG/M
3300018975Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002350 (ERX1782140-ERR1711881)EnvironmentalOpen in IMG/M
3300018977Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001816 (ERX1782322-ERR1711977)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018988Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001580 (ERX1782315-ERR1711974)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019001Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001043 (ERX1782383-ERR1712007)EnvironmentalOpen in IMG/M
3300019009Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000756 (ERX1782233-ERR1711966)EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019027Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000678 (ERX1782477-ERR1711924)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019033Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000067 (ERX1782334-ERR1712080)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019049Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000531 (ERX1782179-ERR1712232)EnvironmentalOpen in IMG/M
3300019051Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227)EnvironmentalOpen in IMG/M
3300019097Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000393 (ERX1782443-ERR1712022)EnvironmentalOpen in IMG/M
3300019116Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001491 (ERX1782226-ERR1711967)EnvironmentalOpen in IMG/M
3300019117Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002348 (ERX1782351-ERR1711912)EnvironmentalOpen in IMG/M
3300019118Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000396 (ERX1782223-ERR1711898)EnvironmentalOpen in IMG/M
3300019123Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782390-ERR1712195)EnvironmentalOpen in IMG/M
3300019125Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002761 (ERX1782425-ERR1712222)EnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021342Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021345Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021348Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021353Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021355Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 150m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021359Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021866Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021868Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021872Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021883Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S0 C1 B9 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021885Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-19 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021889Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-3S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021893Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S23 C1 B24 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021897Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 20m ARK-7M ARK-7-2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021904Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C1 B9 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021911Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-132S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021912Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S7 C1 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021925Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-51M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021928Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S9 C1 B7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021932Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean - 30m ANT-15 Euk ARK-20-1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021934Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S18 C1 B14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021950Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-118M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300022369Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Washington, United States ? R1119 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023674Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 90R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023679Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 32R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023693Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 29R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023694Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 31R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023695Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 21R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023696Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 52R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023701Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 47R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023704Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 35R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025626Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes)EnvironmentalOpen in IMG/M
3300026182Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49B (SPAdes)EnvironmentalOpen in IMG/M
3300026420Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 40R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026443Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 4R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026448Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026449Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 56R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026461Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 75R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026462Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 17R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026465Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 48R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026466Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 70R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026468Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 79R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026470Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 73R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026500Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026503Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026513Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 51R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027859Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027906Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028106Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 66R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028109Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 41R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028110Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 43R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028134Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_12 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028290Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028335Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 14R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028575Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030670Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030721Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1117_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030722Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_943_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030726Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1292_32.3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030780Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S19_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030781Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S7_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030856Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S23_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030857Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S5_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030912Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S15_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030918Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S14_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031004Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S12_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031038Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S14_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031522Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031542Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_331_5m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031579Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1120_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031580Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1111_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031621Marine microbial communities from Western Arctic Ocean, Canada - AG5_SurfaceEnvironmentalOpen in IMG/M
3300031622Marine microbial communities from Western Arctic Ocean, Canada - CB4_20mEnvironmentalOpen in IMG/M
3300031660Marine microbial communities from Ellis Fjord, Antarctic Ocean - #261EnvironmentalOpen in IMG/M
3300031688Marine microbial communities from water near the shore, Antarctic Ocean - #177EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031735Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031737Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031742Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031743Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031750Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032615Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032616Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032666Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032711Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032752Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0005234J37281_102436813300002776MarineASELVSQALLMTETGSEAHEHLTSAMLAMNTNVDARSQLVHVPIDEKRDLTLKVSPTYQLDLVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLSATLDHGFPYDD*
Ga0055584_10181864813300004097Pelagic MarineMTSVDSVAHEHLTNALMSMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD*
Ga0066830_1008949913300005433MarineKFVKLALCALGMAEAVHQKSASELVSQALLMTETGSASHEHLTSALAAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD*
Ga0066831_1006672713300005516MarineMTEEGTSTFEHLTNALHADKANSALLEKNSKLVHVPIDEKRDLTLKVSPTYDLDLVNSVTLKSFRKIVGYDTFESIRKKSRNELKDICDYYNVTLSMMIQRRPVEASPPPVRDPYNPEGATTLAVTLDKGFPYDD*I*DANIHTPS*
Ga0066840_1012973213300005608MarineRALLMTEAGSEAHNHLTAAIQAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD*
Ga0075504_141823313300006383AqueousSLVQQALLNVEAGSAAAMHLENAMSAMSSTKFTDAEILAKNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGAATLASTLDKGFPYDD*
Ga0105019_116413613300007513MarineMKFVKLALAAFAVSSTEAIQQKAANELVSQALLMTETGSEAHSHLMSALESMNTNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD*
Ga0105740_109694313300007955Estuary WaterLLMTETGSVAHEHLTNAISALNTNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNTSLAASLDKGFPYDD*
Ga0118729_119682413300009130MarineMTKTGTEAHEHLTSALEAMNANNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD*
Ga0103842_103685713300009216River WaterETGSAAHEHLHSAMMAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD*
Ga0103880_1007643513300009279Surface Ocean WaterVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAATLDRGFPYDE*
Ga0114997_1063405313300009425MarineMKFLTIAFAACVSAVSQKSASELVSQALLMTETGSEAHEHLTSAMLAMNTNVDARSQLVHVPIDEKRDLTLKVSPTYQLDLVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGN
Ga0115008_1029084913300009436MarineMLMTETGSVAHEHLSNALATMGGNTNVDARSQSVHVPIDEKRDLTLKVSPTYQLDLVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD*
Ga0115008_1029717813300009436MarineMTKTGSVAHEHLSNAISALNTNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD*
Ga0115008_1121329213300009436MarineMTDANSQAHAHLSSALANVNPDARSQLVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNTSLA
Ga0115006_1156556113300009544MarineMTKTGSVAHEHLSNAISALNTNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKG
Ga0115013_1052197913300009550MarineMKFVKIALAAFGVAEASQQKSANQLVSQALLMTEVDSAAHEHLSNALMSMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD*
Ga0115011_1035993423300009593MarineMKFVKLALCALGMAEAVHQRSASELVSQALLMTETGSAAHEHLTSAILSMNNNVDARSQVVHVPIDEKKDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAATLDRGFPYDE*
Ga0115011_1109088713300009593MarineMSFSKIVKLALGALVVSEANASQNKEAAQLVSQALLMTETGTESHSQLTSALVALSKNDANSQLVHVPIDEKRDLTLKVSPTYALDVVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTISMMIQRIPVEASPAPPRDPYNPEGAPSLAATLDKGFPYDD*
Ga0115103_128057013300009599MarineMTETGSVAHEHLTNALSAMNNNVDARSQVVHVPIDEKRDLSLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPEGNPSLSTTLDKGFPYDD*
Ga0115104_1054344913300009677MarineINMKFVQLALCAIGAAEASQSGSANELVSRALLMTETGSEAHSHLTNALNAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD*
Ga0115104_1061000613300009677MarineQALLMTETGSAAHEHLTAAMQALNTNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPSKDPYNPDGNPSLAASLDKGFPYDD*
Ga0115104_1072237713300009677MarineINMKFVQLALATLGVAEATNQRSANHLVSQALLMTETGSVAHEHLTNALSAMGGNVDARSQVVHVPIDEKRDLTLKVSPTYNLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD*
Ga0115104_1104355113300009677MarineMLMTESGSQAHAHLSQALANVNPDARSQLVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD*
Ga0115104_1128434213300009677MarineEAGSAAHEHLTQAIHAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD*
Ga0115105_1012570823300009679MarineMLSETMANKNAAKLVQRALSMTETGTETHAHLSSALSALTMNDHSQLVHVPIDEKRDLTLKVSPTYALDIVNSVTLKSFRKIVGYDTFESIRKKNRNETKDISDYYNVTVSMMIQRKPIEASPAPARDPYNPEGAPNLAATLDKGFPYDD*
Ga0115105_1085898613300009679MarineNASQSAMQSVISAYNMAEAGTELHSHLGAALDAMGVAKGADARSQTVSVPIDEKRALTVKVSPTYALDDINSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEVASAPARDPYNPDGAAALASTLDKGFPYDD*
Ga0115105_1095986513300009679MarineKFVKIALAALATAEATKQKSATDLVSQALLMTKSGSAVHEHLTNAMESLNTNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD*
Ga0115105_1123790013300009679MarineMTETGTAAHAHLSNALGSLGGNADARSQLVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFDSIRRKDRNETKDTSDYYNVTVSMMIRRRPAEAAAAPARDPYAPDGAPSLAATLDKGFPYDD*
Ga0115105_1131827413300009679MarineAALAIASAEASKSAVHLVQKALLMAETGTETHEHLTNALNALNADARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIQRKPVEAASAPAKDPYNPDGNPSLAASLDKGFPYDD*
Ga0115000_1024668413300009705MarineMKFLTIAFAACVSAVSQKSASELVSQALLMTETGSEAHEHLTSAMLAMNTNVDARSQLVHVPIDEKRDLTLKVSPTYQLDLVNSVTLKSFRKIDGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLSATLDHGFPYDD*
Ga0123370_104566113300009748MarineLLMTNVDSVAHQHLTQALSSMGGNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD*
Ga0115001_1027928413300009785MarineMTDANSQAHAHLTSALANVNPDARSQLVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNTSLAASLDKGFPYDD*
Ga0115012_1159345813300009790MarineMTKVDSAAHEHLSNALMAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPD
Ga0123382_105023213300010135MarineNMKFVQIALAALGMASAAEQKSANQLVSQALLMTSVDSAAHEHLTNALQSMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD*
Ga0133547_1199397813300010883MarineMTDANSQAHAHLQSALANVNPDARSQLVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNTSLAASLDKGFPYDD*
Ga0133547_1200006823300010883MarineMKFVKLALAAFAMSATEAAEQKSASELVSQALLMTQTGTEAHTSLTAAIKVLNVNPDARSQVVHVPIDEKRDLTLKISPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD*
Ga0138316_1003219823300010981MarineMTEAGSDVHQHLTSAIASMGASTVEARSQIVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD*
Ga0138316_1018481013300010981MarineINKNMKFVKLVLASLAMADATTQKSAASLVEKALLMTESGTEAHAHLNSALETMKGNDVEARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAQSLDKGFPYDD*
Ga0138316_1048569113300010981MarineALASVNAAEQKSASELVSQALLMTKEGTAVHEHLTNAVAALNTGVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKEISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD*
Ga0138316_1054421113300010981MarineLMTEVDTAAHEHLHNALMAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD*
Ga0138316_1122241213300010981MarineMSFSKIVKLALGALVVSEVDASQNKEASQLISQALLMTETGTETHAQLTSALSALDANSQLVHVPIDEKRDLTLKVSPTYALDVVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIQRKPVEASPAPPRDPYNPEGAPSLAATLDKGFPYDD*
Ga0138316_1152031713300010981MarineMTKSGSSVHEHLTNAMASLNTNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD*
Ga0138326_1045083813300010985MarineQIALAALASVNAAEQKSASELVSQALLMTKEGTAVHEHLTNAVAALNTGVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKEISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD*
Ga0138324_1044712223300010987MarineMLMTEVGSEAHAHLSSALANVNPDARSQLVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASL
Ga0138324_1045228213300010987MarineNINMKFVKIALCALGAVSASQQKSASELVSQALLMTETDSAAYNHLSSAMMAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD*
Ga0138324_1046134713300010987MarineINMKFYSFLCALGLAGATQNKEASNLVSQALLMTETGTSTHEHLTNALNALSKNDANSQLVHVPIDEKRDLTLKVSPTYALDVVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIQRKPVEASPAPPRDPYNPEGSPNLAATLDKGFPYDD*
Ga0138324_1046752813300010987MarineMLALGLVCQAEATQNKAASELVQKALLMTESGTQTHSHLNSALEALSRNDANSQLVHVPIDEKRDLTLKVSPTYALDIVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIQRKPVEASPAPPRDPYNPEGAASLAATLDKGFPYDD*
Ga0138324_1070547213300010987MarineMTKVDSAAHEHLTNALYAMGNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD*
Ga0129331_105044113300012524AqueousMLMTEAGSEAHAHLSSALANVNPDARSQLVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNTSLAASLDKGFPYDD*
Ga0160423_1028684223300012920Surface SeawaterMKFVQLALAALGVAEATNQKSANHLVSQALLMTETGSAAHEHLTAAMHAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD*
Ga0163180_1063725713300012952SeawaterMKFVKLALCALGAAEATQQKSANQLVSQALLMTEVDSAAHEHLTNALMSMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD*
Ga0163180_1070690923300012952SeawaterMKFVKLALAAFAMSSTEAAQQKSATELVSQALLMTETGTEAHSQLSSALNIMNTNVDARSQIVHVPIDEKRDLSLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD*
Ga0163179_1037734213300012953SeawaterMTESGTQTHSHLNSALEALSRNDANSQLVHVPIDEKRDLTLKVSPTYALDIVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIQRKPVEASPAPPRDPYNPEGAPSLAATLDKGFPYDD*
Ga0163179_1041875513300012953SeawaterMAEAAHQKSANELVSQALLMTETGSAAHEHLTSAMFAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD*
Ga0163179_1113230113300012953SeawaterMTETGSEAHEHLTNALGSLNANNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD*
Ga0163179_1138695223300012953SeawaterMKFVKLALAALAMSSVEASALEAFNTNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD*
Ga0163179_1204018713300012953SeawaterAQQALSMTEAGSEAHLHLTNAINAMNANVDARSQLVHVPIDEKRDLTLKVQPTYNLDIVNSVTLKSFRKIVGYDTFDSIRKKNRNESKDISDYYNVTVSMMVQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD*
Ga0129332_100922923300012969AqueousMTEAGSEAHAHLSSALANVNPDARSQLVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNTSLAASLDKGFPYDD*
Ga0181404_116895013300017717SeawaterAEAVHQKSASELVSQALLMTETGSAAHEHLTNAIMSMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0181379_133105513300017783SeawaterGAAEASQQKSANQLVSQALLMTNVDSAAHEHLSNALMAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0192960_10602913300018515MarineMTETGSVAHEHLTNALSAMNNNVDARSQVVHVPIDEKRDLSLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPEGNPSLATTLDKGFPYDD
Ga0193474_101031913300018575MarineMKFVKLALCALGMAEAVHQKSASELVSQALLMTETGSAAHEHLTNAIMSMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193474_101081713300018575MarineMKFYSFLCALGLAGATQNKEAAGLVSQALLMTETGSSTHAHLTNALGALNRDLEANSQLVHVPIDEKRDLTLKVSPTYALDIVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIQRKPVEASPAPPRDPYNPEGSPSLAATLDKGFPYDD
Ga0193474_101352213300018575MarineMKFYSFLCALGLAGATQNKEAAGLVSQALLMTETGSSTHAHLTNALGALNRDLEANSQLVHVPIDEKRDLTLKVSPTYALDIVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIQRKPVEASPAPPRDPYNPEGSPNLAATLDKGFPYDD
Ga0188862_101621623300018622Freshwater LakeMTSVDSVAHEHLTNALKSMGGNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193355_101051613300018628MarineIASMGANTVEARSQIVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193159_102879313300018666MarineMGIINILFININMKFVKLALCALGAAEATQQKSANQLVSQALLMTEVDSAAHEHLTNALMSMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193166_102309813300018674MarineLTNALHSLNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNASLASTLDRGFPYD
Ga0192944_103547613300018692MarineMGIINILFININMKFVKLALCALGAAEASQQKSANQLVSQALLMTKVDSVAHEHLSNALMAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193274_102911313300018703MarineQLTSALESMNTDVDKRSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193517_105555513300018725MarineMTKAGTEAHAHLVSAIESMNTNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193517_105844513300018725MarineLAGATQNKEAATLVQQALLMSETGSATHAHLTNALSDLDANSQLVHVPIDEKRDLTLKVSPTYALDIVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIQRKPVEASPAPPRDPYNPEGSPSLAATLDKGFPYDD
Ga0193517_106094813300018725MarineMTKTGTEAHEHLSNAIEAMNANNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0194246_106024613300018726MarineMTKSGSAVHEHLTNAMESLNTNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0192967_104711213300018730MarineHGKIYYFNNINMKFVKLALCALGAAEASQQKSANQLVSQALLMTKVDSVAHEHLSNALMAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193138_103633313300018742MarineLCALGLAGATQNQEAAGLVQQALLMSETGSATHAHLTNAMHALSKDLDANSQLVHVPIDEKRDLTLKVSPTYALDIVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIQRKPVEASPAPPRDPYNPEGSPSLAATLDKGFPYDD
Ga0193138_103693613300018742MarineMLMTETGSEAHAHLSQALANVNPDARSQLVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193138_103733913300018742MarineINMKFVQIALCALGFAEASKTGSANELVSRALLMTESGSEAHEHLTNALHSLNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193138_103801913300018742MarineMTEVDTAAHEHLTNALHAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193138_104731113300018742MarineMKFVKLALAALVSSADAMQQKSASELVSQALLMTEAGSDVHQHLTSAIASMGASTVEARSQIVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193138_105946813300018742MarineNNNVDARSQVVHVPIDENRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193000_104258913300018745MarineAVNQRSASELVSQALLMTETGSAAHEHLTSAMLAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193147_106855713300018747MarineKSANELVSQALLMTEAGSEVHTHLTSAIASMGANTVEARSQIVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193147_108105613300018747MarineEVDSAAHEHLTNALMSMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193031_104415613300018765MarineMSFSKIVKLALGALVVSEANASQNKEAAQLVSQALLMTETGTESHSQLTSALVALSKNDANSQLVHVPIDEKRDLTLKVSPTYALDVVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTISMMIQRKPVEASPAPPRDPYNPEGAPSLAATLDKGFPYDD
Ga0193031_105246813300018765MarineMTKSGTEAHEHLTNAVAALNTGVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193031_105262513300018765MarineQSANSLVSQALLMTETGSAAHEHLTAAMQAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNASLAASLDKGFPYDD
Ga0193031_105825713300018765MarineLLTEAGTEAHAHLTQALQSLGVSGVDARSQVVHVPIDEKRDLTLKVSPTYNLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193031_105864213300018765MarineMSETGSATHAHLTNALKDLDANSQLVHVPIDEKRDLTLKVSPTYALDIVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIQRKPVEASPAPPRDPYNPEGSPSLAATLDKGFPYDD
Ga0193031_105930813300018765MarineMTETGSEAHEHLTNALHSLNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAATLDRGFPYDD
Ga0193031_106475223300018765MarineMMMAEEGTQTYGHLANALKALTQGDRSQLVHVPIDEKRDLTLKVSPTYALDVVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIQRKPIEASPAPARDPYNPEGASKLADTLDKGFPYDD
Ga0193031_107082013300018765MarineQSANSLVSQALLMTETGSAAHEHLTAAMQAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193031_107200413300018765MarineELVSQALLMTETGTEAHSQLSSALNIMNTNVDARSQIVHVPIDEKRDLSLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193149_103548113300018779MarineKFVKLALAALVSSADAMQQKSASELVSQALLMTEAGSDVHQHLTSAIASMGASTVEARSQIVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193149_103617713300018779MarineKFVKLALASLATAEAAQQRSATELVSKALLMTESGSEAHEHLTSALASLNTNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193149_103664813300018779MarineAAFAMSSTEAVQQKSTSELVSRALLLTEAGTEAHAHLTQALQSLGASGVDARSQVVHVPIDEKRDLTLKVSPTYNLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193149_104121423300018779MarineMTKVGSEAHEHLSNAVVALNANNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193149_104216613300018779MarineIALAALASANATEQKSASELVSQALLMTKEGTQVHEHLTNAVAALNTGADARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193149_104862913300018779MarineKFVKLALAALMSVEAVEQKSANELVSQALLMTEAGSEVHTHLTSAIASMGANTVEARSQIVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193149_105454813300018779MarineTFGALMLSETMANKNAAKLVQRALSMTETGTETHAHLSSALSALTMSDHSQLVHVPIDEKRDLTLKVSPTYALDIVNSVTLKSFRKIVGYDTFESIRKKNRNETKDISDYYNVTVSMMIQRKPIEASPAPARDPYNPEGAPNLAATLDKGFPYDD
Ga0193149_105666313300018779MarineEAHAHLSQALANVNPDARSQLVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193117_105418013300018796MarineVLASLAMADATTQKSAASLVEKALLMTESGTEAHAHLNSALETMKGNDVEARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAQSLDKGFPYDD
Ga0192829_108041613300018812MarineFVKLALAALVSSADAMQQKSASELVSQALLMTEAGSDVHQHLTSAIASMGASTVEARSQIVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193475_104006313300018855MarineMKFYSFLCALGLAGATQNKEAAGLVSQALLMTETGSSTHAHLTNALGALNRDLEANSQLVHVPIDEKRDLTLKVSPTYALDVVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIQRKPVEASPAPPRDPYNPEGAPSLAATLDKGFPYDD
Ga0193072_107108913300018861MarineNMKFVKLALAALVSSADAMQQKSASELVSQALLMTEAGSDVHQHLTSAIASMGASTVEARSQIVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193308_105964813300018862MarineKLALAALAISSVEASALEAYNTNADARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193308_107518313300018862MarineELVSRALLMTETGSEAHEHLTNALHAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193308_107709313300018862MarineDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0192978_103363013300018871MarineNMKFVNLALAAIAMSATEAAEQKSATELVTQALLMTDSGSNAHTHLSSALGAMGGTVEARSQQVHVPIDEKRDLTLKISPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTISMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0192978_108106913300018871MarineAELISAAMLMTDANSQAHAHLSSALANVNPDARSQLVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNTSLAASLDKGFPYDD
Ga0193553_110042213300018873MarineMTETGSEVHQHLTSAIASMGANTVEARSQIVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0192868_1008036913300018913MarineEHLTNALHSLNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0192868_1008214713300018913MarineEHLTNALHSLNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPANDPYNPDGNPSLAASLDKGFPYDD
Ga0193260_1011419413300018928MarineALAMTEEGTYTHGHLTSALHALAMADHSQLVHVPIDEKRDLTLKVSPTYSLDIVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIQRKPVEAAPAPARDPYNPEGAPNLASTLDKGFPYDD
Ga0193066_1022943413300018947MarineVMTEVGSAAHEHLTSAMMAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPARDPYNPDGNPSLAASLDKGFPYDD
Ga0193010_1008241213300018949MarineMLMTDSSSQAYQHLSNAMSAMNVNPDARSQLVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRNKSRSESKDISDYYNVTVSMMIQRKPVEAAAAPARDPYNPDGNPSLAASLDKGFPYDD
Ga0193178_1004709513300018967MarineQQKSANQLVSQALLMTEVDSAAHEHLQNALMSMQTNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0192894_1025346223300018968MarineRSAQQLAQKALAMTTAGSYEHMHLTNAIAALGSSADARAQLVHVPIDEKRDLTLKVSPTYSLDIVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMVQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193143_1018858413300018969MarineTETGSAAHEHLTNAMMALNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0192873_1040054713300018974MarineMTKAGTEAHAHLVSAIESMNTNVDARSQVFHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNKREQDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0192873_1042139913300018974MarineHGDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193006_1020879413300018975MarineQRALAMTEEGTYTHGHLTSALHALAMADHSQLVHVPIDEKRDLTLKVSPTYSLDIVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIQRKPVEAAPAPARDPYNPEGAPNLASTLDKGFPYDD
Ga0193006_1022027313300018975MarineALLMTETGSEAHEHLTNAIASMGANTVEARSQIVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIQRKPVEASPAPPRDPYNPEGAPNLAATLDKGFPYDD
Ga0193006_1022629713300018975MarineGSEVHSHLTSALQSMNTNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMVQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193006_1023629213300018975MarineMTETGTETHAQLTSALSALDANSQLVHVPIDEKRDLTLKVSPTYALDIVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIQRKPVEASPAPPRDPYNPEGAPNLAATLDKGFPYDD
Ga0193006_1023803613300018975MarineMTEEGTQTHQHLSNALGSLADNLDKHSQLVHVPIDEKRDLTLKVSPTYALDIVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDISDYYNVTVSMMIQRKPVEAAPAPARDPYNPEGAPSLAATLDKGFPYDD
Ga0193006_1024964113300018975MarineSSILQQALSMTEAGTETHSHLTNAIHALDGALDKNSQLVHVPIDEKRDLTLKVSPTYALDVVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDISDYYNVTVSMMIQRKPVEASPAPQRDPYNPEGAPTLAATLDKGFPYDD
Ga0193006_1025045813300018975MarineNANNVDARSQVVHVPIDEKRDLTLKVSPTYNLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193353_1015525013300018977MarineMTKTGTEAHEHLSAAMESLNANNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193353_1015858313300018977MarineETSAIQNKEAANLVSQALLMTETGTETHAHLTSALDALSKNDANSQLVHVPIDEKRDLTLKVSPTYALDIVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIQRKPVEASPAPPRDPYNPEGSPSLAATLDKGFPYDD
Ga0193353_1017079713300018977MarineNAAKLVQKALAMTETGTETHGHLTSALNALTMADHSQLVHVPIDEKRDLTLKVSPTYALDIVNSVTLKSFRKIVGYDTFESIRKKNRNEAKDISDYYNVTVSMMIQRKPIEASPAPARDPYNPEGAPNLAATLDKGFPYDD
Ga0193353_1021214013300018977MarineETSAIQNKEAANLVSQALLMTETGTETHAHLTSALDALSKNDANSQLVHVPIDEKRDLTLKVSPTYALDIVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIQRKPVEASPAPPRDPYNPEGSPSLAATLDKGFPYDDSPN
Ga0192961_1013395813300018980MarineMLMTDANSQAHAHLSSALANVNPDARSQLVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNTSLAASLDKGFPYDD
Ga0192947_1015886713300018982MarineMKFVKLALCALGAAEASQQKSANQLVSQALLMTKVDSVAHEHLSNALMAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0192947_1016043913300018982MarineMGIIIKNILFININMKFVTLALCALGYTEASQQRNANALVSQALLMTETGSVAHEHLTAAMQALNTNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPSKDPYNPDGNPSLAASLDKGFPYDD
Ga0192947_1016983713300018982MarineMTETGSIAHEHLTNALSAMNNNVDARSQVVHVPIDEKRDLSLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0192947_1018631013300018982MarineHGAIASTEAAHQQSANELVQKALSMTESGSAVHQHLSNAVVALNTNVDARSQIVHVPIDEKRDLSLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0192947_1022261313300018982MarineMSGLEAGSEAHAHLSSALEAFGKTTDPNDAHSQLVTVPIDEKRALTLKVTPTYNLDLVNSVTLKAFRKIVGYDTFDSIRRKERNEAKDISDYYNVTVSMMVQRKPLDLAARPLQMDPYSPTGAPTLAATLDHGFPYDD
Ga0193275_1013108313300018988MarineMNTDVDKRSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193030_1012992413300018989MarineMKFVKLALAAFAMSSTEAAQQKSATDLVSQALLMTETGTEAHSQLTSALSIMNTNVDARSQVVHVPIDEKRDLSLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193030_1013531113300018989MarineHGEYINKINKNMKFVKLALAAFAMSSTEAVQQKSTSELVSRALLLTEAGTEAHAHLTQALQSLGASGVDARSQVVHVPIDEKRDLTLKVSPTYNLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193030_1013689913300018989MarineMTETGSAAHEHLTAAMQALNTNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNASLAASLDKGFPYDD
Ga0193030_1013844613300018989MarineMKFVTVALAALFSSADAIQQKSASELVSQALLMTETGSEAHTHLSNALTSMNTNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193030_1013931013300018989MarineMTKSGSAVHEHLTNAMASLNTNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193030_1013971223300018989MarineMTETGSAAHEHLTAAMQAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193030_1014056413300018989MarineMKFVTVALAALFSSADAIQQKSASELVSQALLMTETGSEAHTHLSNALTSMNTNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAATLDRGFPYDD
Ga0193030_1014056713300018989MarineMGIININFINNNMKFVKIALCALGMASATEQKSANQLVSQALLMTSVDSAAHEHLTNALNSMNTNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193030_1014097113300018989MarineMGIININFINNNMKFVKIALCALGMASATEQKSANQLVSQALLMTSVDSAAHEHLTNALNSMNTNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPSKDPYNPDGNPSLAASLDKGFPYDD
Ga0193030_1014358923300018989MarineMTETGSEVHSHLTSALESMNVNADARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193030_1014659613300018989MarineMGNYIFYKMKFVTFALAALTADAAMQKSATELVSQALLMTETGSQAHTQLSSALESMNSNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193030_1016512413300018989MarineMTESGTQTHSHLNSALEALSRNDANSQLVHVPIDEKRDLTLKVSPTYALDIVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIQRKPVEASPAPPRDPYNPEGAPSLAATLDKGFPYDD
Ga0193030_1017268513300018989MarineMSETGSSTHAHLSNALSALNKDLDANSQLVHVPIDEKRDLTLKVSPTYALDVVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIQRKPVEASPAPPRDPYNPEGSPSLAATLDKGFPYDD
Ga0193030_1017692513300018989MarineMKFAQIALAALASVNAAEQKSASELVSQALLMTKEGSAVHEHLTNAVAALNTGVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193030_1020053113300018989MarineMGASTNDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193030_1020366113300018989MarineMTESGTQTHSHLNSALEALSRNDANSQLVHVPIDEKRDLTLKVSPTYALDIVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIQRKPVEASPAPPRDPYNPEGSPSLAATLDKGFPYDD
Ga0193030_1022248513300018989MarineMSEEGSSVHMHLTNALKTVDARSQLVHVPIDEKRDLTLKVSPTHDLDIVNSVTLKSFRKIVGYDTFESIRKKGRNESKDTSDYYNVTVSMMIQRTPVEASPPPLRDPYNPEGAASLAATLDKGFPYDD
Ga0193030_1023156013300018989MarineALLMAETGTETHEHLTNALNALNADARSQVVHVPIDEKRDLTLKVAPTYNLDIVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIQRKPVEAASAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193030_1023530713300018989MarineALMCSEAAASQSAQSLVQRALAMTEEGTYTHGHLTSALHALAMADHSQLVHVPIDEKRDLTLKVSPTYSLDIVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIQRKPVEAAPAPARDPYNPEGAPNLASTLDKGFPYDD
Ga0193030_1024994213300018989MarineDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193030_1024994813300018989MarineSTHAHLTNALGALNRDVEANSQLVHVPIDEKRDLTLKVSPTYALDIVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIQRKPVEASPAPPRDPYNPEGSPNLAATLDKGFPYDD
Ga0193030_1029442413300018989MarineSTHAHLTNALGALNRDVEANSQLVHVPIDEKRDLTLKVSPTYALDIVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIQRKPVEASPAPPRDPYNPEGSPSLAATLDKGFPYDDSPN
Ga0193034_1012474413300019001MarineLVQKALLMTESGTQTHSHLNSALEALSRNDANSQLVHVPIDEKRDLTLKVSPTYALDIVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIQRKPVEASPAPPRDPYNPEGAPSLAATLDKGFPYDD
Ga0193034_1015343813300019001MarineNAAKLVQRALSMTETGTETHAHLSSALSALTMSDHSQLVHVPIDEKRDLTLKVSPTYALDIVNSVTLKSFRKIVGYDTFESIRKKNRNETKDISDYYNVTVSMMIQRKPIEASPAPARDPYNPEGAPNLAATLDKGFPYDD
Ga0193034_1018704413300019001MarineNALHSMNVNAEARSQLVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRNKSRSESKDISDYYNVTVSMMIQRKPVEAAAAPARDPYNPDGNPSLAASLDKGFPYDD
Ga0193034_1019897013300019001MarineLLMTETGSAAHEHLTSAILSMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0192880_1010680313300019009MarineMTETGSVAHEHLTNALSAMNNNVDARSQVVHVPIDEKRDLSLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPEGNPSLSATLDHGFPYDD
Ga0192982_1022033913300019021MarineEQKSATELVTQALLMTDSGSNAHTHLSSALGAMGGTVEARSQQVHVPIDEKRDLTLKISPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTISMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0192909_1016662413300019027MarineLMTETGSATHEHLTNALNALSKNDANSQLVHVPIDEKRDLTLKVSPTYALDVVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIQRKPVEASPAPPRDPYNPEGSPNLAATFDKGFPYDD
Ga0193516_1015256113300019031MarineMAALNTGADARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193516_1016786813300019031MarineMGMALKAMSRVRAMNTNVDARSQVVHVPIDEKRDLTLKVSPTYQLDLVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193516_1017550513300019031MarineMKFYSFLCALGLAGATQNKEAAGLVSQALLMTETGSSTHAHLTNALGALNRDLEANSQLVHVPIDEKRDLTLKVSPTYALDIVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIQRKPVEASPAPPRDPYNPEGAPSLAATLDKGFPYDD
Ga0193516_1017591213300019031MarineMTETGTSTHEHLTSALNALSKNDANSQLVHVPIDEKRDLTLKVSPTYALDIVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIQRKPVEASPAPPRDPYNPEGSPSLAATLDKGFPYDD
Ga0193516_1017924813300019031MarineMKFYSFLCALGLAGATQNKEAATLVQQALLMSETGSATHAHLTNALSDLDANSQLVHVPIDEKRDLTLKVSPTYALDIVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIQRKPVEASPAPPRDPYNPEGAPSLAATLDKGFPYDD
Ga0193516_1020021613300019031MarineSASELVSQALLMTETGSAAHEHLTNAIMSMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193516_1020722813300019031MarineMTETGTSTHEHLTSALNALSKNDANSQLVHVPIDEKRDLTLKVSPTYALDIVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIQRKPVEASPAPPRDPYNPEGSPNLAATLDKGFPYDD
Ga0193516_1030605813300019031MarineAHEHLTSAILSMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0192869_1011286613300019032MarineMTETGSEAHEHLTNALHSLNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0192869_1020216113300019032MarineSQALLMTKEGTAVHEHLTNAVAALNTGVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYGTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0192869_1028658613300019032MarineMGTIIYFINNNMKFVKLALCALGMAEAVHQKSASELVSQALLMTETGSAAHEHLTSAIHAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0192869_1034778713300019032MarineAFGVAEATQQRAASNLVSQAMLMTETGTAAHEHLSAALAAMGGNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVRYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0192869_1048241213300019032MarineAHTHLKSALHSMSTNVNPDARSQQVHVPIDEKRDLTLKIFPTYQLDIVNSVTLKSFRKIVGYDTFESIRNKSRSESKDISDYYNVTVSMMIQRKPVEAAAAPARDPYNPDGNPSLAASLDKGFPYDD
Ga0192869_1048362913300019032MarineHGTHLKSALHSMSTNVNPDARSQQVHVPIDENRDLTLKISPTYQLDIVNSVTLKSFRKIVGYDTFESIRNKSRSESKDISDYYNVTVSMMIQRKPVEAAAAPARDPYNPDGNPSLAASLDKGFPYDD
Ga0193037_1033827613300019033MarineMGASAEASKSAINLVQKALLMAESGTETHAHLTNALDALNADARSQVVHVPIDEKRDLTLKVSPTYNLDIVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDE
Ga0193037_1035058713300019033MarineHEHLSNALQSLNTNADARSQLVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTISMMVQRKPVEAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0192945_1015763813300019036MarineRRVHGENILFININMKFVKLALCALGAAEASQQKSANQLVSQALLMTKVDSVAHEHLSNALMAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0192945_1017583823300019036MarineMTETGSVAHEHLTAAMQALNTNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPSKDPYNPDGNPSLAASLDKGFPYDD
Ga0192945_1022957313300019036MarineTESGSAVHQHLSNAVVALNTNVDARSQIVHVPIDEKRDLSLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193336_1022713813300019045MarineLVSQALLMTEAGSDVHQHLTSAITSMGASTVEARSQIVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193336_1037960213300019045MarineMNALNTNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESISRKNRSESKDISDYYNVTVSMMVQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0192981_1012170113300019048MarineMTKVGTEAHSHLSMAISSLNTNVDARSQNVHVPIDEKRDLTLKISPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0192981_1013146713300019048MarineMGLAAIAMSATEAAEQKSATELVTQALLMTDSGSNAHTHLSSALGAMGGTVEARSQQVHVPIDEKRDLTLKISPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTISMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0192981_1020914613300019048MarineMALQAMSHIRTMNGNVDARSQQVHVPIDEKRDLTLKVSPTYQLDLVNSVTLKSFRKIVGYDTFESIRKKNRGESKDIADYYNVTISMMIQRKPVEAAAAPAKDPYNPDGNPSLSQSLDKGFPYDD
Ga0193082_1046329813300019049MarineMTKVDSAAHEHLSAALQAMGNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0192826_1033036713300019051MarineLVSQALLMTNVDSAAHEHLTGALRAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0192826_1033749113300019051MarineSQALLMTNVDSAAHEHLSNALMAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193153_103367713300019097MarineTGSATHAHLTNAMHALSKDLDANSQLVHVPIDEKRDLTLKVSPTYALDIVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIQRKPVEASPAPPRDPYNPEGSPSLAATLDKGFPYDD
Ga0193153_103616213300019097MarineAEAVQQRSASELVSQALLMTETGSAAHEHLTSAMLAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNASLASTLDRGFPYDE
Ga0193243_103981913300019116MarineHQKSASELVSQALLMTETGSESHEHLHSALMAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNASLASTLDRGFPYDE
Ga0193054_103555113300019117MarineTWGIKNILFINIKMKFVKIALCALGMAEAVHQKSASELVSQALLMTETGSASHEHLTSALAAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193157_101905613300019118MarineTWEYINKINKNMKFVKLALAAFAMSSTEAVQQKSTSELVSRALLLTEAGTEAHAHLTQALQSLGASGVDARSQVVHVPIDEKRDLTLKVSPTYNLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193157_101918513300019118MarineMTETGTQTHAHLSNALTALTQNDANSQLVHVPIDEKRDLTLKVSPTYALDVVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIQRKPVEASPAPPRDPYNPEGSPSLAATLDKGFPYDD
Ga0193157_102042613300019118MarineMGNYIFYKMKFVTLALAALTANAAQQKSASELVSQALLMTETGSKAHTELSTALETMNSNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193157_102280413300019118MarineMLSETMANKNAAKLVQRALSMTETGTETHAHLSSALSALTMSDHSQLVHVPIDEKRDLTLKVSPTYALDIVNSVTLKSFRKIVGYDTFESIRKKNRNETKDISDYYNVTVSMMIQRKPIEASPAPARDPYNPEGAPNLAATLDKGFPYDD
Ga0193157_102431713300019118MarineMTETGTAAHEHLTNALTSFNTNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193157_102514713300019118MarineEAAQQKSATELVSRALLMTETGSEAHEHLTNALGSLNANNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193157_102597913300019118MarineQAMASMGANTVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193157_102864813300019118MarineKIAQKALSQTNAGSEAHLHLTNAINAMNANVDARSQVVHVPIDEKRDLTLKVQPTYNLDIVNSVTLKSFRKIVGYDTFDSIRKKNRNESKDISDYYNVTVSMMVQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193157_103019713300019118MarineSEANATQNKEAAQLVSQALLMTETGTQTHAHLSNALTALTQNDANSQLVHVPIDEKRDLTLKVSPTYALDIVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTISMMIQRKPVEASPAPPRDPYNPEGSPSLAATLDKGFPYDD
Ga0193157_103256313300019118MarineTEAHEHLTAAMQSLGANNADARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193157_103314213300019118MarineHLTNALTSFGGNADARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193157_103340613300019118MarineSEANATQNKEAAQLVSQALLMTETGTQTHAHLSNALTALTQNDANSQLVHVPIDEKRDLTLKVSPTYALDIVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIQRKPVEASPAPPRDPYNPEGSPSLAATLDKGFPYDD
Ga0192980_103193713300019123MarineMKFVNLALAAIAMSATEAAEQKSATELVTQALLMTDSGSNAHTHLSSALGAMGGTVEARSQQVHVPIDEKRDLTLKISPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTISMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193104_103336913300019125MarineMGASTVEARSQIVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0193104_105541013300019125MarineTGSQAHTQLSSALESMNSNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0188870_1010244913300019149Freshwater LakeMLMTEAGSEAHAHLSSALANVNPDARSQLVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNTSLAASLDKGFPYDD
Ga0188870_1011626813300019149Freshwater LakeMVMTEVGSEAHAHLASALANVNPDARSQLVHVPIDEKRDLTLKVSPTYQLDFVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNTSLAASLDKGFPYDD
Ga0206687_125454413300021169SeawaterINMKFVALALAAFGVAEASQQRSANHLVSQALLMTETGSETHQHLTNALAAMGGNADARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0206687_143304413300021169SeawaterMTETGSEVHQHLTSAIASMGANTVEARSQIVHAPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0206687_183194223300021169SeawaterMLMTEAGSEAHAHLSSALANVNPDARSQMVHVPIDEKRDLTLKFSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNTSLAASLDKGFPYDD
Ga0206691_175115313300021342SeawaterNALQSMNTNVDARSSVVHVPSDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMVQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0206688_1044693513300021345SeawaterLALAAIALSFTEASRSASKLAQQALAMTEVGSTNHLHLTNAIEALNNANTAARSQFVHVPIDEKRDLTLNVQPTYSLDIVNSVTLKSFRKIVGYDTFESIRKKNRAESKDISDYYNVTISCMVQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0206688_1071805213300021345SeawaterMSEAGSEVHSHLTNALSVMNTNVDARSQVVHVPIDEKRDLTLKVAPTYQLDIVNSVTLKSFIKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMVQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0206688_1099040113300021345SeawaterPMKIIALAAIAVSFAEASRSATSLAQKALSMTSAGTEAHMHLTNAINIMNANVDARSQLVHVPIDEKRDLTLKVQPTYNLDIVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTLSMMVQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0206688_1099127213300021345SeawaterMTTAGSDAEMHLSNALHTVTKNVDARSQLVHVPIDEKRDLTLKVLPTYNLDIVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMVQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0206695_102718413300021348SeawaterMTRVGTEAHAHLTSAIESMNTNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0206695_121240013300021348SeawaterMTETGSVAHEHLTNALSAMNNNVDARSQVVHVPIDEKRDLSLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPEGNPSLSTTLDKGFPYDD
Ga0206695_156982513300021348SeawaterMTETGTSTHEHLTSALNVLSRNDANSQLVHVPIDEKRDLTLKVSPTYALDIVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIQRKPVEASPAPPRDPYNPEGSPSLAATLDKGFPYDD
Ga0206695_168849913300021348SeawaterKFVQLALATLGVAEATQQRNHLVSQALLMTETGSVAHEHLTNALAAMGGNVDARSQVVHVPIDEKRDLTLKVAPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNITVSMMVQRKPDEAAAAPSKDPYNPDGNPSLAASLDKGFPYDD
Ga0206695_172584213300021348SeawaterMTETGTVAHAHLSNALGSLGGNADARSQLVHVPIDEKRDLTLKVSPTYQLDIVNSITLKSFRKIVGYDTFESIRKKNRSENKDISDYYNVTVSMMVQRKPVEAAAAPAKDPYNPDGNPSLAATLDKGFPYDE
Ga0206695_173121313300021348SeawaterINKNMKLVKLALAAFAMSSTEAVQQKSASELVSRALLMTESGSEAHEHLMSAMYAMNTNVDARSQVVHVPIDEKRDLTLKVSPTYALDLVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMVQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0206692_111422723300021350SeawaterMLMTEAGSEAHAHLSSALANVNPDARSQMVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNTSLAASLDKGFPYDD
Ga0206693_123577413300021353SeawaterMLMTEAGSEAHAHLSQALANVNPDARSQLVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0206693_184757513300021353SeawaterMTESGTQTHAHLNSALEALSKNDANSQLVHVPIDEKRDLTLKVSPTYALDIVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIQRKPVEASPAPPRDPYNPEGAPSLAATLDKGFPYDD
Ga0206693_185505513300021353SeawaterNMKFVTLALAAIMSSADAMQQKSASELVSQALLMTETGSEAHTHLTNAMLSMNTNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAATLDRGFPYDD
Ga0206690_1017106213300021355SeawaterMGGSTVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0206690_1017343913300021355SeawaterMLMTETGSEAHAHLSQALANVNPDARSQLVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNTSLAASLDKGFPYDD
Ga0206690_1021836113300021355SeawaterMTRAGTEAHAHLTSALESMNTNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0206689_1000042013300021359SeawaterINKNMKFVTLALAAIMSSADAMQQKSASELVSQALLMTETGSEAHTHLTNAMLSMNTNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAATLDRGFPYDD
Ga0206689_1019653213300021359SeawaterMSEAGSEVHSHLTNALSVMNTNVDARSQVVHVPIDEKRDLTLKVAPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMVQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0206689_1070478713300021359SeawaterMTETGTVAHAHLSNALGSLGGNADARSQLVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSENKDISDYYNVTVSMMVQRKPVEAAAAPAKDPYNPDGNPSLAATLDKGFPYDE
Ga0206689_1081630413300021359SeawaterMTSAGTEAHMHLTNAINIMNANVDARSQLVHVPIDEKRDLTLKVQPTYNLDIVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTLSMMVQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0206689_1095992313300021359SeawaterMTETGSEAHEHLTNALGSLNANNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0063109_10108113300021866MarineKNMKFVKLVLASLAMADATTQKSAASLVEKALLMTESGTEAHAHLNSALETMKGNDVEARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAQSLDKGFPYDD
Ga0063111_11722113300021868MarineFSKIVKLALGALVVSEANATQNKEAAQLVSQALLMTETGTQTHAHLSNALTALTQNDANSQLVHVPIDEKRDLTLKVSPTYALDVVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIQRKPVEASPAPPRDPYNPEGAPSLAATLDKGFPYDD
Ga0063132_10175513300021872MarineINKNMKFVKLILGALAVTEAAQQKSANELVSQALLMTETGSAAHEHLTSAMSALNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0063132_12007613300021872MarineVKIALCALGMAEAVHQKSASELVSQALLMTETGSESHEHLHSALMAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0063126_101265913300021883MarineTDSAAYNHLTSAMMAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0063125_100275213300021885MarineININMKFVKIALCALGMASAAEQKSANQLVSQALLMTNVDSAAHEHLSSALMAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0063125_101557823300021885MarineMAETIVGSEAHTHLKSALHSMSTNVNPDARSQQVHVPIDEKRDLTLKISPTYQLDIVNSVTLKSFRKIVGYDTFESIRNKSRSESKDISDYYNVTVSMMIQRKPVEAAAAPARDPYNPDGNPSLAASLDKGFPYDD
Ga0063089_101756513300021889MarineMLMTETGSVAHEHLSNALATMGGNTNVDARSQSVHVPIDEKRDLTLKVSPTYQLDLVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0063142_105396923300021893MarineMTKTGTEAHEHLTAAMQSLGANNADARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0063142_106812113300021893MarineFVKLVLASLAMADATTQKSAASLVEKALLMTESGTEAHAHLNSALETMKGNDVEARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAQSLDKGFPYDD
Ga0063873_102940713300021897MarineMTKTGSVAHEHLSNAISALNTNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0063131_111287713300021904MarineVKLALAALAISSVEASALEAYNTNADARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0063106_113108613300021911MarineMLMTDAGSVAHAHLSSALANVNPDARSQLVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNTSLAASLDKGFPYDD
Ga0063133_101080313300021912MarineNNMKFAQIALCALGVTEASRQQSANQLVSQALLMTETGSAAHEHLTQAMHAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0063133_102170513300021912MarineIKMKFVKIALCALGMAEAVHQKSASELVSQALLMTETGSESHEHLHSALMAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0063096_100154113300021925MarineMTESGSIAHAHLTNAVSAMNTNVDARSQIVHVPIDEKRDLSLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0063134_102132013300021928MarineKFVKLVLASLAMADATTQKSAASLVEKALLMTESGTEAHAHLNSALETMKGNDVEARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAQSLDKGFPYDD
Ga0063134_103043313300021928MarineFSKIVKLALGALVVSEANASQNKEAAQLVSQALLMTETGTESHSQLTSALVALSKNDANSQLVHVPIDEKRDLTLKVSPTYALDVVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTISMMIQRKPVEASPAPPRDPYNPEGAPSLAATLDKGFPYDD
Ga0063134_113496113300021928MarineVKLALAAFAMSSTEAVQQKSTSELVSRALLLTEAGTEAHAHLTQALQSLGASGVDARSQVVHVPIDEKRDLTLKVSPTYNLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0063872_105074013300021932MarineVAHEHLSNAISALNTNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0063139_109059713300021934MarineFSKIVKLALGALVVSEANATQNKEAAQLVSQALLMAETGSQTHAHLSNALTALTQNDANSQLVHVPIDEKRDLTLKVSPTYALDVVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIQRKPVEASPAPPRDPYNPEGSPSLAATLDKGFPYDD
Ga0063101_102539413300021950MarineINNMKFVKLALAAFAMSATEAAEQKSASELVSQALLMTQTGTEAHTSLTAAIKVLNVNPDARSQVVHVPIDEKRDLTLKISPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0222717_1021998413300021957Estuarine WaterMTSVDSVAHEHLTNALMSMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0210310_102233713300022369EstuarineMTETGSVAHEHLTNAISALNTNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAATLDKGFPYDD
Ga0228697_12541213300023674SeawaterQAMLMTEEGSEAHTHLASALANVNPDARSQLVHVPIDEKRDLTLKVSPTYQLDFVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNTSLAASLDKGFPYDD
Ga0232113_102274013300023679SeawaterMLMTEVGSEAHAHLSSALANVNPDARSQLVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNTSLAASLDKGFPYDD
Ga0232112_103987713300023693SeawaterLMTETGSAAHEHLTQAMHAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0228683_102220613300023694SeawaterMTETGSAAHEHLTNALSSLGGNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0228680_103426513300023695SeawaterSQALLMTEAGSAAHEHLTQAIHAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0228687_102509013300023696SeawaterFINNMKFAQIALCALGVTEASRQQSANQLVSQALLMTETGSAAHEHLTQAMHAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0228685_107684613300023701SeawaterLLMTETGSAAHEHLTQAMHAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0228684_105450713300023704SeawaterMTETGSAAHEHLTQAMHAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0209634_111657413300025138MarineMKFVKIALCALGMAEAAHQKSATELVSQALLMTETGSAAHEHLSNAIHAMGNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0209634_112087613300025138MarineMKFVQIAFAALGMASAAEQKSANQLVSQALLMTSVDSVAHEHLTNALNSMNTNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNASLAASLDKGFPYDD
Ga0209716_113425013300025626Pelagic MarineEGSEAHAHLANAMASMTDANAKFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYSPNGATTLAATLDKGFPYDD
Ga0208275_103616013300026182MarineMTEEGTSTFEHLTNALHADKANSALLEKNSKLVHVPIDEKRDLTLKVSPTYDLDLVNSVTLKSFRKIVGYDTFESIRKKSRNELKDICDYYNVTLSMMIQRRPVEASPPPVRDPYNPEGATTLAVTLDKGFPYDDXIXDANIHTPS
Ga0208275_105705113300026182MarineLSEEGTSVHAHLSNALHGANAAILEKNSQLVHVPIDEKRDLTLKVSPTYELDLVNSVTLKSFRKIVGYDTFDSIRKKSRSEGKDICDYYNVTVSMMIQRRPVEASPPPVRDPYNPEGAPTLAVTLDKGFPYDD
Ga0247581_107334213300026420SeawaterVTEAAQQKSANELVSQALLMTETGSAAHEHLTNAMSALNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0247559_111421713300026443SeawaterALLMTETGSAAHEHLTSAMFAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYNLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0247594_105569313300026448SeawaterMTKVDSAAHEHLSNALMAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0247593_108725613300026449SeawaterVQLALATLGVAEATNQRSANHLVSQALLMTETGSVAHEHLTNALSAMGGNVDARSQVVHVPIDEKRDLTLKVSPTYNLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0247600_104352213300026461SeawaterMLMTEVGSEAHAHLSSALANVNPDARSQLVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKLVEAAAAPAKDPYNPDGNTSLAASLDKGFPYDD
Ga0247568_107681013300026462SeawaterFVQLALATLGVAEATNQRSANHLVSQALLMTETGSVAHEHLTNALSAMGGNVDARSQVVHVPIDEKRDLTLKVSPTYNLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0247588_107906213300026465SeawaterMSGLEAGSEAHAHLSSALEAFGKTKDPNDAHSQLVTVPIDEKRALTLKVTPTYNLDLVNSVTLKAFRKIVGYDTFDSIRRKERNEAKDISDYYNVTVSMMVQRKPLDLAARPLQMDPYSPTGAPTLAATLDHGFPYDD
Ga0247588_108573013300026465SeawaterLGVAEATNQRSANHLVSQALLMTETGSVAHEHLTNALSAMGGNVDARSQVVHVPIDEKRDLTLKVSPTYNLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0247588_108603413300026465SeawaterMLMTEEGSEAHTHLASALANVNPDARSQLVHVPIDEKRDLTLKVSPTYQLDFVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNTSLAASLDKGFPYDD
Ga0247598_117232513300026466SeawaterMHAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0247603_104941113300026468SeawaterNINMKFVQLALATLGVAEATNQRSANHLVSQALLMTETGSVAHEHLTNALSAMGGNVDARSQVVHVPIDEKRDLTLKVSPTYNLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0247603_110700313300026468SeawaterEASQQKSANQLVSQALLMTNVDSAAHEHLSNALMAMNNNVDARSQVVHVPIDEKRDLTLKVSPIYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0247599_108647513300026470SeawaterMKFVQLALATLGVAEATNQRSANHLVSQALLMTETGSVAHEHLTNALSAMGGNVDARSQVVHVPIDEKRDLTLKVSPTYNLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0247599_114024813300026470SeawaterEASRQQSANQLVSQALLMTETGSAAHEHLTQAMHAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0247571_110182513300026495SeawaterINNMKFAQIALCALGVTEASRQQSANQLVSQALLMTETGSAAHEHLTQAMHAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0247571_113269013300026495SeawaterATLGVAEATNQRSANHLVSQALLMTETGSVAHEHLTNALSAMGGNVDARSQVVHVPIDEKRDLTLKVSPTYNLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0247592_109382613300026500SeawaterINMKFVQLALATLGVAEATNQRSANHLVSQALLMTETGSVAHEHLTNALSAMGGNVDARSQVVHVPIDEKRDLTLKVSPTYNLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0247605_111265613300026503SeawaterLININMKFVQLALATLGVAEATNQRSANHLVSQALLMTETGSVAHEHLTNALSAMGGNVDARSQVVHVPIDEKRDLTLKVSPTYNLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0247590_112244113300026513SeawaterININMKFVQLALATLGVAEATNQRSANHLVSQALLMTETGSVAHEHLTNALSAMGGNVDARSQVVHVPIDEKRDLTLKVSPTYNLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0209092_1061006813300027833MarineMTETGSVAHEHLTNALSAMNNNVDARSQVVHVPIDEKRDLSLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPA
Ga0209503_1062746613300027859MarineIINIFLYTSKMKFVKIALAAFGVAEASQQKSANQLVSQALLMTEVDSAAHEHLSNALMSMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0209404_1024728023300027906MarineMKFVKLALCALGMAEAVHQRSASELVSQALLMTETGSAAHEHLTSAILSMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAATLDRGFPYDE
Ga0209404_1065319923300027906MarineMSFSKIVKLALGALVVSEANASQNKEAAQLVSQALLMTETGTESHSQLTSALVALSKNDANSQLVHVPIDEKRDLTLKVSPTYALDVVNSVTLKSFRKIVGYDTFESIRRKNRNESKDTSDYYNVTVSMMVRRKPAEVASAP
Ga0247596_112033013300028106SeawaterVTEASRQQSANQLVSQALLMTETGSAAHEHLTQAMHAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0247582_113616213300028109SeawaterMLMTEVGSEAHAHLSSALANVNPDARSQLVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPCNPDGNTSLAASLDKGFPYDD
Ga0247584_118940613300028110SeawaterQAMHAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0256411_112719913300028134SeawaterMKFAQIALCALGVTEASRQQSANQLVSQALLMTETGSAAHEHLTQAMHAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0256411_118790913300028134SeawaterMTETGSAAHEHLTNAMMALNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0256411_119947513300028134SeawaterLALCALGAAEASQQKSANQLVSKALLMTNVDSAAHEHLSNALMAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0256412_124909513300028137SeawaterKFVQLALATLGVAEATNQRSANHLVSQALLMTETGSVAHEHLTNALSAMGGNVDARSQVVHVPIDEKRDLTLKVSPTYNLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0256412_124987113300028137SeawaterKMKFVKLALCALGAAEASQQKSANQLVSQALLMTNVDSAAHEHLSNALMAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0256413_123552613300028282SeawaterMKFVKLALCALGAAEASQQKSANQLVSQALLMTNVDSAAHEHLSNALMAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0256413_123749213300028282SeawaterMKFAQIALCALGVTEASRQQSANQLVSQALLMTEAGSAAHEHLTQAIHAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0256413_124921813300028282SeawaterKNMKFVKLILGALAVTEAAQQKSANELVSQALLMTETGSAAHEHLTNAMSALNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0256413_133526313300028282SeawaterLSNALMAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMITQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYD
Ga0247572_113291013300028290SeawaterQAMLMTEVGSEAHAHLSSALANVNPDARSQLVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNTSLAASLDKGFPYDD
Ga0247566_105708113300028335SeawaterNMKFVQLALATLGVAEATNQRSANHLVSQALLMTETGSVAHEHLTNALSAMGGNVDARSQVVHVPIDEKRDLTLKVSPTYNLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0247566_107005613300028335SeawaterGSAAHEHLTQAMHAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0304731_1042300513300028575MarineMSFSKIVKLALGALVVSEVDASQNKEASQLISQALLMTETGTETHAQLTSALSALDANSQLVHVPIDEKRDLTLKVSPTYALDVVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIQRKPVEASPAPPRDPYNPEGAPSLAATLDKGFPYDD
Ga0304731_1051381913300028575MarineLMTEVDTAAHEHLHNALMAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0304731_1122943113300028575MarineINKNMKFVKLVLASLAMADATTQKSAASLVEKALLMTESGTEAHAHLNSALETMKGNDVEARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAQSLDKGFPYDD
Ga0304731_1122992513300028575MarineMTKSGSSVHEHLTNAMASLNTNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0304731_1149406013300028575MarineALASVNAAEQKSASELVSQALLMTKEGTAVHEHLTNAVAALNTGVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKEISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0304731_1162696123300028575MarineMTEAGSDVHQHLTSAIASMGASTVEARSQIVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0307401_1053077813300030670MarineMALQAMSHIRTMNGNVDARSQQVHVPIDEKRDLTLKVSPTYQLDLVNSVTLKSFRKIVGYDTFESIRKKNRGESKDIADYYNVTISMMIQRKPVEAAAAPAKDPYNPDGNPSLS
Ga0307401_1059057113300030670MarineIIYNNMKFVNLALAAIAMSATEAAEQKSATELVTQALLMTDSGSNAHTHLSSALGAMGGTVEARSQQVHVPIDEKRDLTLKISPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTISMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFP
Ga0307398_1054457713300030699MarineLAIAALTSADALQQKSASELVSQALLMTQSGSEAHEHLSNALSSMNTNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAATLDRGFPYDD
Ga0307398_1075930213300030699MarineMSESGSSTHAHLTNALSALSKDLDANSQLVHVPIDEKRDLTLKVSPTYALDIVNSVTLKSFRKIVGYDTFESIRKKNRNESKDISDYYNVTVSMMIQRKPVEASPAPPRDPYNPEGSASLAATLDKGFPYDD
Ga0308133_103512513300030721MarineKFVKLALAAFAMSATEAAEQKSASELVSQALLMTQTGTEAHTSLTAAIKVLNVNPDARSQVVHVPIDEKRDLTLKISPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0308133_104069813300030721MarineMTESGSIAHEHLTNAVSAMNTNVDARSQIVHVPIDEKRDLSLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0308137_107063313300030722MarineNINMKFLTIAFAACVSAVSQKSASELVSQALLMTETGSEAHEHLTSAMLAMNTNVDARSQLVHVPIDEKRDLTLKVSPTYQLDLVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLSATLDHGFPYDD
Ga0308126_103626313300030726MarineMTESGSIAHEHLTNAVSAMNTNVDARSQIVHVPIDEKRDLSLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDK
Ga0073988_1000379013300030780MarineMKFVKIALCALGVAEASQQKSANQLVSQALLMTEVDSAAHEHLQNALMSMQTNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0073988_1232553713300030780MarineQQRAASNLVSQAMLMTETGTAAHEHLSAALAAMGGNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0073988_1235049813300030780MarineNMKFVKLALCALGAAEASQQKSANQLVSQALLMTEVDSVAHEHLSNALMSMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0073988_1235851513300030780MarineALCALGVAEATQQKSANQLVSQALLMTNVDSAAHEHLSNALMAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0073982_1172619413300030781MarineMTETGSAAHEHLTSAMMAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0073982_1174759123300030781MarineMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0073990_1203019813300030856MarineFVKLALCALGAVEAAQQKSANQLVSQALLMTEVDSAAHEHLSNALMAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0073990_1204625713300030856MarineFININMKFVKLALCALGVAEATQQKSANQLVSQALLMTEVDSAAHEHLSNALMAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDE
Ga0073981_1163535413300030857MarineMTETGSEAHQQLRSALNTMNTNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0073981_1171926413300030857MarineALCALGAAEASQQKSANQLVSQALLMTEVDSVAHEHLSNALMSMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0073987_1000041113300030912MarineALCALGMAEAVHQRSANELVSQALLMTETGSAAHEHLSAAMHAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0073987_1121905313300030912MarineANQLVSQALLMTNVDSAAHEHLSNALMAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0073987_1122204913300030912MarineQALLMTNVDSAAHEHLSNALMAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0073987_1122966213300030912MarineANQLVSQALLMTEVDSAAHEHLQNALMSMQTNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPARDPYNPDGNPSLAASLDKGFPYDD
Ga0073985_1100014513300030918MarineFAGAVQQRSASELVSQALLMTETGSAAHEHLTSAMLAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0073984_1128698113300031004MarineALGAAEASQQKSANQLVSQALLMTEVDSVAHEHLSNALMSMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0073986_1000599313300031038MarineMTEVDSAAHEHLSNALMALGNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPARDPYNPDGNPSLAASLDKGFPYDD
Ga0307388_1038368613300031522MarineEIINKYLITFTNKCGAEASQQKSANQLVSQALLMTKVDSVAHEHLSNALMAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0308149_104702213300031542MarineLTSALANVNPDARSQLVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNTSLAASLDKGFPYDD
Ga0308134_115232113300031579MarineVKLALAAFAMSATEAAEQKSASELVSQALLMTQTGTEAHTSLTAAIKVLNVNPDARSQVVHVPIDEKRDLTLKISPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0308132_105945213300031580MarineKFLTIAFAACVSAVSQKSASELVSQALLMTETGSEAHEHLTSAMLAMNTNVYARSQLVHVPIDEKRDLTLKVSPTYQLDLVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLSATLDHGFPYDD
Ga0308132_108219913300031580MarineMYAMNTNVDARSQVVHVPIDEKRDLTLKVAPTYNLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0302114_1020574133300031621MarineMLMTDANSQAHAHLQSALANVNPDARSQLVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNTSLAASLDKGFPYDD
Ga0302126_1024636413300031622MarineMLMTDANSQAHAHLTSALANVNPDARSQLVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNTSLAASLDKGFPYDD
Ga0307994_126016413300031660MarineAAMLMTDANSQAHAHLSSALANVNPDARSQLVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNTSLAASLDKGFPYDD
Ga0308011_1021644213300031688MarineALANVNPDARSQLVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNTSLAASLDKGFPYDD
Ga0307386_1040913513300031710MarineMTKVDSVAHEHLSNALMAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNASLAASLDKGFPYDD
Ga0307386_1046786413300031710MarineMTETGSAAHEHLTAAMQAMNNNVDARAQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0307386_1048311213300031710MarineMTENGSIAHEHLTNALSAMNNNVDARSQVVHVPIDEKRDLSLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNITVSMMIQRKPVEAAAAPAKDPYNPEGNPSLAATLDHGFPYDD
Ga0307386_1053850513300031710MarineLVSQALLMTKVDSVAHEHLSNALMAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0307386_1072881113300031710MarineMHLKNAHGAMGPGGGGAATVDARSQFVHVPIDEKRDLTLKVQPTYNLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMVQRKPVEAAAAPSKDPYNPDGNPSLAASLDKGFPYDD
Ga0307381_1025351813300031725MarineSANELVQKALSMTESGSAVHQHLSNAVVALNTNVDARSQIVHVPIDEKRDLSLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0307381_1030878213300031725MarineSQQKSANQLVSQALLMTKVDSVAHEHLSNALMAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVDAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0307397_1035144713300031734MarineTLAAIAMSSIEATTQKSATDLVSQALLMTKVGSEAHEHLSMAISTLNTNVDARSQNVHVPIDEKRDLTLKISPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0307394_1041544613300031735MarineEASQQKAATELVTQALLMTEAGSMAHTQLSSALETMGGTVDQRSQSVHVPIDEKRDLTLKISPTYQLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0307387_1029249213300031737MarineGAAEASQQKSANQLVSQALLMTKVDSVAHEHLSNALMAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0307387_1078076413300031737MarineMTETGSIAHEHLTNALSAMNNNVDARSQVVHVPIDEKRDLSLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNITVSMMIQRKPVEAAAAPAKDPYNPEGNPSLAATLDHGFPYDD
Ga0307384_1046100613300031738MarineIKMKFVSIALCALSVTEAAQQKSANQLVSQALLMTKVDSVAHEHLSNALMAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNASLAASLDKGFPYDD
Ga0307384_1059953013300031738MarineDSVAHEHLSNALMAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0307383_1045648413300031739MarineMTESGSEAHEHLTQAMFAMNTNNVDARSQVVHVPIDEKRDLTLKVSPTYNLDIVNSVTLKSFRKIVGYDTFESIRKKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0307395_1031035513300031742MarineNMKFVNLALAAIAMASTEAAEQKSATELVQQALLMTDTGSNAHTHLSSALGAMGGTVEARSQQVHVPIDEKRDLTLKISPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTISMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0307382_1040767813300031743MarineEASQQKSANQLVSQALLMTKVDSVAHEHLSNALMAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0307389_1050302923300031750MarineSNALMAMNNNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0314674_1062148413300032615SeawaterAQAAAVQTENTMALVADAMSQLESGSAAHAHLSSALASLNGAEFTDAEILASHSQLVSVPIDEKRALALKVAPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMLIQRKPVEAAAAPASDPYAPNGASSLASTLDKGFPYDD
Ga0314671_1051821423300032616SeawaterMTSVDSVAHEHLTNALKSMGGNVDARSQVVHVPIDDKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSMMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD
Ga0314678_1004417023300032666SeawaterMALVADAMSQLESGSAAHAHLSSALASLNGAEFTDAEILASHSQLVSVPIDEKRALALKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKNRSEAKDTSDYYNVTVSMMIQRKPVEAAAAPASDPYAPNGAQTLASTLDKGFPYDD
Ga0314681_1069982013300032711SeawaterMLMTETGSVAHEHLSNALATMGGNTNVDARSQSVHVPIDEKRDLTLKVSPTYQLDLVNSVTLKSFRKIIGYDTFNSILKENRNESKDLNDYYNVTVSMMIQRVPESKIDYEELKMADGKTLAASLDKGFPYDDSNIATSNLESISTLTVKDVVQ
Ga0314700_1040234123300032752SeawaterMTSVDSVAHEHLTNALKSMGGNVDARSQVVHVPIDEKRDLTLKVSPTYQLDIVNSVTLKSFRKIVGYDTFESIRRKNRSESKDISDYYNVTVSLMIQRKPVEAAAAPAKDPYNPDGNPSLAASLDKGFPYDD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.